Citrus Sinensis ID: 026812
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 232 | ||||||
| 255586233 | 276 | Protein C9orf32, putative [Ricinus commu | 0.659 | 0.554 | 0.770 | 1e-64 | |
| 224115626 | 276 | predicted protein [Populus trichocarpa] | 0.659 | 0.554 | 0.707 | 2e-60 | |
| 297791381 | 335 | hypothetical protein ARALYDRAFT_494541 [ | 0.672 | 0.465 | 0.7 | 1e-59 | |
| 356528088 | 336 | PREDICTED: alpha N-terminal protein meth | 0.801 | 0.553 | 0.591 | 9e-59 | |
| 449433531 | 275 | PREDICTED: alpha N-terminal protein meth | 0.659 | 0.556 | 0.687 | 6e-58 | |
| 145358849 | 334 | methyltransferase [Arabidopsis thaliana] | 0.668 | 0.464 | 0.695 | 1e-57 | |
| 356510746 | 278 | PREDICTED: alpha N-terminal protein meth | 0.659 | 0.550 | 0.685 | 8e-57 | |
| 75321280 | 276 | RecName: Full=Alpha N-terminal protein m | 0.655 | 0.550 | 0.702 | 9e-57 | |
| 358348179 | 348 | Methyltransferase-like protein 11A [Medi | 0.659 | 0.439 | 0.630 | 3e-52 | |
| 9758698 | 252 | unnamed protein product [Arabidopsis tha | 0.577 | 0.531 | 0.728 | 2e-50 |
| >gi|255586233|ref|XP_002533771.1| Protein C9orf32, putative [Ricinus communis] gi|223526308|gb|EEF28616.1| Protein C9orf32, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 252 bits (643), Expect = 1e-64, Method: Compositional matrix adjust.
Identities = 121/157 (77%), Positives = 133/157 (84%), Gaps = 4/157 (2%)
Query: 69 MEVSGLDSDGKEFKNAEEMWREQIGEDGEQQEKKTQWYREGISYWEGVEASVDGVLGGFG 128
MEV+G DSDG+EFKNAEEMWREQ G DG KKTQWYR+G+SYW+GVEASVDGVLGG+G
Sbjct: 1 MEVTGTDSDGREFKNAEEMWREQTG-DGT---KKTQWYRDGVSYWQGVEASVDGVLGGYG 56
Query: 129 NVNEVDIKGSEAFLQMLLSDRFPNARNNQHLVALDCGSGIGRITKNLLIRYFNEVDLLEP 188
VN+ DIKGSEAFLQ L S+ F + +HLVALDCGSGIGR+TKNLLIRYFNEVDLLEP
Sbjct: 57 QVNDADIKGSEAFLQTLFSELFVDGGLGRHLVALDCGSGIGRVTKNLLIRYFNEVDLLEP 116
Query: 189 VSHFLDAARESLAPENHMAPDMHKATNFFCVPLQVIT 225
VSHFLDAAR+SL ENHMA D HKATNFFC PLQ T
Sbjct: 117 VSHFLDAARDSLINENHMASDTHKATNFFCTPLQEFT 153
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224115626|ref|XP_002317082.1| predicted protein [Populus trichocarpa] gi|222860147|gb|EEE97694.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297791381|ref|XP_002863575.1| hypothetical protein ARALYDRAFT_494541 [Arabidopsis lyrata subsp. lyrata] gi|297309410|gb|EFH39834.1| hypothetical protein ARALYDRAFT_494541 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356528088|ref|XP_003532637.1| PREDICTED: alpha N-terminal protein methyltransferase 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449433531|ref|XP_004134551.1| PREDICTED: alpha N-terminal protein methyltransferase 1-like [Cucumis sativus] gi|449506765|ref|XP_004162842.1| PREDICTED: alpha N-terminal protein methyltransferase 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|145358849|ref|NP_199258.3| methyltransferase [Arabidopsis thaliana] gi|332007727|gb|AED95110.1| methyltransferase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356510746|ref|XP_003524095.1| PREDICTED: alpha N-terminal protein methyltransferase 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|75321280|sp|Q5PP70.1|NTM1_ARATH RecName: Full=Alpha N-terminal protein methyltransferase 1; AltName: Full=X-Pro-Lys N-terminal protein methyltransferase 1; Short=NTM1 gi|56121880|gb|AAV74221.1| At5g44450 [Arabidopsis thaliana] gi|57222192|gb|AAW39003.1| At5g44450 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|358348179|ref|XP_003638126.1| Methyltransferase-like protein 11A [Medicago truncatula] gi|355504061|gb|AES85264.1| Methyltransferase-like protein 11A [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|9758698|dbj|BAB09152.1| unnamed protein product [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 232 | ||||||
| DICTYBASE|DDB_G0269658 | 270 | DDB_G0269658 "Methyltransferas | 0.620 | 0.533 | 0.378 | 1.4e-23 | |
| UNIPROTKB|B1H2P7 | 224 | ntmt1 "N-terminal Xaa-Pro-Lys | 0.508 | 0.526 | 0.404 | 6.3e-21 | |
| UNIPROTKB|Q4KL94 | 224 | ntmt1-a "N-terminal Xaa-Pro-Ly | 0.508 | 0.526 | 0.412 | 1e-20 | |
| ZFIN|ZDB-GENE-040426-2055 | 223 | ntmt1 "N-terminal Xaa-Pro-Lys | 0.491 | 0.511 | 0.422 | 3.5e-20 | |
| UNIPROTKB|F1MKD1 | 223 | METTL11A "Uncharacterized prot | 0.491 | 0.511 | 0.414 | 1.9e-19 | |
| UNIPROTKB|Q9BV86 | 223 | NTMT1 "N-terminal Xaa-Pro-Lys | 0.504 | 0.524 | 0.396 | 5.1e-19 | |
| UNIPROTKB|Q4KLE6 | 223 | ntmt1-b "N-terminal Xaa-Pro-Ly | 0.504 | 0.524 | 0.380 | 5.1e-19 | |
| UNIPROTKB|Q2T9N3 | 223 | NTMT1 "N-terminal Xaa-Pro-Lys | 0.491 | 0.511 | 0.406 | 1.4e-18 | |
| UNIPROTKB|D2H163 | 223 | NTMT1 "N-terminal Xaa-Pro-Lys | 0.491 | 0.511 | 0.406 | 1.7e-18 | |
| UNIPROTKB|F1RQG3 | 223 | NTMT1 "Uncharacterized protein | 0.491 | 0.511 | 0.398 | 2.2e-18 |
| DICTYBASE|DDB_G0269658 DDB_G0269658 "Methyltransferase-like protein 11A" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Score = 271 (100.5 bits), Expect = 1.4e-23, P = 1.4e-23
Identities = 59/156 (37%), Positives = 92/156 (58%)
Query: 72 SGLDSDGKEFKNAEEMWREQI-GEDGEQQEKKTQWYREGISYWEGVEASVDGVLGGFGNV 130
SGLD +G + N E++W++++ G+D + ++K WY+ YW+GVEA+VDG+LGG V
Sbjct: 24 SGLDGEGNTYINIEDLWKKELEGKDNKMEDK---WYKSADEYWKGVEATVDGMLGGLAQV 80
Query: 131 NEVDIKGSEAFLQMLLSDRFPNARNNQHLVALDCGSGIGRITKNLLIRY-FNEVDLLEPV 189
+ +D+ S+ F+Q + N +L ALDCG+GIGR+ K L+ F VDL+E
Sbjct: 81 SPIDVVASKVFIQDFIKGTDSRPPINLNL-ALDCGAGIGRVAKEFLLPIGFKNVDLVEQN 139
Query: 190 SHFLDAARESLAPENHMAPDMHKATNFFCVPLQVIT 225
FLD A+ +N D ++ N++ V LQ T
Sbjct: 140 KLFLDKAKS----DNFK--DDNRVENYYAVGLQDFT 169
|
|
| UNIPROTKB|B1H2P7 ntmt1 "N-terminal Xaa-Pro-Lys N-methyltransferase 1" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4KL94 ntmt1-a "N-terminal Xaa-Pro-Lys N-methyltransferase 1-A" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2055 ntmt1 "N-terminal Xaa-Pro-Lys N-methyltransferase 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MKD1 METTL11A "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9BV86 NTMT1 "N-terminal Xaa-Pro-Lys N-methyltransferase 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4KLE6 ntmt1-b "N-terminal Xaa-Pro-Lys N-methyltransferase 1-B" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2T9N3 NTMT1 "N-terminal Xaa-Pro-Lys N-methyltransferase 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D2H163 NTMT1 "N-terminal Xaa-Pro-Lys N-methyltransferase 1" [Ailuropoda melanoleuca (taxid:9646)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RQG3 NTMT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 232 | |||
| pfam05891 | 217 | pfam05891, Methyltransf_PK, AdoMet dependent proli | 2e-55 |
| >gnl|CDD|218798 pfam05891, Methyltransf_PK, AdoMet dependent proline di-methyltransferase | Back alignment and domain information |
|---|
Score = 176 bits (448), Expect = 2e-55
Identities = 64/122 (52%), Positives = 86/122 (70%), Gaps = 8/122 (6%)
Query: 101 KKTQWYREGISYWEGVEASVDGVLGGFGNVNEVDIKGSEAFLQMLLSDRFPNARNNQHLV 160
+ Q+Y + I+YWEGV A+VDG+LGG+G+V+++D+ GS FL+ LL +R P +HLV
Sbjct: 1 DEEQFYSKAIAYWEGVSATVDGMLGGYGHVSDIDVNGSRNFLRRLLRERLPGK--RRHLV 58
Query: 161 ALDCGSGIGRITKNLLIRYFNEVDLLEPVSHFLDAARESLAPENHMAPDMHKATNFFCVP 220
ALDCG+GIGR+TKNLL+ F++VDL+EPV FL A+E LA K NFFCV
Sbjct: 59 ALDCGAGIGRVTKNLLLPLFSKVDLVEPVEDFLAKAKEYLAEGK------KKVGNFFCVG 112
Query: 221 LQ 222
LQ
Sbjct: 113 LQ 114
|
This protein is expressed in the tail neuron PVT and in uterine cells in C. elegans [worm-base]. In Saccharomyces cerevisiae this is AdoMet dependent proline di-methyltransferase. This enzyme catalyzes the di-methylation of ribosomal proteins Rpl12 and Rps25 at N-terminal proline residues. The methyltransferases described here specifically recognise the N-terminal X-Pro-Lys sequence motif, and they may account for nearly all previously described eukaryotic protein N-terminal methylation reactions. A number of other yeast and human proteins also share the recognition motif and may be similarly modified. As with other methyltransferases, this family carries the characteristic GxGxG motif. Length = 217 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 232 | |||
| PF05891 | 218 | Methyltransf_PK: AdoMet dependent proline di-methy | 100.0 | |
| KOG3178 | 342 | consensus Hydroxyindole-O-methyltransferase and re | 99.73 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 98.83 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 98.58 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 98.54 | |
| PF05401 | 201 | NodS: Nodulation protein S (NodS); InterPro: IPR00 | 98.49 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 98.44 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 98.41 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 98.39 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 98.38 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 98.36 | |
| smart00650 | 169 | rADc Ribosomal RNA adenine dimethylases. | 98.35 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 98.34 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 98.32 | |
| PRK14103 | 255 | trans-aconitate 2-methyltransferase; Provisional | 98.32 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 98.3 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 98.29 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 98.25 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 98.25 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 98.25 | |
| PF03848 | 192 | TehB: Tellurite resistance protein TehB; InterPro: | 98.21 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 98.2 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 98.2 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 98.18 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 98.18 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 98.15 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 98.14 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 98.14 | |
| PF05219 | 265 | DREV: DREV methyltransferase; InterPro: IPR007884 | 98.09 | |
| PRK00274 | 272 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 98.09 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 98.08 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 98.05 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 98.04 | |
| PF08242 | 99 | Methyltransf_12: Methyltransferase domain; InterPr | 98.04 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 98.0 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 97.99 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 97.99 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 97.98 | |
| KOG1270 | 282 | consensus Methyltransferases [Coenzyme transport a | 97.98 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 97.98 | |
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 97.98 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 97.98 | |
| COG2813 | 300 | RsmC 16S RNA G1207 methylase RsmC [Translation, ri | 97.97 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 97.95 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 97.95 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 97.94 | |
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 97.93 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 97.93 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 97.92 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 97.91 | |
| TIGR00755 | 253 | ksgA dimethyladenosine transferase. Alternate name | 97.91 | |
| PLN02366 | 308 | spermidine synthase | 97.91 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 97.9 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 97.9 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 97.88 | |
| COG4106 | 257 | Tam Trans-aconitate methyltransferase [General fun | 97.88 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 97.88 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 97.87 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 97.87 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 97.83 | |
| TIGR00417 | 270 | speE spermidine synthase. the SpeE subunit of sper | 97.82 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 97.82 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 97.81 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 97.8 | |
| PRK14896 | 258 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 97.8 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 97.77 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 97.77 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 97.77 | |
| TIGR01444 | 143 | fkbM_fam methyltransferase, FkbM family. Members o | 97.76 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 97.75 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 97.75 | |
| TIGR01983 | 224 | UbiG ubiquinone biosynthesis O-methyltransferase. | 97.72 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 97.72 | |
| TIGR02081 | 194 | metW methionine biosynthesis protein MetW. This pr | 97.7 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 97.7 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 97.69 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 97.69 | |
| PHA03412 | 241 | putative methyltransferase; Provisional | 97.69 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 97.68 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 97.68 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 97.68 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 97.68 | |
| PRK03612 | 521 | spermidine synthase; Provisional | 97.67 | |
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 97.66 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 97.66 | |
| COG2263 | 198 | Predicted RNA methylase [Translation, ribosomal st | 97.65 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 97.64 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 97.62 | |
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 97.6 | |
| PF00398 | 262 | RrnaAD: Ribosomal RNA adenine dimethylase; InterPr | 97.58 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 97.56 | |
| TIGR03840 | 213 | TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d | 97.56 | |
| PLN02490 | 340 | MPBQ/MSBQ methyltransferase | 97.53 | |
| PTZ00338 | 294 | dimethyladenosine transferase-like protein; Provis | 97.52 | |
| PRK04457 | 262 | spermidine synthase; Provisional | 97.52 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 97.52 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 97.51 | |
| COG2518 | 209 | Pcm Protein-L-isoaspartate carboxylmethyltransfera | 97.51 | |
| TIGR03438 | 301 | probable methyltransferase. This model represents | 97.51 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 97.48 | |
| PF13489 | 161 | Methyltransf_23: Methyltransferase domain; PDB: 3J | 97.48 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 97.47 | |
| PRK15128 | 396 | 23S rRNA m(5)C1962 methyltransferase; Provisional | 97.43 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 97.43 | |
| PRK13255 | 218 | thiopurine S-methyltransferase; Reviewed | 97.42 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 97.41 | |
| PRK13943 | 322 | protein-L-isoaspartate O-methyltransferase; Provis | 97.4 | |
| PRK14904 | 445 | 16S rRNA methyltransferase B; Provisional | 97.35 | |
| TIGR02085 | 374 | meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer | 97.35 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 97.32 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 97.3 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 97.3 | |
| PRK01581 | 374 | speE spermidine synthase; Validated | 97.27 | |
| PRK05031 | 362 | tRNA (uracil-5-)-methyltransferase; Validated | 97.26 | |
| PF01135 | 209 | PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl | 97.26 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 97.24 | |
| PRK14966 | 423 | unknown domain/N5-glutamine S-adenosyl-L-methionin | 97.2 | |
| COG2890 | 280 | HemK Methylase of polypeptide chain release factor | 97.19 | |
| PRK04266 | 226 | fibrillarin; Provisional | 97.18 | |
| TIGR02143 | 353 | trmA_only tRNA (uracil-5-)-methyltransferase. This | 97.16 | |
| KOG4300 | 252 | consensus Predicted methyltransferase [General fun | 97.14 | |
| TIGR00478 | 228 | tly hemolysin TlyA family protein. Hemolysins are | 97.11 | |
| PRK14902 | 444 | 16S rRNA methyltransferase B; Provisional | 97.11 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 97.1 | |
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 97.1 | |
| PHA01634 | 156 | hypothetical protein | 97.09 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 97.08 | |
| PRK14903 | 431 | 16S rRNA methyltransferase B; Provisional | 97.07 | |
| PLN03075 | 296 | nicotianamine synthase; Provisional | 97.07 | |
| COG0030 | 259 | KsgA Dimethyladenosine transferase (rRNA methylati | 97.03 | |
| PRK14901 | 434 | 16S rRNA methyltransferase B; Provisional | 97.02 | |
| TIGR00095 | 189 | RNA methyltransferase, RsmD family. This model rep | 97.02 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 96.96 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 96.96 | |
| PLN02781 | 234 | Probable caffeoyl-CoA O-methyltransferase | 96.94 | |
| PLN02823 | 336 | spermine synthase | 96.9 | |
| COG2242 | 187 | CobL Precorrin-6B methylase 2 [Coenzyme metabolism | 96.81 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 96.77 | |
| KOG3010 | 261 | consensus Methyltransferase [General function pred | 96.74 | |
| PRK11727 | 321 | 23S rRNA mA1618 methyltransferase; Provisional | 96.74 | |
| PRK06922 | 677 | hypothetical protein; Provisional | 96.73 | |
| COG0357 | 215 | GidB Predicted S-adenosylmethionine-dependent meth | 96.6 | |
| TIGR00563 | 426 | rsmB ribosomal RNA small subunit methyltransferase | 96.54 | |
| PF05958 | 352 | tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas | 96.51 | |
| COG3963 | 194 | Phospholipid N-methyltransferase [Lipid metabolism | 96.51 | |
| PF05185 | 448 | PRMT5: PRMT5 arginine-N-methyltransferase; InterPr | 96.5 | |
| KOG0820 | 315 | consensus Ribosomal RNA adenine dimethylase [RNA p | 96.49 | |
| PRK14121 | 390 | tRNA (guanine-N(7)-)-methyltransferase; Provisiona | 96.31 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 96.29 | |
| PF08003 | 315 | Methyltransf_9: Protein of unknown function (DUF16 | 96.26 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 96.25 | |
| smart00138 | 264 | MeTrc Methyltransferase, chemotaxis proteins. Meth | 96.23 | |
| TIGR00438 | 188 | rrmJ cell division protein FtsJ. | 96.2 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 96.1 | |
| PRK00050 | 296 | 16S rRNA m(4)C1402 methyltranserfase; Provisional | 96.01 | |
| PLN02672 | 1082 | methionine S-methyltransferase | 95.98 | |
| KOG1540 | 296 | consensus Ubiquinone biosynthesis methyltransferas | 95.94 | |
| PLN02476 | 278 | O-methyltransferase | 95.9 | |
| PRK04338 | 382 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 95.76 | |
| PF07021 | 193 | MetW: Methionine biosynthesis protein MetW; InterP | 95.71 | |
| COG0421 | 282 | SpeE Spermidine synthase [Amino acid transport and | 95.66 | |
| PRK13256 | 226 | thiopurine S-methyltransferase; Reviewed | 95.64 | |
| KOG3987 | 288 | consensus Uncharacterized conserved protein DREV/C | 95.56 | |
| PF03602 | 183 | Cons_hypoth95: Conserved hypothetical protein 95; | 95.55 | |
| PF02475 | 200 | Met_10: Met-10+ like-protein; InterPro: IPR003402 | 95.46 | |
| PF01596 | 205 | Methyltransf_3: O-methyltransferase; InterPro: IPR | 95.38 | |
| COG2519 | 256 | GCD14 tRNA(1-methyladenosine) methyltransferase an | 95.09 | |
| PF01564 | 246 | Spermine_synth: Spermine/spermidine synthase; Inte | 95.07 | |
| PF05724 | 218 | TPMT: Thiopurine S-methyltransferase (TPMT); Inter | 95.05 | |
| PF09243 | 274 | Rsm22: Mitochondrial small ribosomal subunit Rsm22 | 95.0 | |
| COG4122 | 219 | Predicted O-methyltransferase [General function pr | 94.97 | |
| KOG1541 | 270 | consensus Predicted protein carboxyl methylase [Ge | 94.93 | |
| KOG1499 | 346 | consensus Protein arginine N-methyltransferase PRM | 94.92 | |
| PTZ00146 | 293 | fibrillarin; Provisional | 94.85 | |
| PF02527 | 184 | GidB: rRNA small subunit methyltransferase G; Inte | 94.72 | |
| PLN02589 | 247 | caffeoyl-CoA O-methyltransferase | 94.51 | |
| PF08704 | 247 | GCD14: tRNA methyltransferase complex GCD14 subuni | 94.5 | |
| PF09445 | 163 | Methyltransf_15: RNA cap guanine-N2 methyltransfer | 94.47 | |
| PF13679 | 141 | Methyltransf_32: Methyltransferase domain | 94.38 | |
| PF10294 | 173 | Methyltransf_16: Putative methyltransferase; Inter | 94.13 | |
| KOG2904 | 328 | consensus Predicted methyltransferase [General fun | 94.0 | |
| PF02636 | 252 | Methyltransf_28: Putative S-adenosyl-L-methionine- | 93.88 | |
| PF05050 | 167 | Methyltransf_21: Methyltransferase FkbM domain; In | 93.85 | |
| COG0500 | 257 | SmtA SAM-dependent methyltransferases [Secondary m | 93.75 | |
| KOG1500 | 517 | consensus Protein arginine N-methyltransferase CAR | 93.64 | |
| COG2265 | 432 | TrmA SAM-dependent methyltransferases related to t | 93.59 | |
| PF08123 | 205 | DOT1: Histone methylation protein DOT1 ; InterPro: | 93.42 | |
| TIGR00308 | 374 | TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi | 93.25 | |
| KOG2940 | 325 | consensus Predicted methyltransferase [General fun | 92.96 | |
| KOG3191 | 209 | consensus Predicted N6-DNA-methyltransferase [Tran | 92.47 | |
| PF04816 | 205 | DUF633: Family of unknown function (DUF633) ; Inte | 91.74 | |
| PRK00536 | 262 | speE spermidine synthase; Provisional | 91.34 | |
| PF00891 | 241 | Methyltransf_2: O-methyltransferase; InterPro: IPR | 91.21 | |
| PRK10742 | 250 | putative methyltransferase; Provisional | 89.68 | |
| KOG2899 | 288 | consensus Predicted methyltransferase [General fun | 89.64 | |
| KOG1501 | 636 | consensus Arginine N-methyltransferase [General fu | 89.6 | |
| COG0742 | 187 | N6-adenine-specific methylase [DNA replication, re | 89.1 | |
| COG1565 | 370 | Uncharacterized conserved protein [Function unknow | 88.3 | |
| PF02390 | 195 | Methyltransf_4: Putative methyltransferase ; Inter | 88.23 | |
| PRK11760 | 357 | putative 23S rRNA C2498 ribose 2'-O-ribose methylt | 87.5 | |
| KOG1661 | 237 | consensus Protein-L-isoaspartate(D-aspartate) O-me | 86.09 | |
| PRK11933 | 470 | yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; | 86.09 | |
| KOG1271 | 227 | consensus Methyltransferases [General function pre | 85.41 | |
| COG4076 | 252 | Predicted RNA methylase [General function predicti | 84.49 | |
| TIGR03439 | 319 | methyl_EasF probable methyltransferase domain, Eas | 84.25 | |
| COG2384 | 226 | Predicted SAM-dependent methyltransferase [General | 83.99 | |
| COG2520 | 341 | Predicted methyltransferase [General function pred | 82.89 | |
| KOG3420 | 185 | consensus Predicted RNA methylase [Translation, ri | 82.4 | |
| PF01728 | 181 | FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 | 82.22 | |
| TIGR02987 | 524 | met_A_Alw26 type II restriction m6 adenine DNA met | 82.11 | |
| cd00315 | 275 | Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth | 81.31 | |
| KOG2361 | 264 | consensus Predicted methyltransferase [General fun | 80.62 |
| >PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.9e-43 Score=306.66 Aligned_cols=122 Identities=48% Similarity=0.888 Sum_probs=96.5
Q ss_pred hhhhhhhhhhcccCCccchhccccCCCcccccchhhHHHHHHHHhcCCCCCcCCCcceeeeccCCccccchHHHHhhccC
Q 026812 102 KTQWYREGISYWEGVEASVDGVLGGFGNVNEVDIKGSEAFLQMLLSDRFPNARNNQHLVALDCGSGIGRITKNLLIRYFN 181 (232)
Q Consensus 102 ~~~~Y~~a~~YWe~veaTvdGMLGGf~~vs~~Di~gS~~FL~~L~~~~~~~~~~~~~~rALDcGAGIGRVTk~lLl~~f~ 181 (232)
+..||.+|.+||++++||+|||||||++||++||++|+.||++|.....+ ......+||||||||||||++||+++|+
T Consensus 2 ~~~~y~~a~~YW~~v~atvdGMLGG~~~is~~Di~gS~~FL~~l~~~~~~--~~~~~~~alDcGAGIGRVTk~lLl~~f~ 79 (218)
T PF05891_consen 2 KKIWYEKAKEYWENVPATVDGMLGGFGHISRIDIQGSRNFLKKLKRGRKP--GKPKFNRALDCGAGIGRVTKGLLLPVFD 79 (218)
T ss_dssp HCHHHHHHHHHHHTS-SSHHHHTTT-GGGHHHHHHHHHHHHHCCCT-----------SEEEEET-TTTHHHHHTCCCC-S
T ss_pred cccHHHHHHHHHcCCCCCccccccCCCCCChHHHHHHHHHHHHHHhhccc--CCCCcceEEecccccchhHHHHHHHhcC
Confidence 46899999999999999999999999999999999999999999875322 2346789999999999999999999999
Q ss_pred eeEEecCcHHHHHHHHHHhCCCCCCCCCCCCcceEEEecCCCccCCC-CCC
Q 026812 182 EVDLLEPVSHFLDAARESLAPENHMAPDMHKATNFFCVPLQVITNII-QYH 231 (232)
Q Consensus 182 ~VDLVEPv~~Fle~Are~l~~~~~~~~~~~rv~n~~~vgLQdF~Pe~-~YD 231 (232)
+||+|||+++|+++|+++++. +..+++++||+|||+|+|+. +||
T Consensus 80 ~VDlVEp~~~Fl~~a~~~l~~------~~~~v~~~~~~gLQ~f~P~~~~YD 124 (218)
T PF05891_consen 80 EVDLVEPVEKFLEQAKEYLGK------DNPRVGEFYCVGLQDFTPEEGKYD 124 (218)
T ss_dssp EEEEEES-HHHHHHHHHHTCC------GGCCEEEEEES-GGG----TT-EE
T ss_pred EeEEeccCHHHHHHHHHHhcc------cCCCcceEEecCHhhccCCCCcEe
Confidence 999999999999999999855 24789999999999999985 998
|
; GO: 0008168 methyltransferase activity; PDB: 1XTP_A 2EX4_B. |
| >KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >smart00650 rADc Ribosomal RNA adenine dimethylases | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >PRK14103 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes | Back alignment and domain information |
|---|
| >PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00755 ksgA dimethyladenosine transferase | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00417 speE spermidine synthase | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >TIGR01444 fkbM_fam methyltransferase, FkbM family | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02081 metW methionine biosynthesis protein MetW | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >PRK03612 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family | Back alignment and domain information |
|---|
| >PLN02490 MPBQ/MSBQ methyltransferase | Back alignment and domain information |
|---|
| >PTZ00338 dimethyladenosine transferase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK04457 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03438 probable methyltransferase | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >PRK13255 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14904 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >PRK01581 speE spermidine synthase; Validated | Back alignment and domain information |
|---|
| >PRK05031 tRNA (uracil-5-)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional | Back alignment and domain information |
|---|
| >COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase | Back alignment and domain information |
|---|
| >KOG4300 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00478 tly hemolysin TlyA family protein | Back alignment and domain information |
|---|
| >PRK14902 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PHA01634 hypothetical protein | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK14903 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PLN03075 nicotianamine synthase; Provisional | Back alignment and domain information |
|---|
| >COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >TIGR00095 RNA methyltransferase, RsmD family | Back alignment and domain information |
|---|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >PLN02781 Probable caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >PLN02823 spermine synthase | Back alignment and domain information |
|---|
| >COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >KOG3010 consensus Methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11727 23S rRNA mA1618 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06922 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 | Back alignment and domain information |
|---|
| >COG3963 Phospholipid N-methyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] | Back alignment and domain information |
|---|
| >KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >smart00138 MeTrc Methyltransferase, chemotaxis proteins | Back alignment and domain information |
|---|
| >TIGR00438 rrmJ cell division protein FtsJ | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional | Back alignment and domain information |
|---|
| >PLN02672 methionine S-methyltransferase | Back alignment and domain information |
|---|
| >KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02476 O-methyltransferase | Back alignment and domain information |
|---|
| >PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins | Back alignment and domain information |
|---|
| >COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13256 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] | Back alignment and domain information |
|---|
| >PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH | Back alignment and domain information |
|---|
| >PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family | Back alignment and domain information |
|---|
| >PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases | Back alignment and domain information |
|---|
| >COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 | Back alignment and domain information |
|---|
| >PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >COG4122 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00146 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G | Back alignment and domain information |
|---|
| >PLN02589 caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] | Back alignment and domain information |
|---|
| >PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] | Back alignment and domain information |
|---|
| >PF13679 Methyltransf_32: Methyltransferase domain | Back alignment and domain information |
|---|
| >PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases | Back alignment and domain information |
|---|
| >KOG2904 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >PF05050 Methyltransf_21: Methyltransferase FkbM domain; InterPro: IPR007744 This entry contains proteins of unknown function | Back alignment and domain information |
|---|
| >COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] | Back alignment and domain information |
|---|
| >COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] | Back alignment and domain information |
|---|
| >TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase | Back alignment and domain information |
|---|
| >KOG2940 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PRK00536 speE spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK10742 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2899 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1501 consensus Arginine N-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1565 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 | Back alignment and domain information |
|---|
| >PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed | Back alignment and domain information |
|---|
| >KOG1271 consensus Methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >COG4076 Predicted RNA methylase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03439 methyl_EasF probable methyltransferase domain, EasF family | Back alignment and domain information |
|---|
| >COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2520 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes | Back alignment and domain information |
|---|
| >TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family | Back alignment and domain information |
|---|
| >cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology | Back alignment and domain information |
|---|
| >KOG2361 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 232 | ||||
| 1xtp_A | 254 | Structural Analysis Of Leishmania Major Lmaj004091a | 4e-25 | ||
| 2ex4_A | 241 | Crystal Structure Of Human Methyltransferase Ad-003 | 2e-20 |
| >pdb|1XTP|A Chain A, Structural Analysis Of Leishmania Major Lmaj004091aaa, A Sam-dependent Methyltransferase Of The Duf858/pfam05891 Family Length = 254 | Back alignment and structure |
|
| >pdb|2EX4|A Chain A, Crystal Structure Of Human Methyltransferase Ad-003 In Complex With S-adenosyl-l-homocysteine Length = 241 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 232 | |||
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 5e-40 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 2e-31 |
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Length = 254 | Back alignment and structure |
|---|
Score = 137 bits (345), Expect = 5e-40
Identities = 58/162 (35%), Positives = 87/162 (53%), Gaps = 18/162 (11%)
Query: 61 PKHKESSAMEVSGLDSDGKEFKNAEEMWREQIGEDGEQQEKKTQWYREGISYWEGVEASV 120
K S + +SG D++GK +++ +EMW+ ++ G+ + + WY + + YW V A+V
Sbjct: 7 SKEASSRNLPISGRDTNGKTYRSTDEMWKAEL--TGDLYDPEKGWYGKALEYWRTVPATV 64
Query: 121 DGVLGGFGNVNEVDIKGSEAFLQMLLSDRFPNARNNQHLVALDCGSGIGRITKNLLIRYF 180
GVLGG +V++VDI+GS F+ L ALDCG+GIGRITKNLL + +
Sbjct: 65 SGVLGGMDHVHDVDIEGSRNFIASLPGHGTSR--------ALDCGAGIGRITKNLLTKLY 116
Query: 181 NEVDLLEPVSHFLDAARESLAPENHMAPDMHKATNFFCVPLQ 222
DLLEPV H L+ A+ LA F ++
Sbjct: 117 ATTDLLEPVKHMLEEAKRELAG--------MPVGKFILASME 150
|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Length = 241 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 232 | |||
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 99.83 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 99.46 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 98.71 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 98.69 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 98.66 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 98.62 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 98.6 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 98.57 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 98.55 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 98.54 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 98.54 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 98.53 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 98.53 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 98.51 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 98.5 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 98.48 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 98.47 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 98.47 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 98.46 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 98.45 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 98.45 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 98.44 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 98.44 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 98.44 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 98.42 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 98.42 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 98.41 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 98.41 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 98.4 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 98.4 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 98.4 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 98.4 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 98.39 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 98.39 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 98.39 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 98.38 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 98.38 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 98.37 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 98.37 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 98.36 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 98.36 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 98.36 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 98.35 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 98.35 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 98.35 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 98.35 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 98.35 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 98.34 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 98.34 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 98.34 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 98.33 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 98.33 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 98.32 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 98.31 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 98.31 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 98.31 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 98.31 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 98.3 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 98.3 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 98.29 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 98.29 | |
| 2cmg_A | 262 | Spermidine synthase; transferase, putrescine amino | 98.29 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 98.28 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 98.28 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 98.27 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 98.27 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 98.27 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 98.26 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 98.26 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 98.25 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 98.25 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 98.25 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 98.25 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 98.24 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 98.24 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 98.23 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 98.22 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 98.22 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 98.22 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 98.21 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 98.21 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 98.21 | |
| 3tqs_A | 255 | Ribosomal RNA small subunit methyltransferase A; p | 98.21 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 98.21 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 98.21 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 98.2 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 98.2 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 98.2 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 98.2 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 98.19 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 98.19 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 98.18 | |
| 1qam_A | 244 | ERMC' methyltransferase; rRNA methyltransferase ER | 98.18 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 98.17 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 98.16 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 98.16 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 98.16 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 98.16 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 98.15 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 98.14 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 98.14 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 98.14 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 98.13 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 98.13 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 98.13 | |
| 2a14_A | 263 | Indolethylamine N-methyltransferase; SGC,INMT, str | 98.12 | |
| 3uzu_A | 279 | Ribosomal RNA small subunit methyltransferase A; s | 98.12 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 98.12 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 98.11 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 98.1 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 98.1 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 98.1 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 98.1 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 98.09 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 98.09 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 98.08 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 98.08 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 98.08 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 98.08 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 98.08 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 98.08 | |
| 2aot_A | 292 | HMT, histamine N-methyltransferase; classic methyl | 98.08 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 98.07 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 98.07 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 98.07 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 98.06 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 98.06 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 98.06 | |
| 3fut_A | 271 | Dimethyladenosine transferase; methyltransferase, | 98.04 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 98.04 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 98.04 | |
| 3ftd_A | 249 | Dimethyladenosine transferase; KSGA, rossmann-like | 98.03 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 98.03 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 98.03 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 98.03 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 98.02 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 98.02 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 98.01 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 98.01 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 98.01 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 98.01 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 98.0 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 98.0 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 98.0 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 98.0 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 97.99 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 97.99 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 97.99 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 97.98 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 97.97 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 97.97 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 97.97 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 97.97 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 97.96 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 97.95 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 97.94 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 97.93 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 97.93 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 97.93 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 97.92 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 97.92 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 97.92 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 97.92 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 97.91 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 97.91 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 97.91 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 97.9 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 97.9 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 97.9 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 97.9 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 97.89 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 97.88 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 97.88 | |
| 1qyr_A | 252 | KSGA, high level kasugamycin resistance protein, S | 97.87 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 97.87 | |
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 97.85 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 97.84 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 97.83 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 97.83 | |
| 3p2e_A | 225 | 16S rRNA methylase; methyltransferase, transferase | 97.83 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 97.82 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 97.82 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 97.82 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 97.8 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 97.79 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 97.79 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 97.77 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 97.77 | |
| 2g72_A | 289 | Phenylethanolamine N-methyltransferase; HET: SAM F | 97.77 | |
| 1yub_A | 245 | Ermam, rRNA methyltransferase; MLS antibiotics; NM | 97.76 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 97.76 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 97.75 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 97.73 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 97.73 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 97.73 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 97.72 | |
| 2r6z_A | 258 | UPF0341 protein in RSP 3' region; alpha-beta prote | 97.72 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 97.71 | |
| 3opn_A | 232 | Putative hemolysin; structural genomics, PSI-2, pr | 97.69 | |
| 3bt7_A | 369 | TRNA (uracil-5-)-methyltransferase; methyluridine, | 97.69 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 97.69 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 97.68 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 97.68 | |
| 3ll7_A | 410 | Putative methyltransferase; methytransferase, stru | 97.63 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 97.63 | |
| 1m6y_A | 301 | S-adenosyl-methyltransferase MRAW; SAM-dependent m | 97.62 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 97.61 | |
| 2yx1_A | 336 | Hypothetical protein MJ0883; methyl transferase, t | 97.6 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 97.56 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 97.56 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 97.54 | |
| 2oxt_A | 265 | Nucleoside-2'-O-methyltransferase; flavivirus, vir | 97.53 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 97.52 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 97.52 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 97.51 | |
| 3hp7_A | 291 | Hemolysin, putative; structural genomics, APC64019 | 97.51 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 97.51 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 97.5 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 97.49 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 97.46 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 97.44 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 97.43 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 97.43 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 97.42 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 97.39 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 97.38 | |
| 4e2x_A | 416 | TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s | 97.37 | |
| 2wa2_A | 276 | Non-structural protein 5; transferase, S-adenosyl- | 97.33 | |
| 2qfm_A | 364 | Spermine synthase; spermidine aminopropyltransfera | 97.29 | |
| 2yxl_A | 450 | PH0851 protein, 450AA long hypothetical FMU protei | 97.29 | |
| 2bm8_A | 236 | Cephalosporin hydroxylase CMCI; cephamycin biosynt | 97.27 | |
| 2frx_A | 479 | Hypothetical protein YEBU; rossmann-type S-adenosy | 97.21 | |
| 2oyr_A | 258 | UPF0341 protein YHIQ; alpha-beta protein, structur | 97.17 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 97.16 | |
| 2qe6_A | 274 | Uncharacterized protein TFU_2867; putative methylt | 97.09 | |
| 3m6w_A | 464 | RRNA methylase; rRNA methyltransferase, 5-methylcy | 97.08 | |
| 2b9e_A | 309 | NOL1/NOP2/SUN domain family, member 5 isoform 2; m | 97.08 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 97.05 | |
| 3frh_A | 253 | 16S rRNA methylase; methyltransferase domain, heli | 97.05 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 97.0 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 96.99 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 96.96 | |
| 3k0b_A | 393 | Predicted N6-adenine-specific DNA methylase; methy | 96.93 | |
| 3lcv_B | 281 | Sisomicin-gentamicin resistance methylase SGM; ant | 96.92 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 96.89 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 96.81 | |
| 3m4x_A | 456 | NOL1/NOP2/SUN family protein; mtase domain, PUA do | 96.78 | |
| 3giw_A | 277 | Protein of unknown function DUF574; rossmann-fold | 96.76 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 96.75 | |
| 3o4f_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 96.74 | |
| 3ldg_A | 384 | Putative uncharacterized protein SMU.472; YPSC, me | 96.69 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 96.69 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 96.66 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 96.64 | |
| 2plw_A | 201 | Ribosomal RNA methyltransferase, putative; malaria | 96.59 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 96.56 | |
| 2p41_A | 305 | Type II methyltransferase; vizier, viral enzymes i | 96.45 | |
| 3axs_A | 392 | Probable N(2),N(2)-dimethylguanosine tRNA methylt | 96.42 | |
| 1af7_A | 274 | Chemotaxis receptor methyltransferase CHER; chemot | 96.39 | |
| 1wg8_A | 285 | Predicted S-adenosylmethionine-dependent methyltra | 96.38 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 96.38 | |
| 1i4w_A | 353 | Mitochondrial replication protein MTF1; mitochondr | 96.3 | |
| 2dul_A | 378 | N(2),N(2)-dimethylguanosine tRNA methyltransferas; | 96.22 | |
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 96.09 | |
| 4a6d_A | 353 | Hydroxyindole O-methyltransferase; melatonin, circ | 96.09 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 96.04 | |
| 2py6_A | 409 | Methyltransferase FKBM; YP_546752.1, structural ge | 96.03 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 96.03 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 95.9 | |
| 4gqb_A | 637 | Protein arginine N-methyltransferase 5; TIM barrel | 95.82 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 95.8 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 95.6 | |
| 3cvo_A | 202 | Methyltransferase-like protein of unknown functio; | 95.52 | |
| 2okc_A | 445 | Type I restriction enzyme stysji M protein; NP_813 | 95.09 | |
| 3c6k_A | 381 | Spermine synthase; spermidine aminopropyltransfera | 94.49 | |
| 2ld4_A | 176 | Anamorsin; methyltransferase-like fold, alpha/beta | 94.43 | |
| 2k4m_A | 153 | TR8_protein, UPF0146 protein MTH_1000; alpha+beta, | 94.4 | |
| 3lkz_A | 321 | Non-structural protein 5; flavivirus, methyltransf | 93.78 | |
| 3ua3_A | 745 | Protein arginine N-methyltransferase 5; TIM-barrel | 93.17 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 93.12 | |
| 3sso_A | 419 | Methyltransferase; macrolide, natural product, ros | 92.85 | |
| 1g60_A | 260 | Adenine-specific methyltransferase MBOIIA; structu | 91.94 | |
| 3evf_A | 277 | RNA-directed RNA polymerase NS5; NS5 methyltransfe | 91.45 | |
| 1g55_A | 343 | DNA cytosine methyltransferase DNMT2; human DNA me | 90.6 | |
| 3gcz_A | 282 | Polyprotein; flavivirus, RNA capping, methyltransf | 90.48 | |
| 3eld_A | 300 | Methyltransferase; flavivirus, RNA capping, guanyl | 90.07 | |
| 2xyq_A | 290 | Putative 2'-O-methyl transferase; transferase-vira | 89.94 | |
| 3p8z_A | 267 | Mtase, non-structural protein 5; methyltransferase | 88.31 | |
| 4auk_A | 375 | Ribosomal RNA large subunit methyltransferase M; Y | 88.03 | |
| 3g7u_A | 376 | Cytosine-specific methyltransferase; DNA-binding, | 85.76 | |
| 1zkd_A | 387 | DUF185; NESG, RPR58, structural genomics, PSI, pro | 85.22 | |
| 3tka_A | 347 | Ribosomal RNA small subunit methyltransferase H; H | 85.2 | |
| 2px2_A | 269 | Genome polyprotein [contains: capsid protein C (co | 84.35 | |
| 2c7p_A | 327 | Modification methylase HHAI; DNA methyltransferase | 84.15 | |
| 2ar0_A | 541 | M.ecoki, type I restriction enzyme ecoki M protein | 82.03 | |
| 3lkd_A | 542 | Type I restriction-modification system methyltrans | 82.03 |
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
Probab=99.83 E-value=6.1e-21 Score=159.55 Aligned_cols=150 Identities=39% Similarity=0.744 Sum_probs=121.9
Q ss_pred CCcccccccccCCCCCcccCHHHHHHHHhccCCchhhhhhhhhhhhhhcccCCccchhccccCCCcccccchhhHHHHHH
Q 026812 64 KESSAMEVSGLDSDGKEFKNAEEMWREQIGEDGEQQEKKTQWYREGISYWEGVEASVDGVLGGFGNVNEVDIKGSEAFLQ 143 (232)
Q Consensus 64 ~~~~~~~~~G~ds~g~~~~s~~emWk~~~~~d~~~~~~~~~~Y~~a~~YWe~veaTvdGMLGGf~~vs~~Di~gS~~FL~ 143 (232)
..|.+|+++|.|++|+.|++|+++|++.+..... .....||..+.+||+....+.++|++++..++..+......||.
T Consensus 10 ~~~~~~~~~g~d~~~~~~~~~~~~w~~~~~~~~~--~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~ 87 (254)
T 1xtp_A 10 ASSRNLPISGRDTNGKTYRSTDEMWKAELTGDLY--DPEKGWYGKALEYWRTVPATVSGVLGGMDHVHDVDIEGSRNFIA 87 (254)
T ss_dssp ---CCCCCCEEETTSCEESCHHHHHHHHSCSCTT--CTTTCHHHHHHHHHHTSCSSHHHHTTTCGGGHHHHHHHHHHHHH
T ss_pred CCcccccccccCCCCcccccHHHHHHHHHhcccc--ccchhhhhhhhhHHhcCCccccceecCcCccCHHHHHHHHHHHH
Confidence 3477899999999999999999999999876322 22335999999999999999999999999999999888888888
Q ss_pred HHhcCCCCCcCCCcceeeeccCCccccchHHHHhhccCeeEEecCcHHHHHHHHHHhCCCCCCCCCCCCcceEEEecCCC
Q 026812 144 MLLSDRFPNARNNQHLVALDCGSGIGRITKNLLIRYFNEVDLLEPVSHFLDAARESLAPENHMAPDMHKATNFFCVPLQV 223 (232)
Q Consensus 144 ~L~~~~~~~~~~~~~~rALDcGAGIGRVTk~lLl~~f~~VDLVEPv~~Fle~Are~l~~~~~~~~~~~rv~n~~~vgLQd 223 (232)
.+.. .+..++||+|||+|+++..|+...+.+|++||+++.+++.|++++... .+ .++.+..+++
T Consensus 88 ~l~~--------~~~~~vLDiG~G~G~~~~~l~~~~~~~v~~vD~s~~~~~~a~~~~~~~-------~~-~~~~~~d~~~ 151 (254)
T 1xtp_A 88 SLPG--------HGTSRALDCGAGIGRITKNLLTKLYATTDLLEPVKHMLEEAKRELAGM-------PV-GKFILASMET 151 (254)
T ss_dssp TSTT--------CCCSEEEEETCTTTHHHHHTHHHHCSEEEEEESCHHHHHHHHHHTTTS-------SE-EEEEESCGGG
T ss_pred hhcc--------cCCCEEEEECCCcCHHHHHHHHhhcCEEEEEeCCHHHHHHHHHHhccC-------Cc-eEEEEccHHH
Confidence 7643 234689999999999999876666778999999999999999987541 23 3788888887
Q ss_pred ccC-CCCCC
Q 026812 224 ITN-IIQYH 231 (232)
Q Consensus 224 F~P-e~~YD 231 (232)
+.+ ...||
T Consensus 152 ~~~~~~~fD 160 (254)
T 1xtp_A 152 ATLPPNTYD 160 (254)
T ss_dssp CCCCSSCEE
T ss_pred CCCCCCCeE
Confidence 753 34676
|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 | Back alignment and structure |
|---|
| >3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... | Back alignment and structure |
|---|
| >1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* | Back alignment and structure |
|---|
| >2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* | Back alignment and structure |
|---|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* | Back alignment and structure |
|---|
| >2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} | Back alignment and structure |
|---|
| >3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* | Back alignment and structure |
|---|
| >3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* | Back alignment and structure |
|---|
| >1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* | Back alignment and structure |
|---|
| >1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* | Back alignment and structure |
|---|
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* | Back alignment and structure |
|---|
| >4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* | Back alignment and structure |
|---|
| >2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* | Back alignment and structure |
|---|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* | Back alignment and structure |
|---|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* | Back alignment and structure |
|---|
| >3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* | Back alignment and structure |
|---|
| >2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A | Back alignment and structure |
|---|
| >2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} | Back alignment and structure |
|---|
| >3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} | Back alignment and structure |
|---|
| >3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* | Back alignment and structure |
|---|
| >1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 | Back alignment and structure |
|---|
| >3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} | Back alignment and structure |
|---|
| >3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* | Back alignment and structure |
|---|
| >2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* | Back alignment and structure |
|---|
| >3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* | Back alignment and structure |
|---|
| >4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* | Back alignment and structure |
|---|
| >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} | Back alignment and structure |
|---|
| >1zkd_A DUF185; NESG, RPR58, structural genomics, PSI, protein structure INI northeast structural genomics consortium, unknown function; 2.10A {Rhodopseudomonas palustris} SCOP: c.66.1.52 | Back alignment and structure |
|---|
| >3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} | Back alignment and structure |
|---|
| >2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* | Back alignment and structure |
|---|
| >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... | Back alignment and structure |
|---|
| >2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* | Back alignment and structure |
|---|
| >3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 232 | ||||
| d1xtpa_ | 254 | c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa | 2e-33 | |
| d2ex4a1 | 222 | c.66.1.42 (A:2-224) Adrenal gland protein AD-003 ( | 2e-18 |
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Length = 254 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: AD-003 protein-like domain: Hypothetical protein Lmaj004091aaa (LmjF30.0810) species: Leishmania major [TaxId: 5664]
Score = 118 bits (297), Expect = 2e-33
Identities = 54/133 (40%), Positives = 79/133 (59%), Gaps = 10/133 (7%)
Query: 62 KHKESSAMEVSGLDSDGKEFKNAEEMWREQIGEDGEQQEKKTQWYREGISYWEGVEASVD 121
K S + +SG D++GK +++ +EMW+ ++ D + + WY + + YW V A+V
Sbjct: 8 KEASSRNLPISGRDTNGKTYRSTDEMWKAELTGDLY--DPEKGWYGKALEYWRTVPATVS 65
Query: 122 GVLGGFGNVNEVDIKGSEAFLQMLLSDRFPNARNNQHLVALDCGSGIGRITKNLLIRYFN 181
GVLGG +V++VDI+GS F+ L ALDCG+GIGRITKNLL + +
Sbjct: 66 GVLGGMDHVHDVDIEGSRNFIASLPGHGTSR--------ALDCGAGIGRITKNLLTKLYA 117
Query: 182 EVDLLEPVSHFLD 194
DLLEPV H L+
Sbjct: 118 TTDLLEPVKHMLE 130
|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Length = 222 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 232 | |||
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 100.0 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 99.85 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 99.08 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 98.89 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 98.88 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 98.83 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 98.81 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 98.77 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 98.76 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 98.74 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 98.71 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 98.71 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 98.66 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 98.63 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 98.53 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 98.48 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 98.4 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 98.39 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 98.38 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 98.37 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 98.34 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 98.29 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 98.25 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 98.23 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 98.19 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 98.18 | |
| d1vlma_ | 208 | Possible histamine N-methyltransferase TM1293 {The | 98.14 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 98.13 | |
| d2a14a1 | 257 | Indolethylamine N-methyltransferase, INMT {Human ( | 98.13 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 98.13 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 98.1 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 98.03 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 98.03 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 98.0 | |
| d1qama_ | 235 | rRNA adenine dimethylase {Bacillus subtilis, Ermc' | 97.99 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 97.94 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 97.91 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 97.84 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 97.83 | |
| d2g72a1 | 263 | Phenylethanolamine N-methyltransferase, PNMTase {H | 97.8 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 97.76 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 97.75 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 97.73 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 97.72 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 97.7 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 97.69 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 97.66 | |
| d1zq9a1 | 278 | Probable dimethyladenosine transferase {Human (Hom | 97.66 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 97.66 | |
| d1yuba_ | 245 | rRNA adenine dimethylase {Streptococcus pneumoniae | 97.6 | |
| d1qyra_ | 252 | High level kasugamycin resistance protein KsgA {Es | 97.58 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 97.56 | |
| d1qzza2 | 256 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 97.46 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 97.46 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 97.45 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 97.41 | |
| d1r18a_ | 223 | Protein-L-isoaspartyl O-methyltransferase {Fruit f | 97.38 | |
| d2h00a1 | 250 | Methyltransferase 10 domain containing protein MET | 97.31 | |
| d1uira_ | 312 | Spermidine synthase {Thermus thermophilus [TaxId: | 97.3 | |
| d1mjfa_ | 276 | Putative spermidine synthetase PF0127 (SpeE) {Arch | 97.29 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 97.26 | |
| d1u2za_ | 406 | Catalytic, N-terminal domain of histone methyltran | 97.21 | |
| d2b25a1 | 324 | Hypothetical protein FLJ20628 {Human (Homo sapiens | 97.19 | |
| d1m6ya2 | 192 | TM0872, methyltransferase domain {Thermotoga marit | 97.17 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 97.17 | |
| d1uwva2 | 358 | rRNA (Uracil-5-)-methyltransferase RumA, catalytic | 97.13 | |
| d1wxxa2 | 318 | Hypothetical protein TTHA1280, middle and C-termin | 97.1 | |
| d2igta1 | 309 | Putative methyltransferase Atu0340 {Agrobacterium | 97.04 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 97.04 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 96.9 | |
| d1i4wa_ | 322 | Transcription factor sc-mtTFB {Baker's yeast (Sacc | 96.77 | |
| d1yzha1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep | 96.73 | |
| d2ifta1 | 183 | Putative methylase HI0767 {Haemophilus influenzae | 96.71 | |
| d1jsxa_ | 207 | Glucose-inhibited division protein B (GidB) {Esche | 96.61 | |
| d1nv8a_ | 271 | N5-glutamine methyltransferase, HemK {Thermotoga m | 96.54 | |
| d2cl5a1 | 214 | Catechol O-methyltransferase, COMT {Rat (Rattus no | 96.19 | |
| d1inla_ | 295 | Spermidine synthase {Thermotoga maritima [TaxId: 2 | 96.02 | |
| d2o07a1 | 285 | Spermidine synthase {Human (Homo sapiens) [TaxId: | 95.82 | |
| d1iy9a_ | 274 | Spermidine synthase {Bacillus subtilis [TaxId: 142 | 95.78 | |
| d2b2ca1 | 312 | Spermidine synthase {Caenorhabditis elegans [TaxId | 95.68 | |
| d2b78a2 | 317 | Hypothetical protein SMu776, middle and C-terminal | 95.48 | |
| d2avda1 | 219 | COMT domain-containing protein 1, COMTD1 {Human (H | 95.23 | |
| d1xj5a_ | 290 | Spermidine synthase {Thale cress (Arabidopsis thal | 95.02 | |
| d1susa1 | 227 | Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag | 94.41 | |
| d2oyra1 | 250 | Hypothetical protein YhiQ {Shigella flexneri [TaxI | 93.81 | |
| d2ih2a1 | 223 | DNA methylase TaqI, N-terminal domain {Thermus aqu | 93.72 | |
| d2py6a1 | 395 | Methyltransferase FkbM {Methylobacillus flagellatu | 91.53 | |
| d1xdza_ | 239 | Glucose-inhibited division protein B (GidB) {Bacil | 91.53 | |
| d2f8la1 | 328 | Hypothetical protein Lmo1582 {Listeria monocytogen | 90.86 | |
| d1wg8a2 | 182 | TM0872, methyltransferase domain {Thermus thermoph | 88.91 | |
| d1fp2a2 | 244 | Isoflavone O-methyltransferase {Alfalfa (Medicago | 88.52 | |
| d1af7a2 | 193 | Chemotaxis receptor methyltransferase CheR, C-term | 86.75 | |
| d2p41a1 | 257 | An RNA cap (nucleoside-2'-O-)-methyltransferase do | 85.85 | |
| d1zkda1 | 365 | Hypothetical protein RPA4359 {Rhodopseudomonas pal | 85.12 | |
| d2dula1 | 375 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 83.42 | |
| d2b9ea1 | 293 | NOL1R {Human (Homo sapiens) [TaxId: 9606]} | 81.27 |
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: AD-003 protein-like domain: Hypothetical protein Lmaj004091aaa (LmjF30.0810) species: Leishmania major [TaxId: 5664]
Probab=100.00 E-value=1.9e-37 Score=268.11 Aligned_cols=152 Identities=39% Similarity=0.750 Sum_probs=133.3
Q ss_pred CCCCcccccccccCCCCCcccCHHHHHHHHhccCCchhhhhhhhhhhhhhcccCCccchhccccCCCcccccchhhHHHH
Q 026812 62 KHKESSAMEVSGLDSDGKEFKNAEEMWREQIGEDGEQQEKKTQWYREGISYWEGVEASVDGVLGGFGNVNEVDIKGSEAF 141 (232)
Q Consensus 62 ~~~~~~~~~~~G~ds~g~~~~s~~emWk~~~~~d~~~~~~~~~~Y~~a~~YWe~veaTvdGMLGGf~~vs~~Di~gS~~F 141 (232)
+..++.++.++|.|++|++|+|.++||++++..+.+ ....+||.++.+||+++++|+|||||||+++|++|+.+|+.|
T Consensus 8 ~~~~~~~~~~~g~d~~g~~~~~~~~~~~~~~~~~~~--~~~~~~Y~~~~~yW~~~~~t~~~mlgg~~~~~~~d~~~s~~f 85 (254)
T d1xtpa_ 8 KEASSRNLPISGRDTNGKTYRSTDEMWKAELTGDLY--DPEKGWYGKALEYWRTVPATVSGVLGGMDHVHDVDIEGSRNF 85 (254)
T ss_dssp -----CCCCCCEEETTSCEESCHHHHHHHHSCSCTT--CTTTCHHHHHHHHHHTSCSSHHHHTTTCGGGHHHHHHHHHHH
T ss_pred cccccccccccccCCCCCEeccHHHHHHHHhccccc--ccchhhhhchhhhhhcCchhcccccCCccccchhhHHHHHHH
Confidence 455677999999999999999999999999987655 456689999999999999999999999999999999999999
Q ss_pred HHHHhcCCCCCcCCCcceeeeccCCccccchHHHHhhccCeeEEecCcHHHHHHHHHHhCCCCCCCCCCCCcceEEEecC
Q 026812 142 LQMLLSDRFPNARNNQHLVALDCGSGIGRITKNLLIRYFNEVDLLEPVSHFLDAARESLAPENHMAPDMHKATNFFCVPL 221 (232)
Q Consensus 142 L~~L~~~~~~~~~~~~~~rALDcGAGIGRVTk~lLl~~f~~VDLVEPv~~Fle~Are~l~~~~~~~~~~~rv~n~~~vgL 221 (232)
|+.+.. ....+|||||||+||+|+.||.+.|.+|++|||++.|++.|++++.. .++.+|++.++
T Consensus 86 l~~l~~--------~~~~~vLD~GcG~G~~t~~ll~~~~~~v~~vD~s~~~l~~a~~~~~~--------~~~~~~~~~d~ 149 (254)
T d1xtpa_ 86 IASLPG--------HGTSRALDCGAGIGRITKNLLTKLYATTDLLEPVKHMLEEAKRELAG--------MPVGKFILASM 149 (254)
T ss_dssp HHTSTT--------CCCSEEEEETCTTTHHHHHTHHHHCSEEEEEESCHHHHHHHHHHTTT--------SSEEEEEESCG
T ss_pred HhhCCC--------CCCCeEEEecccCChhhHHHHhhcCceEEEEcCCHHHHHhhhccccc--------cccceeEEccc
Confidence 998765 23468999999999999999999999999999999999999998755 34569999999
Q ss_pred CCccCCC-CCC
Q 026812 222 QVITNII-QYH 231 (232)
Q Consensus 222 QdF~Pe~-~YD 231 (232)
|+|.++. .||
T Consensus 150 ~~~~~~~~~fD 160 (254)
T d1xtpa_ 150 ETATLPPNTYD 160 (254)
T ss_dssp GGCCCCSSCEE
T ss_pred cccccCCCccc
Confidence 9999764 787
|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} | Back information, alignment and structure |
|---|
| >d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} | Back information, alignment and structure |
|---|
| >d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|