Citrus Sinensis ID: 026827


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
MSLAPSSYASLYSPPPLPRTNQNPFLFSQNSHVWFKKNCFLSASGCSCNTLLVKPSVFVAKASETEAQASPEAESGSEEQEEKYEEYEVEIEQPYGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMKMQKRYGKMEQTGELSEKEIIRAERNSGVISNRVREIQMQNYMKKKEQKERREQDLLRVFLGNSGQEDC
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccHHHHccccccccccHHHHccccEEEEEEccccEEEEEEEccccEEEEEEccccccccccccccccEEEEEEccccccEEEccccHHHHHHHHcccccEEEEEEccccHHHHHccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
ccccccccHHHcccccccccccccccccccccccccccEEEcccccccccccccccEEEEEEEccccccccccccccccccccEEEEEEEEccccEEEEEccccccEEEEEEcccccHHHcccEEcccEEEEEEcccccccccHHHccHHHHHHHHccccEEEEEEEccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
mslapssyaslysppplprtnqnpflfsqnshvwfkkncflsasgcscntllvkpSVFVAKAseteaqaspeaesgseeqeEKYEEYEVEIeqpyglkfakgrdggtyidaiapggsadktgmfqvGDKVLATSAVfgteiwpaaeygrtMYTIRQRVGPLLMKMQKRYgkmeqtgelSEKEIIRAERNSGVISNRVREIQMQNYMKKKEQKERREQDLLRVFLGNSGQEDC
MSLAPSSYASLYSPPPLPRTNQNPFLFSQNSHVWFKKNCFLSASGCSCNTLLVKPSVFVAKASeteaqaspeaesgseeqeEKYEEYEVEIEQPYGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGteiwpaaeygrtmYTIRQRVGPLLMKMQKRYGKmeqtgelsekeiiraernsgvisnrvreiqMQNYMkkkeqkerreqDLLRvflgnsgqedc
MslapssyaslysppplpRTNQNPFLFSQNSHVWFKKNCFLSASGCSCNTLLVKPSVFVAKASETeaqaspeaesgseeqeekyeeyeveieqpyGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMKMQKRYGKMEQTGELSEKEIIRAERNSGVISNRVREIQMQNYMkkkeqkerreqDLLRVFLGNSGQEDC
************************FLFSQNSHVWFKKNCFLSASGCSCNTLLVKPSVFVA****************************VEIEQPYGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMKM*******************************************************************
*************************************************************************************EYEVEIEQPYGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMKMQKRYG****************************************************F*********
MSLAPSSYASLYSPPPLPRTNQNPFLFSQNSHVWFKKNCFLSASGCSCNTLLVKPSVFVAKAS*************************VEIEQPYGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMKMQKRYGKMEQTGELSEKEIIRAERNSGVISNRVREIQMQNYM********REQDLLRVFLGNSGQEDC
************SPPPLPRTNQNPFLFSQNSHVWFKKNCFLSASGCSCNTLLVKPSVFVAKASE*****************EKYEEYEVEIEQPYGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMKMQKRYGKMEQTGELSEKEIIRAERNSGVISNRVREIQMQNYMKKKEQKERREQDLLRVFLGNS*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLAPSSYASLYSPPPLPRTNQNPFLFSQNSHVWFKKNCFLSASGCSCNTLLVKPSVFVAKASETEAQASPEAESGSEEQEEKYEEYEVEIEQPYGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMKMQKRYGKMEQTGELSEKEIIRAERNSGVISNRVREIQxxxxxxxxxxxxxxxxxxxxxFLGNSGQEDC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query232 2.2.26 [Sep-21-2011]
F4J117 591 Phosphoglucan phosphatase no no 0.362 0.142 0.273 6e-05
>sp|F4J117|LSF1_ARATH Phosphoglucan phosphatase LSF1, chloroplastic OS=Arabidopsis thaliana GN=LSF1 PE=1 SV=1 Back     alignment and function desciption
 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 44/84 (52%)

Query: 86  EYEVEIEQPYGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAA 145
           EY V +E+P G++FA   DG  ++ AI  G +A+K  +  VGD +   S   G  +    
Sbjct: 76  EYMVTLEKPLGIRFALSADGKIFVHAIKKGSNAEKARIIMVGDTLKKASDSSGGTLVEIK 135

Query: 146 EYGRTMYTIRQRVGPLLMKMQKRY 169
           ++G T   + ++ G   + +++ +
Sbjct: 136 DFGDTKKMLVEKTGSFSLVLERPF 159




Starch granule-associated phosphoglucan phosphatase involved in the control of starch accumulation. Participates to the regulation of the initial steps of starch degradation at the granule surface. May release a different set of phosphate groups from those removed by DSP4.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: -

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
224073126 344 predicted protein [Populus trichocarpa] 0.943 0.636 0.7 3e-79
255564826 337 protein binding protein, putative [Ricin 0.935 0.643 0.724 5e-78
225435790329 PREDICTED: uncharacterized protein LOC10 0.870 0.613 0.731 9e-78
357519275 335 hypothetical protein MTR_8g088420 [Medic 0.918 0.635 0.647 2e-73
357519277332 hypothetical protein MTR_8g088420 [Medic 0.905 0.632 0.638 3e-70
147789082 1051 hypothetical protein VITISV_041015 [Viti 0.724 0.159 0.837 5e-70
297847910 335 binding protein [Arabidopsis lyrata subs 0.862 0.597 0.681 9e-69
449463844 337 PREDICTED: uncharacterized protein LOC10 0.943 0.649 0.606 2e-68
255645435 342 unknown [Glycine max] 0.943 0.640 0.640 6e-67
363807870 340 uncharacterized protein LOC100820619 [Gl 0.943 0.644 0.672 9e-66
>gi|224073126|ref|XP_002303984.1| predicted protein [Populus trichocarpa] gi|222841416|gb|EEE78963.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  300 bits (768), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 161/230 (70%), Positives = 179/230 (77%), Gaps = 11/230 (4%)

Query: 1   MSLAPSSYASLYSPPPLPRTN----QNPFLFSQNSHVWFKKNCFLSASGCSCNTLLVKPS 56
           MSLAPS Y +LYS  PLP ++    Q P LFSQN+H   K   FLS S    NTLL+KPS
Sbjct: 1   MSLAPSRYPALYSSSPLPTSSVQAKQIPLLFSQNTHFLSKNYSFLSTSTAFSNTLLLKPS 60

Query: 57  VFVAKASETEAQASPEAESGSEEQEEKYEEYEVEIE-------QPYGLKFAKGRDGGTYI 109
             + KASETE+Q S  AESGS  + E   E E + E       QPYG+KFAKGRDG TYI
Sbjct: 61  NSILKASETESQTSKSAESGSGGEGEGEGEGEEKYEEYEVEIEQPYGIKFAKGRDGSTYI 120

Query: 110 DAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMKMQKRY 169
           DAIAPGGSADK G F VGDKV+ATSAVFGTEIWPAAEYGRTMYTIRQR+GPL MKMQKRY
Sbjct: 121 DAIAPGGSADKNGKFSVGDKVIATSAVFGTEIWPAAEYGRTMYTIRQRIGPLFMKMQKRY 180

Query: 170 GKMEQTGELSEKEIIRAERNSGVISNRVREIQMQNYMKKKEQKERREQDL 219
           G M+ TGEL+EKEIIRAERNSGVISNRVREIQMQNY++KKEQKE+RE+DL
Sbjct: 181 GNMDYTGELTEKEIIRAERNSGVISNRVREIQMQNYLRKKEQKEQREKDL 230




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255564826|ref|XP_002523407.1| protein binding protein, putative [Ricinus communis] gi|223537357|gb|EEF38986.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225435790|ref|XP_002285744.1| PREDICTED: uncharacterized protein LOC100241562 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357519275|ref|XP_003629926.1| hypothetical protein MTR_8g088420 [Medicago truncatula] gi|217073920|gb|ACJ85320.1| unknown [Medicago truncatula] gi|355523948|gb|AET04402.1| hypothetical protein MTR_8g088420 [Medicago truncatula] gi|388505444|gb|AFK40788.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357519277|ref|XP_003629927.1| hypothetical protein MTR_8g088420 [Medicago truncatula] gi|355523949|gb|AET04403.1| hypothetical protein MTR_8g088420 [Medicago truncatula] Back     alignment and taxonomy information
>gi|147789082|emb|CAN75787.1| hypothetical protein VITISV_041015 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297847910|ref|XP_002891836.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297337678|gb|EFH68095.1| binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449463844|ref|XP_004149641.1| PREDICTED: uncharacterized protein LOC101217229 [Cucumis sativus] gi|449522778|ref|XP_004168403.1| PREDICTED: uncharacterized LOC101217229 [Cucumis sativus] Back     alignment and taxonomy information
>gi|255645435|gb|ACU23213.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|363807870|ref|NP_001242444.1| uncharacterized protein LOC100820619 [Glycine max] gi|255639295|gb|ACU19945.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
TAIR|locus:2193844 335 ZKT "protein containing PDZ do 0.801 0.555 0.603 4.4e-52
TAIR|locus:2167150271 ENH1 "enhancer of sos3-1" [Ara 0.262 0.225 0.387 5.5e-05
TAIR|locus:2193844 ZKT "protein containing PDZ domain, a K-box domain, and a TPR region" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 540 (195.1 bits), Expect = 4.4e-52, P = 4.4e-52
 Identities = 114/189 (60%), Positives = 132/189 (69%)

Query:    19 RTNQNPFLFSQNSHVWFKKNCFLSASGCS-CNTLLVKPSVFVAKASETXXXXXXXXXXXX 77
             +T QNP L +Q+S +   K+ FLS++  S CNT + K      KASET            
Sbjct:    22 QTKQNPSLITQSSFI-SAKSLFLSSNSASLCNTHVAKRRNLALKASETESSAKAEAGGDG 80

Query:    78 XXXXXXXXXXXXXXXXXXGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVF 137
                               GLKF KGRDGGTYIDAI PGGSADKTG F VGD+V+ATSAVF
Sbjct:    81 EEEEKYETYEIEVEQPY-GLKFRKGRDGGTYIDAILPGGSADKTGKFTVGDRVIATSAVF 139

Query:   138 GTEIWPAAEYGRTMYTIRQRVGPLLMKMQKRYGKMEQTGELSEKEIIRAERNSGVISNRV 197
             GTEIWPAAEYGRTMYTIRQR+GPLLM+M+KR GK E TGEL+EKEIIRAERN+G IS+R+
Sbjct:   140 GTEIWPAAEYGRTMYTIRQRIGPLLMQMEKRNGKAEDTGELTEKEIIRAERNAGYISSRL 199

Query:   198 REIQMQNYM 206
             REIQMQNY+
Sbjct:   200 REIQMQNYL 208




GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009611 "response to wounding" evidence=IEP
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0010264 "myo-inositol hexakisphosphate biosynthetic process" evidence=RCA
GO:0015979 "photosynthesis" evidence=RCA
GO:0016117 "carotenoid biosynthetic process" evidence=RCA
TAIR|locus:2167150 ENH1 "enhancer of sos3-1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 9e-05
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 3e-04
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 6e-04
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
 Score = 39.5 bits (93), Expect = 9e-05
 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 7/53 (13%)

Query: 86  EYEVEIE----QPYGLKFAKGRD--GGTYIDAIAPGGSADKTGMFQVGDKVLA 132
              V +        G     G+D  GG ++  + PGG A++ G+ +VGD++L 
Sbjct: 1   VRTVTLRKDPGGGLGFSLRGGKDSGGGIFVSRVEPGGPAERGGL-RVGDRILE 52


May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases. Length = 82

>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 232
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 98.79
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.32
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.21
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.06
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.06
KOG3571 626 consensus Dishevelled 3 and related proteins [Gene 97.77
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 97.72
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 97.54
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 97.39
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 97.15
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 96.99
KOG0609 542 consensus Calcium/calmodulin-dependent serine prot 96.54
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 96.45
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 96.41
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 96.31
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 96.22
PRK11186 667 carboxy-terminal protease; Provisional 96.14
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 96.13
PLN00049 389 carboxyl-terminal processing protease; Provisional 95.78
PRK10139455 serine endoprotease; Provisional 95.76
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 95.48
PRK10139455 serine endoprotease; Provisional 95.43
PRK10942473 serine endoprotease; Provisional 95.19
PRK10898353 serine endoprotease; Provisional 95.17
PRK10942473 serine endoprotease; Provisional 95.08
KOG1892 1629 consensus Actin filament-binding protein Afadin [C 94.99
KOG3553124 consensus Tax interaction protein TIP1 [Cell wall/ 94.79
PRK10779 449 zinc metallopeptidase RseP; Provisional 94.72
KOG3209984 consensus WW domain-containing protein [General fu 94.41
KOG3550207 consensus Receptor targeting protein Lin-7 [Extrac 94.26
TIGR01713259 typeII_sec_gspC general secretion pathway protein 94.15
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 94.14
KOG3580 1027 consensus Tight junction proteins [Signal transduc 93.66
KOG3532 1051 consensus Predicted protein kinase [General functi 93.63
COG3975558 Predicted protease with the C-terminal PDZ domain 92.81
KOG3938334 consensus RGS-GAIP interacting protein GIPC, conta 92.69
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 92.35
PRK10779 449 zinc metallopeptidase RseP; Provisional 92.24
KOG3606358 consensus Cell polarity protein PAR6 [Signal trans 92.07
KOG3580 1027 consensus Tight junction proteins [Signal transduc 91.88
KOG3605829 consensus Beta amyloid precursor-binding protein [ 91.31
KOG3209 984 consensus WW domain-containing protein [General fu 90.76
KOG3542 1283 consensus cAMP-regulated guanine nucleotide exchan 90.46
COG0265347 DegQ Trypsin-like serine proteases, typically peri 90.02
KOG3129231 consensus 26S proteasome regulatory complex, subun 89.97
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 86.66
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 85.0
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 83.67
KOG3651 429 consensus Protein kinase C, alpha binding protein 83.4
KOG3552 1298 consensus FERM domain protein FRM-8 [General funct 82.86
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
Probab=98.79  E-value=2.2e-08  Score=71.86  Aligned_cols=74  Identities=23%  Similarity=0.618  Sum_probs=60.0

Q ss_pred             EEEecC----cceeEEeeeCCC---CeEEEEeCCCCCcccccccccCcEEEEeecccCCceeeccchhhHHHHhhcccCc
Q 026827           88 EVEIEQ----PYGLKFAKGRDG---GTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGP  160 (232)
Q Consensus        88 eVeL~K----PLGL~Fee~~dG---gvyV~eV~pGGNAaKaG~I~VGD~LvatSA~FGdElWpA~~~G~t~~AIr~RsGp  160 (232)
                      +|+|.|    |+|+.+..+.+.   ++||.+|.|+|.|+++| |++||+|+.+...   .+ .....-+++.+|+...++
T Consensus         1 ~v~l~k~~~~~lG~~l~~~~~~~~~~~~V~~v~~~~~a~~~g-l~~GD~Il~INg~---~v-~~~~~~~~~~~l~~~~~~   75 (81)
T PF00595_consen    1 QVTLEKSGNGPLGFTLRGGSDNDEKGVFVSSVVPGSPAERAG-LKVGDRILEINGQ---SV-RGMSHDEVVQLLKSASNP   75 (81)
T ss_dssp             EEEEEESTTSBSSEEEEEESTSSSEEEEEEEECTTSHHHHHT-SSTTEEEEEETTE---ES-TTSBHHHHHHHHHHSTSE
T ss_pred             CEEEEeCCCCCcCEEEEecCCCCcCCEEEEEEeCCChHHhcc-cchhhhhheeCCE---eC-CCCCHHHHHHHHHCCCCc
Confidence            355555    999999998775   99999999999999999 9999999998763   22 222455788899988889


Q ss_pred             eEEEEe
Q 026827          161 LLMKMQ  166 (232)
Q Consensus       161 v~LkLe  166 (232)
                      |.|+++
T Consensus        76 v~L~V~   81 (81)
T PF00595_consen   76 VTLTVQ   81 (81)
T ss_dssp             EEEEEE
T ss_pred             EEEEEC
Confidence            999875



PDZ domains can occur in one or multiple copies and are nearly always found in cytoplasmic proteins. They bind either the carboxyl-terminal sequences of proteins or internal peptide sequences []. In most cases, interaction between a PDZ domain and its target is constitutive, with a binding affinity of 1 to 10 microns. However, agonist-dependent activation of cell surface receptors is sometimes required to promote interaction with a PDZ protein. PDZ domain proteins are frequently associated with the plasma membrane, a compartment where high concentrations of phosphatidylinositol 4,5-bisphosphate (PIP2) are found. Direct interaction between PIP2 and a subset of class II PDZ domains (syntenin, CASK, Tiam-1) has been demonstrated. PDZ domains consist of 80 to 90 amino acids comprising six beta-strands (beta-A to beta-F) and two alpha-helices, A and B, compactly arranged in a globular structure. Peptide binding of the ligand takes place in an elongated surface groove as an anti-parallel beta-strand interacts with the beta-B strand and the B helix. The structure of PDZ domains allows binding to a free carboxylate group at the end of a peptide through a carboxylate-binding loop between the beta-A and beta-B strands.; GO: 0005515 protein binding; PDB: 3AXA_A 1WF8_A 1QAV_B 1QAU_A 1B8Q_A 1MC7_A 2KAW_A 1I16_A 1VB7_A 1WI4_A ....

>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>KOG3571 consensus Dishevelled 3 and related proteins [General function prediction only] Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG0609 consensus Calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton] Back     alignment and domain information
>KOG3553 consensus Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>KOG3209 consensus WW domain-containing protein [General function prediction only] Back     alignment and domain information
>KOG3550 consensus Receptor targeting protein Lin-7 [Extracellular structures] Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3532 consensus Predicted protein kinase [General function prediction only] Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG3938 consensus RGS-GAIP interacting protein GIPC, contains PDZ domain [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>KOG3606 consensus Cell polarity protein PAR6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only] Back     alignment and domain information
>KOG3209 consensus WW domain-containing protein [General function prediction only] Back     alignment and domain information
>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3129 consensus 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>KOG3651 consensus Protein kinase C, alpha binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG3552 consensus FERM domain protein FRM-8 [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 1e-08
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 2e-08
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 2e-08
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 6e-08
2djt_A104 Unnamed protein product; PDZ domain, structural ge 9e-08
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 1e-07
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 1e-07
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 1e-07
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 1e-07
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 2e-07
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 2e-07
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 4e-07
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 4e-07
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 4e-07
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 4e-07
2opg_A98 Multiple PDZ domain protein; structural protein, s 6e-07
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 6e-07
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 6e-07
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 7e-07
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 7e-07
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 7e-07
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 1e-06
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-06
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 1e-06
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 1e-06
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 1e-06
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 2e-06
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 2e-06
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 2e-06
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 2e-06
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-06
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-05
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 2e-06
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 2e-06
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 3e-06
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 3e-06
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 4e-05
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 3e-06
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 5e-06
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 5e-06
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 5e-06
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 5e-06
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 5e-06
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 6e-06
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 6e-06
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 6e-06
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 7e-06
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 7e-06
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 7e-06
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 2e-05
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 7e-06
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 8e-06
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 8e-06
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 8e-06
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 9e-06
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
2byg_A117 Channel associated protein of synapse-110; DLG2, P 1e-05
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 1e-05
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 1e-05
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 1e-05
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 1e-05
2fne_A117 Multiple PDZ domain protein; structural protein, s 2e-05
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 2e-05
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 2e-05
2o2t_A117 Multiple PDZ domain protein; structural protein, s 2e-05
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 2e-05
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 2e-05
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 2e-05
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 2e-05
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 2e-05
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 2e-05
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 2e-05
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 3e-05
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 7e-05
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 3e-05
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 3e-05
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 3e-05
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 3e-05
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 3e-05
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 4e-05
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 4e-05
2awx_A105 Synapse associated protein 97; membrane protein, s 4e-05
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 4e-05
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 5e-05
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 5e-05
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 6e-05
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 6e-05
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 7e-05
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 4e-04
2eeh_A100 PDZ domain-containing protein 7; structural genomi 8e-05
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 8e-05
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 8e-05
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 9e-05
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 9e-05
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 1e-04
2eaq_A90 LIM domain only protein 7; conserved hypothetical 1e-04
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 1e-04
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 1e-04
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 1e-04
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 1e-04
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 1e-04
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 1e-04
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 1e-04
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 2e-04
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 2e-04
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 2e-04
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 2e-04
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 2e-04
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 2e-04
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 3e-04
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 3e-04
3k1r_A192 Harmonin; protein-protein complex, alternative spl 3e-04
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 4e-04
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 4e-04
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 5e-04
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 5e-04
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 5e-04
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 5e-04
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 6e-04
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 7e-04
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 8e-04
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
 Score = 50.4 bits (121), Expect = 1e-08
 Identities = 19/75 (25%), Positives = 34/75 (45%), Gaps = 6/75 (8%)

Query: 64  ETEAQASPEAESGSEEQE-EKYEEYEVEIE-QPYGLKF--AKGRDGGT--YIDAIAPGGS 117
                 S   + G+E    +  + Y VE+E    G  F    GR+     Y+  +A  G 
Sbjct: 2   HHHHHHSSGVDLGTENLYFQSMDFYTVELERGAKGFGFSLRGGREYNMDLYVLRLAEDGP 61

Query: 118 ADKTGMFQVGDKVLA 132
           A+++G  ++GD++L 
Sbjct: 62  AERSGKMRIGDEILE 76


>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 98.78
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 98.76
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 98.7
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 98.67
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 98.67
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 98.65
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.64
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 98.62
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 98.61
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 98.61
2opg_A98 Multiple PDZ domain protein; structural protein, s 98.6
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 98.6
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 98.6
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 98.58
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 98.58
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 98.58
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 98.57
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 98.57
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 98.57
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 98.57
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 98.57
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 98.56
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 98.55
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 98.55
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 98.54
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 98.53
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 98.52
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 98.51
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 98.51
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 98.51
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 98.51
2awx_A105 Synapse associated protein 97; membrane protein, s 98.49
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 98.49
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 98.49
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 98.48
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 98.48
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 98.48
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 98.47
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 98.47
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 98.47
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 98.46
2o2t_A117 Multiple PDZ domain protein; structural protein, s 98.46
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 98.45
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 98.45
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 98.44
2d90_A102 PDZ domain containing protein 1; structural genomi 98.44
2byg_A117 Channel associated protein of synapse-110; DLG2, P 98.42
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 98.42
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 98.42
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 98.42
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 98.42
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 98.42
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 98.41
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 98.41
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 98.41
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 98.4
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 98.4
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 98.4
2djt_A104 Unnamed protein product; PDZ domain, structural ge 98.39
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 98.39
2eeh_A100 PDZ domain-containing protein 7; structural genomi 98.39
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 98.39
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 98.39
2fne_A117 Multiple PDZ domain protein; structural protein, s 98.38
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 98.38
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 98.37
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 98.36
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 98.35
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 98.35
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 98.35
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 98.34
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.34
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 98.33
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 98.32
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 98.31
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 98.31
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 98.31
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 98.3
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.3
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 98.29
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 98.29
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 98.29
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 98.29
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 98.28
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 98.28
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 98.28
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 98.26
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 98.26
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 98.26
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.26
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 98.26
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 98.25
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.24
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 98.24
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 98.24
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.24
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 98.23
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 98.23
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 98.23
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 98.23
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 98.22
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 98.22
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 98.21
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 98.2
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 98.19
2ego_A96 General receptor for phosphoinositides 1- associat 98.19
4amh_A106 Disks large homolog 1; permutation, protein foldin 98.18
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 98.18
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 98.18
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 98.17
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 98.17
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 98.17
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 98.16
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 98.15
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 98.15
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 98.13
2v90_A96 PDZ domain-containing protein 3; membrane, protein 98.12
2eaq_A90 LIM domain only protein 7; conserved hypothetical 98.12
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 98.12
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 98.11
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 98.1
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 98.1
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 98.1
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 98.09
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 98.08
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 98.08
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 98.08
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 98.06
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.06
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 98.06
2eei_A106 PDZ domain-containing protein 1; regulatory factor 98.05
3k1r_A192 Harmonin; protein-protein complex, alternative spl 98.05
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 98.04
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 98.04
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 98.04
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 98.02
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 98.02
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 97.99
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 97.99
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 97.96
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 97.93
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 97.93
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 97.9
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 97.89
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 97.86
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 97.85
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 97.85
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 97.84
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 97.83
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 97.83
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 97.82
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 97.81
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 97.8
3khf_A99 Microtubule-associated serine/threonine-protein ki 97.77
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 97.73
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 97.7
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 97.69
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 97.66
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 97.61
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 97.57
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 96.68
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 97.49
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 97.47
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 97.45
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 97.41
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 97.32
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 97.3
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 97.3
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 97.3
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 97.23
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 97.19
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 97.19
2kl1_A94 YLBL protein; structure genomics, structural genom 97.15
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 97.14
4fgm_A597 Aminopeptidase N family protein; structural genomi 97.09
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 97.06
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 97.03
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 96.98
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 96.98
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 96.8
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 96.8
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 96.73
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 96.69
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 96.55
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 96.48
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 96.46
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 96.43
2hga_A125 Conserved protein MTH1368; GFT structural genomics 96.37
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 96.2
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 96.19
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 96.18
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 96.16
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 96.11
3k50_A 403 Putative S41 protease; structural genomics, joint 95.6
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 95.38
1k32_A 1045 Tricorn protease; protein degradation, substrate g 95.02
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 95.01
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 93.69
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 93.46
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 93.43
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
Probab=98.78  E-value=2.4e-08  Score=71.37  Aligned_cols=81  Identities=20%  Similarity=0.413  Sum_probs=61.6

Q ss_pred             ccEEEEEecC----cceeEEeeeC-CCCeEEEEeCCCCCcccccccccCcEEEEeecccCCceeeccchhhHHHHhhccc
Q 026827           84 YEEYEVEIEQ----PYGLKFAKGR-DGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRV  158 (232)
Q Consensus        84 ~eeyeVeL~K----PLGL~Fee~~-dGgvyV~eV~pGGNAaKaG~I~VGD~LvatSA~FGdElWpA~~~G~t~~AIr~Rs  158 (232)
                      ++.++|+|.|    ++|+.+.... +.+++|..|.+++.|+++|.|++||+|+++...   .+=. ..+.++...++...
T Consensus         3 ~~~~~v~l~k~~~~~lG~~~~~~~~~~gv~V~~V~~~spA~~aG~L~~GD~I~~vng~---~v~~-~~~~~~~~~~~~~~   78 (92)
T 2qg1_A            3 SDTLTIGLQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGE---DVRN-ATQEAVAALLKCSL   78 (92)
T ss_dssp             -CEEEEEEECCTTSCCSEEEECCSSSCSCEEEEECTTSHHHHHTCCCTTCEEEEETTE---ECTT-CCHHHHHHHHHHCC
T ss_pred             ceEEEEEEEeCCCCcccEEEEeccCCCCEEEEEECCCCHHHHcCCCCCCCEEEEECCE---ECCC-CCHHHHHHHHHcCC
Confidence            4678999987    4889988754 359999999999999999999999999998753   2211 12345666777656


Q ss_pred             CceEEEEeec
Q 026827          159 GPLLMKMQKR  168 (232)
Q Consensus       159 Gpv~LkLeR~  168 (232)
                      +++.|.+.|+
T Consensus        79 ~~v~l~v~R~   88 (92)
T 2qg1_A           79 GTVTLEVGRI   88 (92)
T ss_dssp             SEEEEEEECC
T ss_pred             CeEEEEEEcc
Confidence            7899999885



>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 232
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-06
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 7e-06
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 4e-05
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 5e-05
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 6e-05
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 1e-04
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 2e-04
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-04
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 3e-04
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 3e-04
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 4e-04
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 5e-04
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 8e-04
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 8e-04
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 9e-04
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 0.001
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 0.001
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 0.002
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 0.002
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 0.002
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 0.003
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 0.003
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 0.003
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 0.004
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 43.0 bits (101), Expect = 2e-06
 Identities = 17/64 (26%), Positives = 33/64 (51%), Gaps = 7/64 (10%)

Query: 73  AESGSEEQEEKYEEYEVEIE---QPYGLKFAKGRD--GGTYIDAIAPGGSADKTGMFQVG 127
             SGS  Q+  ++ + V++E   + +G     GR+     Y+  +A  G A + G  +VG
Sbjct: 1   GSSGSSGQD--FDYFTVDMEKGAKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVG 58

Query: 128 DKVL 131
           D+++
Sbjct: 59  DQII 62


>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.01
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 98.95
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 98.86
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 98.86
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 98.85
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 98.84
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 98.83
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 98.82
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 98.81
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 98.81
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 98.8
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 98.77
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 98.76
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 98.75
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 98.74
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 98.71
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 98.7
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.69
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 98.69
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 98.68
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 98.68
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 98.66
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.66
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 98.64
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 98.63
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 98.63
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 98.63
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.63
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 98.6
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 98.59
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 98.56
d1x45a185 Amyloid beta A4 precursor protein-binding family A 98.52
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 98.49
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 98.47
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 98.46
d1rzxa_98 GTPase-binding domain of the cell polarity protein 98.45
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 98.42
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 98.41
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.41
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 98.41
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 98.41
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 98.41
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 98.39
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 98.38
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 98.33
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 98.33
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 98.32
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 98.32
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 98.32
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 98.3
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.29
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.24
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 98.2
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 98.13
d1fc6a392 Photosystem II D1 C-terminal processing protease { 98.12
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.1
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 98.02
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 98.01
d1y7na179 Amyloid beta A4 precursor protein-binding family A 97.97
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 97.93
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 97.92
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 97.83
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 97.69
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 97.54
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 97.38
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 97.25
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 97.2
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 97.03
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 97.0
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 96.01
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Phosphatase hPTP1e
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.01  E-value=7.3e-10  Score=80.73  Aligned_cols=84  Identities=29%  Similarity=0.463  Sum_probs=66.5

Q ss_pred             cccEEEEEecC---cceeEEeee----------CCCCeEEEEeCCCCCcccccccccCcEEEEeecccCCceeeccchhh
Q 026827           83 KYEEYEVEIEQ---PYGLKFAKG----------RDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGR  149 (232)
Q Consensus        83 ~~eeyeVeL~K---PLGL~Fee~----------~dGgvyV~eV~pGGNAaKaG~I~VGD~LvatSA~FGdElWpA~~~G~  149 (232)
                      |-+.|+|+|.|   +||+.+...          .++++||..|.|+|.|+++|.|++||+|+++-..   .|- -..+-+
T Consensus         2 pg~~~~V~L~k~~~~lG~~i~~~~~~~g~~~~~~~~~i~V~~V~~gg~A~~~G~L~~GD~Il~VNg~---~v~-~~s~~~   77 (99)
T d1ozia_           2 PGDTFEVELAKTDGSLGISVTVLFDKGGVNTSVRHGGIYVKAIIPKGAAESDGRIHKGDRVLAVNGV---SLE-GATHKQ   77 (99)
T ss_dssp             TTCEEEEEEECCSSSCSEEEESCCSSSCSSCSSSCCCEEEEEECSSSHHHHHTCCCTTCEEEEETTE---ECS-SCCHHH
T ss_pred             CCCEEEEEEEECCCCCcEEEEeeccCCCcccccCCCCEEEEEECCCChHHhcCCCCccCEEEEECCE---EcC-CCCHHH
Confidence            34679999976   688988643          2347999999999999999999999999998752   232 226668


Q ss_pred             HHHHhhcccCceEEEEeecCC
Q 026827          150 TMYTIRQRVGPLLMKMQKRYG  170 (232)
Q Consensus       150 t~~AIr~RsGpv~LkLeR~~~  170 (232)
                      ++.+|+.-...|.|++.|..-
T Consensus        78 a~~~lk~~~~~v~L~v~R~~~   98 (99)
T d1ozia_          78 AVETLRNTGQVVHLLLEKGQV   98 (99)
T ss_dssp             HHHHHHHSCSEEEEEEECCCC
T ss_pred             HHHHHHCCCCeEEEEEEeCCC
Confidence            889999767889999999643



>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure