Citrus Sinensis ID: 026809

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230---
MKMEWPNFQQGGEMERQFQQDGGDTSNGLCVKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQNEIAGMRMGNPYFDPFVASGSQKLTARQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQNRRARLKRKQSGVVPNNAESEAETVTHAESRKQNPESIQSLEDSAPPPRDEDIYPQSPDLGIDQMIGKMEIPGSFSFHWQVDRYDMLG
ccccccccccccHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccEEEcccccHHHHHHHHccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccHHHHHHccccccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHccccccccccccHHHcccccccccHHHHccccccccccccHHHHHcccccc
mkmewpnfqqggemerqfqqdggdtsnglCVKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQNEiagmrmgnpyfdpfvasgsqkltarqrwtptpaqlQILEHVYdeckgtprkqKIQDMTAELAKhgqisetnvYNWFQNRRARLkrkqsgvvpnnaeseaetvthaesrkqnpesiqsledsappprdediypqspdlgidqmigkmeipgsfsfhwqvdrydmlg
mkmewpnfqQGGEMERQFQQDGGDTSNGLCVKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQNEIAGMRMGNPYFDPFVASGSQKLTARQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAkhgqisetnvyNWFQNRRARLkrkqsgvvpnnaeseaetvthaesrkqnpesiqsledsappprdediyPQSPDLGIDQMIGKMEIPGSFSFHWQVDRYDMLG
MKMEWPNFQQGGEMERQFQQDGGDTSNGLCVKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQNEIAGMRMGNPYFDPFVASGSQKLTARQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQNRRARLKRKQSGVVPNNAESEAETVTHAESRKQNPESIQSLEDSAPPPRDEDIYPQSPDLGIDQMIGKMEIPGSFSFHWQVDRYDMLG
***************************GLCVKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQNEIAGMRMGNPYFDPFVASGSQKLTARQRWTPTPAQLQILEHVYDECKG**************AKHGQISETNVYNWFQN************************************************************IDQMIGKMEIPGSFSFHWQVDRY****
*********************************MTDEQMELLRKQIAVYAMICEQLVQ*****************************************PAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQ************************************************************************************D***
********QQGGEMERQFQQDGGDTSNGLCVKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQNEIAGMRMGNPYFDPFVASGSQKLTARQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQNRRAR*******************************************RDEDIYPQSPDLGIDQMIGKMEIPGSFSFHWQVDRYDMLG
************************TSNGLCVKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQNEIAGMRMGNPYFDPFVAS*****TARQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQNRRARLK***************************************PPRDEDIYPQSPDLGIDQMIGKMEIPGSFSFHWQVDRYDML*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKMEWPNFQQGGEMERQFQQDGGDTSNGLCVKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQNEIAGMRMGNPYFDPFVASGSQKLTARQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQNRRARLKRKQSGVVPNNAESEAETVTHAESRKQNPESIQSLEDSAPPPRDEDIYPQSPDLGIDQMIGKMEIPGSFSFHWQVDRYDMLG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query233 2.2.26 [Sep-21-2011]
O81788268 WUSCHEL-related homeobox yes no 0.871 0.757 0.466 2e-51
Q5QMM3267 WUSCHEL-related homeobox yes no 0.562 0.490 0.706 2e-51
Q9LM84211 WUSCHEL-related homeobox no no 0.751 0.829 0.505 3e-43
Q9LM83197 Putative WUSCHEL-related no no 0.746 0.883 0.473 4e-32
Q9SIB4244 WUSCHEL-related homeobox no no 0.274 0.262 0.484 4e-10
Q6X7K0 350 WUSCHEL-related homeobox no no 0.261 0.174 0.459 5e-10
Q6X7J5 325 WUSCHEL-related homeobox no no 0.266 0.190 0.403 2e-09
Q6X7J4 378 WUSCHEL-related homeobox no no 0.266 0.164 0.387 3e-09
Q5W7C3 286 Putative WUSCHEL-related no no 0.257 0.209 0.466 3e-09
A2XZR3 286 Putative WUSCHEL-related N/A no 0.257 0.209 0.466 4e-09
>sp|O81788|WOX13_ARATH WUSCHEL-related homeobox 13 OS=Arabidopsis thaliana GN=WOX13 PE=2 SV=1 Back     alignment and function desciption
 Score =  201 bits (512), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 111/238 (46%), Positives = 144/238 (60%), Gaps = 35/238 (14%)

Query: 29  LCVKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQNEIAGMRMGNPYFDPFVASGSQ 88
           + VKVMTDEQ E LRKQIA+Y  ICE+LV+MHK  +AQ ++AG RMG  Y DP ++S   
Sbjct: 33  MYVKVMTDEQYETLRKQIAIYGTICERLVEMHKTLTAQQDLAGGRMGGLYADPMMSSLGH 92

Query: 89  KLTARQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQNRR 148
           K+TARQRWTPTP QLQILE ++D+  GTP KQKI+D+T EL++HGQI+E NVYNWFQNRR
Sbjct: 93  KMTARQRWTPTPVQLQILERIFDQGTGTPSKQKIKDITEELSQHGQIAEQNVYNWFQNRR 152

Query: 149 ARLKRKQ-------SGVVPNNAESEAETVTHAESRKQNPESIQSLEDS------------ 189
           AR KRKQ       +    +  E+E E +   E R   PES+  L D             
Sbjct: 153 ARSKRKQHGGGSSGNNNGESEVETEVEALN--EKRVVRPESLLGLPDGNSNNNGLGTTTA 210

Query: 190 -APPPRDEDIYPQSPDLGID-------------QMIGKMEIPGSFSFHWQVDRYDMLG 233
               PR ED+  QSP++  D              ++GKM +  S++ +  V+ Y M G
Sbjct: 211 TTTAPRPEDLCFQSPEISSDLHLLDVLSNPRDEHLVGKMGLAESYNLYDHVEDYGMSG 268
Transcription factor which may be involved in developmental processes.
Arabidopsis thaliana (taxid: 3702)
>sp|Q5QMM3|WOX8_ORYSJ WUSCHEL-related homeobox 8 OS=Oryza sativa subsp. japonica GN=WOX8 PE=2 SV=1 Back     alignment and function description
>sp|Q9LM84|WOX14_ARATH WUSCHEL-related homeobox 14 OS=Arabidopsis thaliana GN=WOX14 PE=2 SV=1 Back     alignment and function description
>sp|Q9LM83|WOX10_ARATH Putative WUSCHEL-related homeobox 10 OS=Arabidopsis thaliana GN=WOX10 PE=3 SV=1 Back     alignment and function description
>sp|Q9SIB4|WOX3_ARATH WUSCHEL-related homeobox 3 OS=Arabidopsis thaliana GN=WOX3 PE=2 SV=1 Back     alignment and function description
>sp|Q6X7K0|WOX1_ARATH WUSCHEL-related homeobox 1 OS=Arabidopsis thaliana GN=WOX1 PE=2 SV=2 Back     alignment and function description
>sp|Q6X7J5|WOX8_ARATH WUSCHEL-related homeobox 8 OS=Arabidopsis thaliana GN=WOX8 PE=2 SV=1 Back     alignment and function description
>sp|Q6X7J4|WOX9_ARATH WUSCHEL-related homeobox 9 OS=Arabidopsis thaliana GN=WOX9 PE=2 SV=1 Back     alignment and function description
>sp|Q5W7C3|WOX2_ORYSJ Putative WUSCHEL-related homeobox 2 OS=Oryza sativa subsp. japonica GN=WOX2 PE=3 SV=1 Back     alignment and function description
>sp|A2XZR3|WOX2_ORYSI Putative WUSCHEL-related homeobox 2 OS=Oryza sativa subsp. indica GN=WOX2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query233
224083324216 predicted protein [Populus trichocarpa] 0.892 0.962 0.592 4e-68
224065679215 predicted protein [Populus trichocarpa] 0.918 0.995 0.588 5e-68
40233067217 homeodomain protein HB1 [Populus tomento 0.918 0.986 0.582 2e-66
3955019217 HB1 homeodomain protein [Populus tremula 0.918 0.986 0.582 2e-66
224081491248 predicted protein [Populus trichocarpa] 0.866 0.814 0.584 4e-64
40233087257 homeodomain protein HB2 [Populus tomento 0.866 0.785 0.580 1e-63
3955021261 HB2 homeodomain protein [Populus tremula 0.866 0.773 0.580 1e-63
356508610208 PREDICTED: WUSCHEL-related homeobox 8-li 0.888 0.995 0.563 2e-61
225457574279 PREDICTED: WUSCHEL-related homeobox 8 [V 0.871 0.727 0.516 4e-61
147865345243 hypothetical protein VITISV_018997 [Viti 0.849 0.814 0.510 3e-59
>gi|224083324|ref|XP_002306983.1| predicted protein [Populus trichocarpa] gi|222856432|gb|EEE93979.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  263 bits (672), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 163/216 (75%), Gaps = 8/216 (3%)

Query: 20  QDGGDTSNGLCVKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQNEIAGMRMGNPYF 79
           Q+GG    GL VKVMTDEQME+LRKQI+VYA ICEQLV+MHK  S   + AGMR+GNPYF
Sbjct: 7   QNGG----GLGVKVMTDEQMEMLRKQISVYATICEQLVEMHKALSVHQDFAGMRLGNPYF 62

Query: 80  -DPFVASGSQKLTARQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISET 138
            DP ++S   K+ +RQRWTP PAQL+ILE ++ +C  TP +QKI+D+T ELA+HGQISET
Sbjct: 63  CDPLLSSSVHKIGSRQRWTPKPAQLEILEQIFKQCNATPGRQKIKDITKELAQHGQISET 122

Query: 139 NVYNWFQNRRARLKRKQSGVVPNNAESEAET-VTHAESRKQNPESIQSLEDSAPPPRDED 197
           NVYNWFQNRRAR KRKQS ++PN+ ESE ET +   + +K  PE  Q  ED+   P  + 
Sbjct: 123 NVYNWFQNRRARSKRKQSALLPNSGESEVETEIEPFKEKKTKPEDNQPDEDAT--PVSDH 180

Query: 198 IYPQSPDLGIDQMIGKMEIPGSFSFHWQVDRYDMLG 233
           +Y  SPD+GIDQ++GKME PGS   +WQ+++YD+ G
Sbjct: 181 MYLHSPDIGIDQLVGKMESPGSCIPYWQLEQYDLFG 216

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224065679|ref|XP_002301917.1| predicted protein [Populus trichocarpa] gi|222843643|gb|EEE81190.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|40233067|gb|AAR83340.1| homeodomain protein HB1 [Populus tomentosa] gi|40233103|gb|AAR83342.1| homeodomain protein HB1 [Populus tomentosa] Back     alignment and taxonomy information
>gi|3955019|emb|CAA09366.1| HB1 homeodomain protein [Populus tremula x Populus tremuloides] Back     alignment and taxonomy information
>gi|224081491|ref|XP_002306432.1| predicted protein [Populus trichocarpa] gi|222855881|gb|EEE93428.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|40233087|gb|AAR83341.1| homeodomain protein HB2 [Populus tomentosa] Back     alignment and taxonomy information
>gi|3955021|emb|CAA09367.1| HB2 homeodomain protein [Populus tremula x Populus tremuloides] Back     alignment and taxonomy information
>gi|356508610|ref|XP_003523048.1| PREDICTED: WUSCHEL-related homeobox 8-like [Glycine max] Back     alignment and taxonomy information
>gi|225457574|ref|XP_002272420.1| PREDICTED: WUSCHEL-related homeobox 8 [Vitis vinifera] gi|297745565|emb|CBI40730.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147865345|emb|CAN84082.1| hypothetical protein VITISV_018997 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query233
TAIR|locus:2127968268 WOX13 "AT4G35550" [Arabidopsis 0.798 0.694 0.561 2e-53
TAIR|locus:2030467211 WOX14 "AT1G20700" [Arabidopsis 0.836 0.924 0.476 5.9e-41
TAIR|locus:2030487197 WOX10 "AT1G20710" [Arabidopsis 0.755 0.893 0.462 4.9e-37
UNIPROTKB|Q33DK1203 WOX3 "WUSCHEL-related homeobox 0.274 0.315 0.468 3.5e-11
TAIR|locus:2057614 378 HB-3 "homeobox-3" [Arabidopsis 0.557 0.343 0.285 1e-10
TAIR|locus:2088550 350 WOX1 "WUSCHEL related homeobox 0.351 0.234 0.4 5.2e-10
TAIR|locus:2065484244 PRS "PRESSED FLOWER" [Arabidop 0.270 0.258 0.492 1.2e-09
TAIR|locus:2096429 297 WOX11 "AT3G03660" [Arabidopsis 0.390 0.306 0.369 2.2e-09
TAIR|locus:2825767251 WOX4 "WUSCHEL related homeobox 0.261 0.243 0.459 5.5e-09
TAIR|locus:2060902 292 WUS "AT2G17950" [Arabidopsis t 0.412 0.328 0.362 1e-08
TAIR|locus:2127968 WOX13 "AT4G35550" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 518 (187.4 bits), Expect = 2.0e-53, Sum P(2) = 2.0e-53
 Identities = 110/196 (56%), Positives = 130/196 (66%)

Query:     3 MEWPN-FQQGGEMERQFQQ---DGGD-TSNGLCVKVMTDEQMELLRKQIAVYAMICEQLV 57
             MEW N  Q         Q    +GG     G+ VKVMTDEQ E LRKQIA+Y  ICE+LV
Sbjct:     2 MEWDNQLQPNNHHSSNLQGIDVNGGSGAGGGMYVKVMTDEQYETLRKQIAIYGTICERLV 61

Query:    58 QMHKVFSAQNEIAGMRMGNPYFDPFVASGSQKLTARQRWTPTPAQLQILEHVYDECKGTP 117
             +MHK  +AQ ++AG RMG  Y DP ++S   K+TARQRWTPTP QLQILE ++D+  GTP
Sbjct:    62 EMHKTLTAQQDLAGGRMGGLYADPMMSSLGHKMTARQRWTPTPVQLQILERIFDQGTGTP 121

Query:   118 RKQKIQDMTAELAKHGQISETNVYNWFQNRRARLKRKQSGVVP---NNAESEAETVTHA- 173
              KQKI+D+T EL++HGQI+E NVYNWFQNRRAR KRKQ G      NN ESE ET   A 
Sbjct:   122 SKQKIKDITEELSQHGQIAEQNVYNWFQNRRARSKRKQHGGGSSGNNNGESEVETEVEAL 181

Query:   174 -ESRKQNPESIQSLED 188
              E R   PES+  L D
Sbjct:   182 NEKRVVRPESLLGLPD 197
GO:0003677 "DNA binding" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
TAIR|locus:2030467 WOX14 "AT1G20700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030487 WOX10 "AT1G20710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q33DK1 WOX3 "WUSCHEL-related homeobox 3" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2057614 HB-3 "homeobox-3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2088550 WOX1 "WUSCHEL related homeobox 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065484 PRS "PRESSED FLOWER" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096429 WOX11 "AT3G03660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825767 WOX4 "WUSCHEL related homeobox 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060902 WUS "AT2G17950" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5QMM3WOX8_ORYSJNo assigned EC number0.70670.56220.4906yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query233
pfam0004657 pfam00046, Homeobox, Homeobox domain 1e-14
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 9e-12
smart0038957 smart00389, HOX, Homeodomain 9e-11
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 4e-04
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 65.6 bits (161), Expect = 1e-14
 Identities = 25/61 (40%), Positives = 37/61 (60%), Gaps = 5/61 (8%)

Query: 93  RQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQNRRARLK 152
           R+R T TP QL+ LE  +++ +  P  ++ +    ELAK   ++E  V  WFQNRRA+ K
Sbjct: 2   RKRTTFTPEQLEELEKEFEKNR-YPSAEERE----ELAKKLGLTERQVKVWFQNRRAKWK 56

Query: 153 R 153
           R
Sbjct: 57  R 57

Length = 57
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 233
KOG3802398 consensus Transcription factor OCT-1, contains POU 100.0
KOG1168385 consensus Transcription factor ACJ6/BRN-3, contain 99.77
KOG0489261 consensus Transcription factor zerknullt and relat 99.73
KOG0484125 consensus Transcription factor PHOX2/ARIX, contain 99.72
KOG4577383 consensus Transcription factor LIM3, contains LIM 99.72
KOG0488309 consensus Transcription factor BarH and related HO 99.71
KOG0843197 consensus Transcription factor EMX1 and related HO 99.71
KOG2251228 consensus Homeobox transcription factor [Transcrip 99.68
KOG0487308 consensus Transcription factor Abd-B, contains HOX 99.67
KOG0842307 consensus Transcription factor tinman/NKX2-3, cont 99.66
KOG0850245 consensus Transcription factor DLX and related pro 99.66
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.61
KOG0485268 consensus Transcription factor NKX-5.1/HMX1, conta 99.6
KOG0492246 consensus Transcription factor MSH, contains HOX d 99.6
KOG0494332 consensus Transcription factor CHX10 and related H 99.56
KOG0848317 consensus Transcription factor Caudal, contains HO 99.51
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.49
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.47
KOG0493342 consensus Transcription factor Engrailed, contains 99.47
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.46
KOG0491194 consensus Transcription factor BSH, contains HOX d 99.44
COG5576156 Homeodomain-containing transcription factor [Trans 99.41
KOG0844408 consensus Transcription factor EVX1, contains HOX 99.39
KOG0486 351 consensus Transcription factor PTX1, contains HOX 99.37
KOG0490235 consensus Transcription factor, contains HOX domai 99.36
KOG0483198 consensus Transcription factor HEX, contains HOX a 99.35
KOG0847288 consensus Transcription factor, contains HOX domai 99.29
PF0015775 Pou: Pou domain - N-terminal to homeobox domain; I 99.07
KOG0849354 consensus Transcription factor PRD and related pro 98.92
KOG0775304 consensus Transcription factor SIX and related HOX 98.75
KOG0774334 consensus Transcription factor PBX and related HOX 98.65
smart0035275 POU Found in Pit-Oct-Unc transcription factors. 98.26
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.17
KOG0490235 consensus Transcription factor, contains HOX domai 98.0
KOG2252558 consensus CCAAT displacement protein and related h 97.81
KOG1146 1406 consensus Homeobox protein [General function predi 97.32
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 95.74
KOG0773342 consensus Transcription factor MEIS1 and related H 95.35
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 93.9
PF0888037 QLQ: QLQ; InterPro: IPR014978 QLQ is named after t 88.24
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 85.21
>KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] Back     alignment and domain information 
Probab=100.00  E-value=7.7e-36  Score=271.79  Aligned_cols=141  Identities=19%  Similarity=0.218  Sum_probs=123.7

Q ss_pred             CcccccchhhhhhccCCCcCCCcccccCCHHHHHHHHHHHHHHHHHHHHHHHhhhhhccchhhccCCCCCCCCCCCccCC
Q 026809            7 NFQQGGEMERQFQQDGGDTSNGLCVKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQNEIAGMRMGNPYFDPFVASG   86 (233)
Q Consensus         7 ~~~~~~~~~~~~q~~~~~~~~~~~~~~~t~~~~~~lr~qi~~y~~ic~q~~~~~~~l~~~~~~~~~~~~~~~~~p~~~s~   86 (233)
                      .|||++++++++|+|||+|+|+|||+|||||+||||+++.++|++||+..++|.|||.+++..... .+..+.+.+   .
T Consensus       214 ~FKqRRIkLGfTQaDVGlALG~lyGn~FSQTTIcRFEALqLSFKNMCKLKPLL~KWLeEAes~~~~-~~~~~~e~i---~  289 (398)
T KOG3802|consen  214 TFKQRRIKLGFTQADVGLALGALYGNVFSQTTICRFEALQLSFKNMCKLKPLLEKWLEEAESREST-GSPNSIEKI---G  289 (398)
T ss_pred             HHHhheeccccchhHHHHHHHhhhCcccchhhhhHhHhhccCHHHHhhhHHHHHHHHHHHhccccc-CCCCCHHHh---h
Confidence            599999999999999999999999999999999999999999999999999999999998763111 111222222   1


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHhhcCCCCCHHHHHHHHHHHHhhCCCcccceeeccccchhhHHhhhc
Q 026809           87 SQKLTARQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQNRRARLKRKQS  156 (233)
Q Consensus        87 ~~~~~rr~Rt~~t~~Ql~~Le~~F~~~~~~P~~~~r~~LA~~L~~~~gls~~qV~vWFQNRR~k~Kr~~~  156 (233)
                      ...|+|++||+|....+..||+.|.+| ++|+.++|..||.+|    +|+..+|+|||||||+|+||...
T Consensus       290 a~~RkRKKRTSie~~vr~aLE~~F~~n-pKPt~qEIt~iA~~L----~leKEVVRVWFCNRRQkeKR~~~  354 (398)
T KOG3802|consen  290 AQSRKRKKRTSIEVNVRGALEKHFLKN-PKPTSQEITHIAESL----QLEKEVVRVWFCNRRQKEKRITP  354 (398)
T ss_pred             ccccccccccceeHHHHHHHHHHHHhC-CCCCHHHHHHHHHHh----ccccceEEEEeeccccccccCCC
Confidence            222688899999999999999999999 899999999999999    99999999999999999999766

>KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG2251 consensus Homeobox transcription factor [Transcription] Back     alignment and domain information
>KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0485 consensus Transcription factor NKX-5 Back     alignment and domain information
>KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] Back     alignment and domain information
>KOG0847 consensus Transcription factor, contains HOX domain [Transcription] Back     alignment and domain information
>PF00157 Pou: Pou domain - N-terminal to homeobox domain; InterPro: IPR000327 POU proteins are eukaryotic transcription factors containing a bipartite DNA binding domain referred to as the POU domain Back     alignment and domain information
>KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] Back     alignment and domain information
>KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] Back     alignment and domain information
>smart00352 POU Found in Pit-Oct-Unc transcription factors Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PF08880 QLQ: QLQ; InterPro: IPR014978 QLQ is named after the conserved Gln, Leu, Gln motif Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query233
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 1e-15
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 1e-10
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 6e-10
1lfb_A99 Liver transcription factor (LFB1); transcription r 2e-09
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 1e-08
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 1e-08
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 1e-08
2xsd_C164 POU domain, class 3, transcription factor 1; trans 2e-08
1uhs_A72 HOP, homeodomain only protein; structural genomics 7e-08
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 1e-07
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 2e-07
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 3e-07
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 6e-07
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 8e-07
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 1e-06
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 2e-06
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-06
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 3e-06
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 3e-06
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 3e-06
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 6e-06
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 7e-06
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 8e-06
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 1e-05
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 1e-05
3d1n_I151 POU domain, class 6, transcription factor 1; prote 1e-05
1e3o_C160 Octamer-binding transcription factor 1; transcript 1e-05
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 2e-05
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 2e-05
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 2e-05
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 2e-05
3a02_A60 Homeobox protein aristaless; homeodomain, developm 3e-05
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 3e-05
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 3e-05
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 3e-05
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 3e-05
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 4e-05
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 6e-05
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 6e-05
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 6e-05
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 8e-05
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 1e-04
3a01_A93 Homeodomain-containing protein; homeodomain, prote 1e-04
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 2e-04
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 2e-04
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 2e-04
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 2e-04
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 2e-04
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 3e-04
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 4e-04
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 5e-04
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 8e-04
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 9e-04
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
 Score = 68.9 bits (168), Expect = 1e-15
 Identities = 19/88 (21%), Positives = 40/88 (45%), Gaps = 14/88 (15%)

Query: 93  RQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAE-----------LAKHGQISETNVY 141
             R+T     L ++E  ++E +  P + K +++              L+   +++   VY
Sbjct: 9   GSRFTWRKECLAVMESYFNENQ-YPDEAKREEIANACNAVIQKPGKKLSDLERVTSLKVY 67

Query: 142 NWFQNRRARLKRKQ--SGVVPNNAESEA 167
           NWF NRR  +KR+   + ++ ++  S  
Sbjct: 68  NWFANRRKEIKRRANIAAILESSGPSSG 95
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query233
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.96
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.96
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.96
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.95
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.95
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.79
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.79
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.78
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.78
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.77
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.77
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.77
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.77
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.77
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.77
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.76
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.76
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.76
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.76
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.76
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.76
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.76
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.76
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.76
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.76
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.76
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.75
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.75
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.75
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.75
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.75
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.75
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.75
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.75
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.75
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.75
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.74
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.74
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.74
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.73
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.73
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.73
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.73
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.73
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.72
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.72
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.72
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.71
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.71
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.71
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.71
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.7
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.7
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.7
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.69
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.68
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.68
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.67
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.67
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.67
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.67
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.66
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.66
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.65
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.64
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.64
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.63
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.62
2e19_A64 Transcription factor 8; homeobox domain, structura 99.62
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.6
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.59
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.57
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.51
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.38
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.38
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.27
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.2
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.61
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 92.62
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
Probab=99.96  E-value=5.2e-31  Score=213.63  Aligned_cols=136  Identities=20%  Similarity=0.265  Sum_probs=114.9

Q ss_pred             CcccccchhhhhhccCCCcCCCcccccCCHHHHHHHHHHHHHHHHHHHHHHHhhhhhccchhhccCCCCCCCCCCCccCC
Q 026809            7 NFQQGGEMERQFQQDGGDTSNGLCVKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQNEIAGMRMGNPYFDPFVASG   86 (233)
Q Consensus         7 ~~~~~~~~~~~~q~~~~~~~~~~~~~~~t~~~~~~lr~qi~~y~~ic~q~~~~~~~l~~~~~~~~~~~~~~~~~p~~~s~   86 (233)
                      .|+|.++..+.+|+|||+++|.+||+++|+++||+|+++.+++.++|+..+.+.+|+.+.....+.        +....+
T Consensus        11 ~~k~~ri~lg~tQ~~vg~al~~l~g~~~Sqtti~rfe~l~ls~knm~kLkPlL~~wl~e~e~~~~~--------~~~~~~   82 (146)
T 1au7_A           11 EFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGAL--------YNEKVG   82 (146)
T ss_dssp             HHHHHHHHHTCCHHHHHHHHHHTTSSCCCHHHHHHHHTTCSBHHHHHHHHHHHHHHHHHCCC------------------
T ss_pred             HHHHHHHhccCcHHhhhhhcchhccCCCCcchHHHHhccCCChHHHHhcchHHHHHHHHhhcccCc--------cCcccC
Confidence            378999999999999999999999999999999999999999999999999999999987643211        111123


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHhhcCCCCCHHHHHHHHHHHHhhCCCcccceeeccccchhhHHhhh
Q 026809           87 SQKLTARQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQNRRARLKRKQ  155 (233)
Q Consensus        87 ~~~~~rr~Rt~~t~~Ql~~Le~~F~~~~~~P~~~~r~~LA~~L~~~~gls~~qV~vWFQNRR~k~Kr~~  155 (233)
                      ..+++||.|+.|+..|+.+||..|..+ +||+..+|..||..|    ||++++|+|||||||+|+||++
T Consensus        83 ~~~~~rr~Rt~ft~~Q~~~Le~~F~~~-~yp~~~~r~~LA~~l----~L~~~qV~vWFqNRR~k~kr~k  146 (146)
T 1au7_A           83 ANERKRKRRTTISIAAKDALERHFGEH-SKPSSQEIMRMAEEL----NLEKEVVRVWFCNRRQREKRVK  146 (146)
T ss_dssp             ------CCCCCCCHHHHHHHHHHHHHC-SSCCHHHHHHHHHHH----TCCHHHHHHHHHHHHHHTTSCC
T ss_pred             CCCCCCCCCcCccHHHHHHHHHHHHHc-CCCCHHHHHHHHHHh----CCChhhchhhhHhhhhhhhccC
Confidence            345678889999999999999999999 999999999999999    9999999999999999999853
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 233
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 2e-11
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 2e-11
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 2e-11
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 3e-11
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 9e-11
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 2e-10
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 2e-10
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 6e-10
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 9e-10
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 9e-10
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 1e-09
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 1e-09
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 2e-09
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 2e-09
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 2e-09
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 2e-09
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 3e-09
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 3e-09
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 5e-09
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 6e-09
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 7e-09
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 8e-09
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 1e-08
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 3e-08
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 3e-08
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 3e-08
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 4e-08
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 8e-08
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 1e-07
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 4e-07
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 3e-06
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 4e-05
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: pbx1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 56.1 bits (135), Expect = 2e-11
 Identities = 18/63 (28%), Positives = 27/63 (42%), Gaps = 2/63 (3%)

Query: 93  RQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQNRRARLK 152
           R+R        +IL   +      P   +  +   ELAK   I+ + V NWF N+R R K
Sbjct: 3   RKRRNFNKQATEILNEYFYSHLSNPYPSE--EAKEELAKKCGITVSQVSNWFGNKRIRYK 60

Query: 153 RKQ 155
           +  
Sbjct: 61  KNI 63
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query233
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.81
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.81
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.81
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.8
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.8
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.8
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.8
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.79
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.79
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.79
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.78
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.78
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.78
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.76
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.76
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.74
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.74
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.74
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.73
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.72
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.71
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.7
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.7
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.67
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.65
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.63
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.62
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.62
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.57
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.53
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.48
d1e3oc275 Oct-1 {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1au7a272 Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.29
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeotic bicoid protein
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=99.81  E-value=6.6e-21  Score=133.34  Aligned_cols=63  Identities=29%  Similarity=0.398  Sum_probs=59.1

Q ss_pred             CCCCCCCCCHHHHHHHHHHHhhcCCCCCHHHHHHHHHHHHhhCCCcccceeeccccchhhHHhhhcCC
Q 026809           91 TARQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQNRRARLKRKQSGV  158 (233)
Q Consensus        91 ~rr~Rt~~t~~Ql~~Le~~F~~~~~~P~~~~r~~LA~~L~~~~gls~~qV~vWFQNRR~k~Kr~~~~~  158 (233)
                      +||.|++||+.|+.+||..|..+ +||+..++.+||..|    ||++++|+|||||||+|+|+.....
T Consensus         1 Prr~Rt~ft~~Ql~~Le~~F~~~-~yp~~~~r~~LA~~l----~l~~~~V~iWFqNrR~k~kk~~~~~   63 (67)
T d1zq3p1           1 PRRTRTTFTSSQIAELEQHFLQG-RYLTAPRLADLSAKL----ALGTAQVKIWFKNRRRRHKIQSDQH   63 (67)
T ss_dssp             CSCCSCCCCHHHHHHHHHHHTTC-SSCCHHHHHHHHHHH----TSCHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             CCCCCCcCCHHHHHHHHHHHHHC-CCCCHHHHHHHHHHh----CCCccceeeccccHHHhHhhhhhhc
Confidence            35779999999999999999999 999999999999999    9999999999999999999877654
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc2 a.35.1.1 (C:1-75) Oct-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a2 a.35.1.1 (A:5-76) Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure