Citrus Sinensis ID: 026827

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--

MSLAPSSYASLYSPPPLPRTNQNPFLFSQNSHVWFKKNCFLSASGCSCNTLLVKPSVFVAKASETEAQASPEAESGSEEQEEKYEEYEVEIEQPYGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMKMQKRYGKMEQTGELSEKEIIRAERNSGVISNRVREIQMQNYMKKKEQKERREQDLLRVFLGNSGQEDC

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccHHHHccccccccccHHHHccccEEEEEEccccEEEEEEEccccEEEEEEccccccccccccccccEEEEEEccccccEEEccccHHHHHHHHcccccEEEEEEccccHHHHHccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc

ccccccccHHHcccccccccccccccccccccccccccEEEcccccccccccccccEEEEEEEccccccccccccccccccccEEEEEEEEccccEEEEEccccccEEEEEEcccccHHHcccEEcccEEEEEEcccccccccHHHccHHHHHHHHccccEEEEEEEccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc

mslapssyaslysppplprtnqnpflfsqnshvwfkkncflsasgcscntllvkpSVFVAKAseteaqaspeaesgseeqeEKYEEYEVEIeqpyglkfakgrdggtyidaiapggsadktgmfqvGDKVLATSAVfgteiwpaaeygrtMYTIRQRVGPLLMKMQKRYgkmeqtgelSEKEIIRAERNSGVISNRVREIQMQNYMKKKEQKERREQDLLRVFLGNSGQEDC

MSLAPSSYASLYSPPPLPRTNQNPFLFSQNSHVWFKKNCFLSASGCSCNTLLVKPSVFVAKASeteaqaspeaesgseeqeEKYEEYEVEIEQPYGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGteiwpaaeygrtmYTIRQRVGPLLMKMQKRYGKmeqtgelsekeiiraernsgvisnrvreiqMQNYMkkkeqkerreqDLLRvflgnsgqedc

MslapssyaslysppplpRTNQNPFLFSQNSHVWFKKNCFLSASGCSCNTLLVKPSVFVAKASETeaqaspeaesgseeqeekyeeyeveieqpyGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMKMQKRYGKMEQTGELSEKEIIRAERNSGVISNRVREIQMQNYMkkkeqkerreqDLLRVFLGNSGQEDC

************************FLFSQNSHVWFKKNCFLSASGCSCNTLLVKPSVFVA****************************VEIEQPYGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMKM*******************************************************************

*************************************************************************************EYEVEIEQPYGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMKMQKRYG****************************************************F*********

MSLAPSSYASLYSPPPLPRTNQNPFLFSQNSHVWFKKNCFLSASGCSCNTLLVKPSVFVAKAS*************************VEIEQPYGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMKMQKRYGKMEQTGELSEKEIIRAERNSGVISNRVREIQMQNYM********REQDLLRVFLGNSGQEDC

************SPPPLPRTNQNPFLFSQNSHVWFKKNCFLSASGCSCNTLLVKPSVFVAKASE*****************EKYEEYEVEIEQPYGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMKMQKRYGKMEQTGELSEKEIIRAERNSGVISNRVREIQMQNYMKKKEQKERREQDLLRVFLGNS*****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		232	2.2.26 [Sep-21-2011]
F4J117		591	Phosphoglucan phosphatase	no	no	0.362	0.142	0.273	6e-05

>sp\|F4J117\|LSF1_ARATH Phosphoglucan phosphatase LSF1, chloroplastic OS=Arabidopsis thaliana GN=LSF1 PE=1 SV=1	Back alignment and function desciption

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 44/84 (52%)

Query: 86  EYEVEIEQPYGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAA 145
           EY V +E+P G++FA   DG  ++ AI  G +A+K  +  VGD +   S   G  +    
Sbjct: 76  EYMVTLEKPLGIRFALSADGKIFVHAIKKGSNAEKARIIMVGDTLKKASDSSGGTLVEIK 135

Query: 146 EYGRTMYTIRQRVGPLLMKMQKRY 169
           ++G T   + ++ G   + +++ +
Sbjct: 136 DFGDTKKMLVEKTGSFSLVLERPF 159

Starch granule-associated phosphoglucan phosphatase involved in the control of starch accumulation. Participates to the regulation of the initial steps of starch degradation at the granule surface. May release a different set of phosphate groups from those removed by DSP4.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: -

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		232
224073126		344	predicted protein [Populus trichocarpa]	0.943	0.636	0.7	3e-79
255564826		337	protein binding protein, putative [Ricin	0.935	0.643	0.724	5e-78
225435790		329	PREDICTED: uncharacterized protein LOC10	0.870	0.613	0.731	9e-78
357519275		335	hypothetical protein MTR_8g088420 [Medic	0.918	0.635	0.647	2e-73
357519277		332	hypothetical protein MTR_8g088420 [Medic	0.905	0.632	0.638	3e-70
147789082		1051	hypothetical protein VITISV_041015 [Viti	0.724	0.159	0.837	5e-70
297847910		335	binding protein [Arabidopsis lyrata subs	0.862	0.597	0.681	9e-69
449463844		337	PREDICTED: uncharacterized protein LOC10	0.943	0.649	0.606	2e-68
255645435		342	unknown [Glycine max]	0.943	0.640	0.640	6e-67
363807870		340	uncharacterized protein LOC100820619 [Gl	0.943	0.644	0.672	9e-66

>gi\|224073126\|ref\|XP_002303984.1\| predicted protein [Populus trichocarpa] gi\|222841416\|gb\|EEE78963.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  300 bits (768), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 161/230 (70%), Positives = 179/230 (77%), Gaps = 11/230 (4%)

Query: 1   MSLAPSSYASLYSPPPLPRTN----QNPFLFSQNSHVWFKKNCFLSASGCSCNTLLVKPS 56
           MSLAPS Y +LYS  PLP ++    Q P LFSQN+H   K   FLS S    NTLL+KPS
Sbjct: 1   MSLAPSRYPALYSSSPLPTSSVQAKQIPLLFSQNTHFLSKNYSFLSTSTAFSNTLLLKPS 60

Query: 57  VFVAKASETEAQASPEAESGSEEQEEKYEEYEVEIE-------QPYGLKFAKGRDGGTYI 109
             + KASETE+Q S  AESGS  + E   E E + E       QPYG+KFAKGRDG TYI
Sbjct: 61  NSILKASETESQTSKSAESGSGGEGEGEGEGEEKYEEYEVEIEQPYGIKFAKGRDGSTYI 120

Query: 110 DAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMKMQKRY 169
           DAIAPGGSADK G F VGDKV+ATSAVFGTEIWPAAEYGRTMYTIRQR+GPL MKMQKRY
Sbjct: 121 DAIAPGGSADKNGKFSVGDKVIATSAVFGTEIWPAAEYGRTMYTIRQRIGPLFMKMQKRY 180

Query: 170 GKMEQTGELSEKEIIRAERNSGVISNRVREIQMQNYMKKKEQKERREQDL 219
           G M+ TGEL+EKEIIRAERNSGVISNRVREIQMQNY++KKEQKE+RE+DL
Sbjct: 181 GNMDYTGELTEKEIIRAERNSGVISNRVREIQMQNYLRKKEQKEQREKDL 230

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255564826\|ref\|XP_002523407.1\| protein binding protein, putative [Ricinus communis] gi\|223537357\|gb\|EEF38986.1\| protein binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|225435790\|ref\|XP_002285744.1\| PREDICTED: uncharacterized protein LOC100241562 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|357519275\|ref\|XP_003629926.1\| hypothetical protein MTR_8g088420 [Medicago truncatula] gi\|217073920\|gb\|ACJ85320.1\| unknown [Medicago truncatula] gi\|355523948\|gb\|AET04402.1\| hypothetical protein MTR_8g088420 [Medicago truncatula] gi\|388505444\|gb\|AFK40788.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

>gi\|357519277\|ref\|XP_003629927.1\| hypothetical protein MTR_8g088420 [Medicago truncatula] gi\|355523949\|gb\|AET04403.1\| hypothetical protein MTR_8g088420 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|147789082\|emb\|CAN75787.1\| hypothetical protein VITISV_041015 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297847910\|ref\|XP_002891836.1\| binding protein [Arabidopsis lyrata subsp. lyrata] gi\|297337678\|gb\|EFH68095.1\| binding protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|449463844\|ref\|XP_004149641.1\| PREDICTED: uncharacterized protein LOC101217229 [Cucumis sativus] gi\|449522778\|ref\|XP_004168403.1\| PREDICTED: uncharacterized LOC101217229 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|255645435\|gb\|ACU23213.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|363807870\|ref\|NP_001242444.1\| uncharacterized protein LOC100820619 [Glycine max] gi\|255639295\|gb\|ACU19945.1\| unknown [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		232
TAIR\|locus:2193844		335	ZKT "protein containing PDZ do	0.801	0.555	0.603	4.4e-52
TAIR\|locus:2167150		271	ENH1 "enhancer of sos3-1" [Ara	0.262	0.225	0.387	5.5e-05

TAIR\|locus:2193844 ZKT "protein containing PDZ domain, a K-box domain, and a TPR region" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 540 (195.1 bits), Expect = 4.4e-52, P = 4.4e-52
 Identities = 114/189 (60%), Positives = 132/189 (69%)

Query:    19 RTNQNPFLFSQNSHVWFKKNCFLSASGCS-CNTLLVKPSVFVAKASETXXXXXXXXXXXX 77
             +T QNP L +Q+S +   K+ FLS++  S CNT + K      KASET            
Sbjct:    22 QTKQNPSLITQSSFI-SAKSLFLSSNSASLCNTHVAKRRNLALKASETESSAKAEAGGDG 80

Query:    78 XXXXXXXXXXXXXXXXXXGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVF 137
                               GLKF KGRDGGTYIDAI PGGSADKTG F VGD+V+ATSAVF
Sbjct:    81 EEEEKYETYEIEVEQPY-GLKFRKGRDGGTYIDAILPGGSADKTGKFTVGDRVIATSAVF 139

Query:   138 GTEIWPAAEYGRTMYTIRQRVGPLLMKMQKRYGKMEQTGELSEKEIIRAERNSGVISNRV 197
             GTEIWPAAEYGRTMYTIRQR+GPLLM+M+KR GK E TGEL+EKEIIRAERN+G IS+R+
Sbjct:   140 GTEIWPAAEYGRTMYTIRQRIGPLLMQMEKRNGKAEDTGELTEKEIIRAERNAGYISSRL 199

Query:   198 REIQMQNYM 206
             REIQMQNY+
Sbjct:   200 REIQMQNYL 208

GO:0009507 "chloroplast" evidence=ISM;IDA

GO:0009941 "chloroplast envelope" evidence=IDA

GO:0009535 "chloroplast thylakoid membrane" evidence=IDA

GO:0009611 "response to wounding" evidence=IEP

GO:0009570 "chloroplast stroma" evidence=IDA

GO:0009534 "chloroplast thylakoid" evidence=IDA

GO:0010264 "myo-inositol hexakisphosphate biosynthetic process" evidence=RCA

GO:0015979 "photosynthesis" evidence=RCA

GO:0016117 "carotenoid biosynthetic process" evidence=RCA

TAIR\|locus:2167150 ENH1 "enhancer of sos3-1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		232
cd00992		82	cd00992, PDZ_signaling, PDZ domain found in a vari	9e-05
smart00228		85	smart00228, PDZ, Domain present in PSD-95, Dlg, an	3e-04
cd00136		70	cd00136, PDZ, PDZ domain, also called DHR (Dlg hom	6e-04

>gnl\|CDD\|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements	Back alignment and domain information

 Score = 39.5 bits (93), Expect = 9e-05
 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 7/53 (13%)

Query: 86  EYEVEIE----QPYGLKFAKGRD--GGTYIDAIAPGGSADKTGMFQVGDKVLA 132
              V +        G     G+D  GG ++  + PGG A++ G+ +VGD++L 
Sbjct: 1   VRTVTLRKDPGGGLGFSLRGGKDSGGGIFVSRVEPGGPAERGGL-RVGDRILE 52

May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases. Length = 82

>gnl\|CDD\|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2	Back alignment and domain information

>gnl\|CDD\|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif)	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		232
PF00595		81	PDZ: PDZ domain (Also known as DHR or GLGF) Coordi	98.79
cd00992		82	PDZ_signaling PDZ domain found in a variety of Eum	98.32
cd00136		70	PDZ PDZ domain, also called DHR (Dlg homologous re	98.21
PF13180		82	PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_	98.06
smart00228		85	PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als	98.06
KOG3571		626	consensus Dishevelled 3 and related proteins [Gene	97.77
cd00990		80	PDZ_glycyl_aminopeptidase PDZ domain associated wi	97.72
cd00988		85	PDZ_CTP_protease PDZ domain of C-terminal processi	97.54
cd00987		90	PDZ_serine_protease PDZ domain of tryspin-like ser	97.39
cd00991		79	PDZ_archaeal_metalloprotease PDZ domain of archaea	97.15
cd00989		79	PDZ_metalloprotease PDZ domain of bacterial and pl	96.99
KOG0609		542	consensus Calcium/calmodulin-dependent serine prot	96.54
cd00986		79	PDZ_LON_protease PDZ domain of ATP-dependent LON s	96.45
TIGR00225		334	prc C-terminal peptidase (prc). A C-terminal pepti	96.41
TIGR02037		428	degP_htrA_DO periplasmic serine protease, Do/DeqQ	96.31
COG0793		406	Prc Periplasmic protease [Cell envelope biogenesis	96.22
PRK11186		667	carboxy-terminal protease; Provisional	96.14
TIGR02037		428	degP_htrA_DO periplasmic serine protease, Do/DeqQ	96.13
PLN00049		389	carboxyl-terminal processing protease; Provisional	95.78
PRK10139		455	serine endoprotease; Provisional	95.76
TIGR02038		351	protease_degS periplasmic serine pepetdase DegS. T	95.48
PRK10139		455	serine endoprotease; Provisional	95.43
PRK10942		473	serine endoprotease; Provisional	95.19
PRK10898		353	serine endoprotease; Provisional	95.17
PRK10942		473	serine endoprotease; Provisional	95.08
KOG1892		1629	consensus Actin filament-binding protein Afadin [C	94.99
KOG3553		124	consensus Tax interaction protein TIP1 [Cell wall/	94.79
PRK10779		449	zinc metallopeptidase RseP; Provisional	94.72
KOG3209		984	consensus WW domain-containing protein [General fu	94.41
KOG3550		207	consensus Receptor targeting protein Lin-7 [Extrac	94.26
TIGR01713		259	typeII_sec_gspC general secretion pathway protein	94.15
TIGR00054		420	RIP metalloprotease RseP. A model that detects fra	94.14
KOG3580		1027	consensus Tight junction proteins [Signal transduc	93.66
KOG3532		1051	consensus Predicted protein kinase [General functi	93.63
COG3975		558	Predicted protease with the C-terminal PDZ domain	92.81
KOG3938		334	consensus RGS-GAIP interacting protein GIPC, conta	92.69
TIGR00054		420	RIP metalloprotease RseP. A model that detects fra	92.35
PRK10779		449	zinc metallopeptidase RseP; Provisional	92.24
KOG3606		358	consensus Cell polarity protein PAR6 [Signal trans	92.07
KOG3580		1027	consensus Tight junction proteins [Signal transduc	91.88
KOG3605		829	consensus Beta amyloid precursor-binding protein [	91.31
KOG3209		984	consensus WW domain-containing protein [General fu	90.76
KOG3542		1283	consensus cAMP-regulated guanine nucleotide exchan	90.46
COG0265		347	DegQ Trypsin-like serine proteases, typically peri	90.02
KOG3129		231	consensus 26S proteasome regulatory complex, subun	89.97
TIGR03279		433	cyano_FeS_chp putative FeS-containing Cyanobacteri	86.66
TIGR02860		402	spore_IV_B stage IV sporulation protein B. SpoIVB,	85.0
PF14685		88	Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6	83.67
KOG3651		429	consensus Protein kinase C, alpha binding protein	83.4
KOG3552		1298	consensus FERM domain protein FRM-8 [General funct	82.86

>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ]	Back alignment and domain information

Probab=98.79  E-value=2.2e-08  Score=71.86  Aligned_cols=74  Identities=23%  Similarity=0.618  Sum_probs=60.0

Q ss_pred             EEEecC----cceeEEeeeCCC---CeEEEEeCCCCCcccccccccCcEEEEeecccCCceeeccchhhHHHHhhcccCc
Q 026827           88 EVEIEQ----PYGLKFAKGRDG---GTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGP  160 (232)
Q Consensus        88 eVeL~K----PLGL~Fee~~dG---gvyV~eV~pGGNAaKaG~I~VGD~LvatSA~FGdElWpA~~~G~t~~AIr~RsGp  160 (232)
                      +|+|.|    |+|+.+..+.+.   ++||.+|.|+|.|+++| |++||+|+.+...   .+ .....-+++.+|+...++
T Consensus         1 ~v~l~k~~~~~lG~~l~~~~~~~~~~~~V~~v~~~~~a~~~g-l~~GD~Il~INg~---~v-~~~~~~~~~~~l~~~~~~   75 (81)
T PF00595_consen    1 QVTLEKSGNGPLGFTLRGGSDNDEKGVFVSSVVPGSPAERAG-LKVGDRILEINGQ---SV-RGMSHDEVVQLLKSASNP   75 (81)
T ss_dssp             EEEEEESTTSBSSEEEEEESTSSSEEEEEEEECTTSHHHHHT-SSTTEEEEEETTE---ES-TTSBHHHHHHHHHHSTSE
T ss_pred             CEEEEeCCCCCcCEEEEecCCCCcCCEEEEEEeCCChHHhcc-cchhhhhheeCCE---eC-CCCCHHHHHHHHHCCCCc
Confidence            355555    999999998775   99999999999999999 9999999998763   22 222455788899988889


Q ss_pred             eEEEEe
Q 026827          161 LLMKMQ  166 (232)
Q Consensus       161 v~LkLe  166 (232)
                      |.|+++
T Consensus        76 v~L~V~   81 (81)
T PF00595_consen   76 VTLTVQ   81 (81)
T ss_dssp             EEEEEE
T ss_pred             EEEEEC
Confidence            999875

PDZ domains can occur in one or multiple copies and are nearly always found in cytoplasmic proteins. They bind either the carboxyl-terminal sequences of proteins or internal peptide sequences []. In most cases, interaction between a PDZ domain and its target is constitutive, with a binding affinity of 1 to 10 microns. However, agonist-dependent activation of cell surface receptors is sometimes required to promote interaction with a PDZ protein. PDZ domain proteins are frequently associated with the plasma membrane, a compartment where high concentrations of phosphatidylinositol 4,5-bisphosphate (PIP2) are found. Direct interaction between PIP2 and a subset of class II PDZ domains (syntenin, CASK, Tiam-1) has been demonstrated. PDZ domains consist of 80 to 90 amino acids comprising six beta-strands (beta-A to beta-F) and two alpha-helices, A and B, compactly arranged in a globular structure. Peptide binding of the ligand takes place in an elongated surface groove as an anti-parallel beta-strand interacts with the beta-B strand and the B helix. The structure of PDZ domains allows binding to a free carboxylate group at the end of a peptide through a carboxylate-binding loop between the beta-A and beta-B strands.; GO: 0005515 protein binding; PDB: 3AXA_A 1WF8_A 1QAV_B 1QAU_A 1B8Q_A 1MC7_A 2KAW_A 1I16_A 1VB7_A 1WI4_A ....

>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements	Back alignment and domain information

>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif)	Back alignment and domain information

>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C	Back alignment and domain information

>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2	Back alignment and domain information

>KOG3571 consensus Dishevelled 3 and related proteins [General function prediction only]	Back alignment and domain information

>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases	Back alignment and domain information

>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts	Back alignment and domain information

>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis	Back alignment and domain information

>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms	Back alignment and domain information

>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms	Back alignment and domain information

>KOG0609 consensus Calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases	Back alignment and domain information

>TIGR00225 prc C-terminal peptidase (prc)	Back alignment and domain information

>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family	Back alignment and domain information

>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK11186 carboxy-terminal protease; Provisional	Back alignment and domain information

>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family	Back alignment and domain information

>PLN00049 carboxyl-terminal processing protease; Provisional	Back alignment and domain information

>PRK10139 serine endoprotease; Provisional	Back alignment and domain information

>TIGR02038 protease_degS periplasmic serine pepetdase DegS	Back alignment and domain information

>PRK10139 serine endoprotease; Provisional	Back alignment and domain information

>PRK10942 serine endoprotease; Provisional	Back alignment and domain information

>PRK10898 serine endoprotease; Provisional	Back alignment and domain information

>PRK10942 serine endoprotease; Provisional	Back alignment and domain information

>KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton]	Back alignment and domain information

>KOG3553 consensus Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>PRK10779 zinc metallopeptidase RseP; Provisional	Back alignment and domain information

>KOG3209 consensus WW domain-containing protein [General function prediction only]	Back alignment and domain information

>KOG3550 consensus Receptor targeting protein Lin-7 [Extracellular structures]	Back alignment and domain information

>TIGR01713 typeII_sec_gspC general secretion pathway protein C	Back alignment and domain information

>TIGR00054 RIP metalloprotease RseP	Back alignment and domain information

>KOG3580 consensus Tight junction proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG3532 consensus Predicted protein kinase [General function prediction only]	Back alignment and domain information

>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only]	Back alignment and domain information

>KOG3938 consensus RGS-GAIP interacting protein GIPC, contains PDZ domain [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR00054 RIP metalloprotease RseP	Back alignment and domain information

>PRK10779 zinc metallopeptidase RseP; Provisional	Back alignment and domain information

>KOG3606 consensus Cell polarity protein PAR6 [Signal transduction mechanisms]	Back alignment and domain information

>KOG3580 consensus Tight junction proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only]	Back alignment and domain information

>KOG3209 consensus WW domain-containing protein [General function prediction only]	Back alignment and domain information

>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms]	Back alignment and domain information

>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3129 consensus 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase	Back alignment and domain information

>TIGR02860 spore_IV_B stage IV sporulation protein B	Back alignment and domain information

>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A	Back alignment and domain information

>KOG3651 consensus Protein kinase C, alpha binding protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG3552 consensus FERM domain protein FRM-8 [General function prediction only]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		232
2r4h_A		112	Membrane-associated guanylate kinase, WW and PDZ c	1e-08
2dlu_A		111	INAD-like protein; PDZ domain, inadl protein, hina	2e-08
2qkv_A		96	Inactivation-NO-after-potential D protein; PDZ dom	2e-08
1wfv_A		103	Membrane associated guanylate kinase inverted-2; a	6e-08
2djt_A		104	Unnamed protein product; PDZ domain, structural ge	9e-08
3gge_A		95	PDZ domain-containing protein GIPC2; structural ge	1e-07
2la8_A		106	Inactivation-NO-after-potential D protein, KON-TI	1e-07
1tp5_A		119	Presynaptic density protein 95; PDZ-peptide ligand	1e-07
2dmz_A		129	INAD-like protein; PDZ domain, inadl protein, hina	1e-07
2ejy_A		97	55 kDa erythrocyte membrane protein; GPC, maguk, P	2e-07
2eno_A		120	Synaptojanin-2-binding protein; mitochondrial oute	2e-07
1va8_A		113	Maguk P55 subfamily member 5; PDZ domain, palmitoy	4e-07
3axa_A		106	Afadin, nectin-3, protein AF-6; PDZ domain, fusion	4e-07
1nf3_C		128	PAR-6B; semi-CRIB motif, switch I and II, PDZ doma	4e-07
2qg1_A		92	Multiple PDZ domain protein; MPDZ, MUPP1, structur	4e-07
2opg_A		98	Multiple PDZ domain protein; structural protein, s	6e-07
2lob_A		112	Golgi-associated PDZ and coiled-coil motif-contai	6e-07
1uep_A		103	Membrane associated guanylate kinase inverted-2 (M	6e-07
1x5q_A		110	LAP4 protein; PDZ domain, scribble homolog protein	7e-07
2dkr_A		93	LIN-7 homolog B; LIN-7B, PDZ, structural genomics,	7e-07
1i16_A		130	Interleukin 16, LCF; cytokine, lymphocyte chemoatt	7e-07
2dm8_A		116	INAD-like protein; PDZ domain, inadl protein, hina	1e-06
2iwn_A		97	Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP	1e-06
1n7e_A		97	AMPA receptor interacting protein GRIP; PDZ, prote	1e-06
2jre_A		108	C60-1 PDZ domain peptide; de novo protein; NMR {Sy	1e-06
3egg_C		170	Spinophilin; PP1, serine/threonine phosphatase, po	1e-06
3i4w_A		104	Disks large homolog 4; alpha and beta protein, alt	2e-06
2i1n_A		102	Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig	2e-06
2jik_A		101	Synaptojanin-2 binding protein; transmembrane, out	2e-06
1b8q_A		127	Protein (neuronal nitric oxide synthase); PDZ doma	2e-06
2xkx_A		721	Disks large homolog 4; structural protein, scaffol	2e-06
2xkx_A		721	Disks large homolog 4; structural protein, scaffol	2e-05
1um7_A		113	Synapse-associated protein 102; PDZ, discs large h	2e-06
1uit_A		117	Human discs large 5 protein; PDZ domain, HDLG5, ma	2e-06
2dc2_A		103	GOPC, golgi associated PDZ and coiled-coil motif c	3e-06
1p1d_A		196	PDZ45, glutamate receptor interacting protein; PDZ	3e-06
1p1d_A		196	PDZ45, glutamate receptor interacting protein; PDZ	4e-05
2w4f_A		97	Protein LAP4; structural protein, phosphoprotein,	3e-06
2db5_A		128	INAD-like protein; PDZ domain, hinadl, PALS1- asso	5e-06
2iwq_A		123	Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP	5e-06
2koj_A		111	Partitioning defective 3 homolog; PDZ domain, stru	5e-06
2kom_A		121	Partitioning defective 3 homolog; PAR-3B, PDZ doma	5e-06
1uew_A		114	Membrane associated guanylate kinase inverted-2 (M	5e-06
2q9v_A		90	Membrane-associated guanylate kinase, WW and PDZ c	6e-06
1v6b_A		118	Harmonin isoform A1; structural genomics, usher sy	6e-06
2jil_A		97	GRIP1 protein, glutamate receptor interacting prot	6e-06
2daz_A		124	INAD-like protein; PDZ domain, inadl protein, hina	7e-06
2vwr_A		95	Ligand of NUMB protein X 2; protein-binding, metal	7e-06
3r0h_A		206	INAD, inactivation-NO-after-potential D protein; p	7e-06
3r0h_A		206	INAD, inactivation-NO-after-potential D protein; p	2e-05
3o46_A		93	Maguk P55 subfamily member 7; PDZ domain, structur	7e-06
2kpk_A		129	Membrane-associated guanylate kinase, WW and PDZ c	8e-06
3b76_A		118	E3 ubiquitin-protein ligase LNX; PDZ, bound ligand	8e-06
1d5g_A		96	Human phosphatase HPTP1E; protein-peptide complex,	8e-06
1x6d_A		119	Interleukin-16; PDZ domain, lymphocyte chemoattrac	9e-06
2iwo_A		120	Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP	1e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-05
2byg_A		117	Channel associated protein of synapse-110; DLG2, P	1e-05
1kwa_A		88	Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca	1e-05
1v62_A		117	KIAA1719 protein; structural genomics, synaptic tr	1e-05
1wg6_A		127	Hypothetical protein (riken cDNA 2810455B10); stru	1e-05
1z87_A		263	Alpha-1-syntrophin; protein binding; NMR {Mus musc	1e-05
2fne_A		117	Multiple PDZ domain protein; structural protein, s	2e-05
3tsv_A		124	Tight junction protein ZO-1; PDZ, scaffolding, JAM	2e-05
1qav_A		90	Alpha-1 syntrophin (residues 77-171); beta-finger,	2e-05
2o2t_A		117	Multiple PDZ domain protein; structural protein, s	2e-05
2edp_A		100	Fragment, shroom family member 4; APX/shroom famil	2e-05
2d92_A		108	INAD-like protein; PDZ domain, inadl protein, hina	2e-05
1wif_A		126	RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s	2e-05
1uez_A		101	KIAA1526 protein; PDZ domain, structural genomics,	2e-05
1v5q_A		122	GRIP1 homolog, glutamate receptor interacting prot	2e-05
1m5z_A		91	GRIP, AMPA receptor interacting protein; six beta-	2e-05
2fcf_A		103	Multiple PDZ domain protein; adaptor molecule, pro	2e-05
2qt5_A		200	Glutamate receptor-interacting protein 1; PDZ-pept	3e-05
2qt5_A		200	Glutamate receptor-interacting protein 1; PDZ-pept	7e-05
2yt7_A		101	Amyloid beta A4 precursor protein-binding family A	3e-05
2i04_A		85	Membrane-associated guanylate kinase, WW and PDZ d	3e-05
1q7x_A		108	PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str	3e-05
1ueq_A		123	Membrane associated guanylate kinase inverted-2 (M	3e-05
1wha_A		105	KIAA0147 protein, scribble; PDZ domain, cellular s	3e-05
2fe5_A		94	Presynaptic protein SAP102; PDZ domain, DLG3, huma	4e-05
1ihj_A		98	INAD; intermolecular disulfide bond, PDZ domain, s	4e-05
2awx_A		105	Synapse associated protein 97; membrane protein, s	4e-05
1um1_A		110	KIAA1849 protein, RSGI RUH-007; PDZ domain, human	4e-05
1uhp_A		107	Hypothetical protein KIAA1095; PDZ domain, semapho	5e-05
2csj_A		117	TJP2 protein; PDZ domain, structural genomics, NPP	5e-05
1ujd_A		117	KIAA0559 protein; PDZ domain, structural genomics,	6e-05
1qau_A		112	Neuronal nitric oxide synthase (residues 1-130); b	6e-05
3gsl_A		196	Disks large homolog 4; PDZ domain, tandem, PSD-95,	7e-05
3gsl_A		196	Disks large homolog 4; PDZ domain, tandem, PSD-95,	4e-04
2eeh_A		100	PDZ domain-containing protein 7; structural genomi	8e-05
1wi4_A		109	Synip, syntaxin binding protein 4; syntaxin4-inter	8e-05
1wi2_A		104	Riken cDNA 2700099C19; structural genomics, riken	8e-05
1wf8_A		107	Neurabin-I; PDZ domain, structural genomics, NPPSF	9e-05
1uju_A		111	Scribble; PDZ domain, cellular signaling, structur	9e-05
1uf1_A		128	KIAA1526 protein; PDZ domain, structural genomics,	1e-04
2eaq_A		90	LIM domain only protein 7; conserved hypothetical	1e-04
1ufx_A		103	KIAA1526 protein; PDZ domain, structural genomics,	1e-04
1x5n_A		114	Harmonin; PDZ domain, usher syndrome 1C protein, a	1e-04
2e7k_A		91	Maguk P55 subfamily member 2; PDZ domain, MPP2 pro	1e-04
2h2b_A		107	Tight junction protein ZO-1; PDZ domain, phage der	1e-04
3cbz_A		108	Dishevelled-2; PDZ domain, phage derived high affi	1e-04
2rcz_A		81	Tight junction protein ZO-1; PDZ, domain-swapping,	1e-04
2ehr_A		117	INAD-like protein; PDZ domain, inadl protein, hina	1e-04
1whd_A		100	RGS3, regulator of G-protein signaling 3; PDZ doma	2e-04
1wfg_A		131	Regulating synaptic membrane exocytosis protein 2;	2e-04
1wh1_A		124	KIAA1095 protein; PDZ domain, structural genomics,	2e-04
2g5m_B		113	Neurabin-2; spinophilin, PDZ domain, CNS, synaptic	2e-04
3e17_A		88	Tight junction protein ZO-2; domain swapping, alte	2e-04
2edv_A		96	FERM and PDZ domain-containing protein 1; cytoskel	2e-04
2uzc_A		88	Human pdlim5, PDZ and LIM domain 5; metal-binding,	3e-04
2q3g_A		89	PDZ and LIM domain protein 7; structural genomics,	3e-04
3k1r_A		192	Harmonin; protein-protein complex, alternative spl	3e-04
1n7t_A		103	99-MER peptide of densin-180-like protein; PDZ dom	4e-04
3cyy_A		92	Tight junction protein ZO-1; protein-ligand comple	4e-04
1w9e_A		166	Syntenin 1; cell adhesion, adhesion/complex, PDZ d	5e-04
2kv8_A		83	RGS12, regulator of G-protein signaling 12; PDZ do	5e-04
2gzv_A		114	PRKCA-binding protein; protein kinase C, PDZ domai	5e-04
2edz_A		114	PDZ domain-containing protein 1; CFTR-associated p	5e-04
2f5y_A		91	Regulator of G-protein signalling 3 isoform 1; PDZ	6e-04
3nfk_A		107	Tyrosine-protein phosphatase non-receptor type 4;	7e-04
2eeg_A		94	PDZ and LIM domain protein 4; PDZ domain, structur	8e-04

>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112	Back alignment and structure

 Score = 50.4 bits (121), Expect = 1e-08
 Identities = 19/75 (25%), Positives = 34/75 (45%), Gaps = 6/75 (8%)

Query: 64  ETEAQASPEAESGSEEQE-EKYEEYEVEIE-QPYGLKF--AKGRDGGT--YIDAIAPGGS 117
                 S   + G+E    +  + Y VE+E    G  F    GR+     Y+  +A  G 
Sbjct: 2   HHHHHHSSGVDLGTENLYFQSMDFYTVELERGAKGFGFSLRGGREYNMDLYVLRLAEDGP 61

Query: 118 ADKTGMFQVGDKVLA 132
           A+++G  ++GD++L 
Sbjct: 62  AERSGKMRIGDEILE 76

PyMOL of 2r4h

>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111	Back alignment and structure

>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96	Back alignment and structure

>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103	Back alignment and structure

>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104	Back alignment and structure

>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95	Back alignment and structure

>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106	Back alignment and structure

>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119	Back alignment and structure

>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129	Back alignment and structure

>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97	Back alignment and structure

>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120	Back alignment and structure

>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113	Back alignment and structure

>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106	Back alignment and structure

>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128	Back alignment and structure

>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92	Back alignment and structure

>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98	Back alignment and structure

>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112	Back alignment and structure

>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103	Back alignment and structure

>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110	Back alignment and structure

>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93	Back alignment and structure

>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130	Back alignment and structure

>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116	Back alignment and structure

>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97	Back alignment and structure

>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97	Back alignment and structure

>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108	Back alignment and structure

>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170	Back alignment and structure

>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104	Back alignment and structure

>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102	Back alignment and structure

>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101	Back alignment and structure

>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127	Back alignment and structure

>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721	Back alignment and structure

>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721	Back alignment and structure

>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113	Back alignment and structure

>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117	Back alignment and structure

>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103	Back alignment and structure

>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196	Back alignment and structure

>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196	Back alignment and structure

>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97	Back alignment and structure

>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128	Back alignment and structure

>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123	Back alignment and structure

>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111	Back alignment and structure

>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121	Back alignment and structure

>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114	Back alignment and structure

>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90	Back alignment and structure

>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118	Back alignment and structure

>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97	Back alignment and structure

>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124	Back alignment and structure

>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95	Back alignment and structure

>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206	Back alignment and structure

>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206	Back alignment and structure

>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93	Back alignment and structure

>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129	Back alignment and structure

>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118	Back alignment and structure

>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96	Back alignment and structure

>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119	Back alignment and structure

>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117	Back alignment and structure

>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88	Back alignment and structure

>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117	Back alignment and structure

>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127	Back alignment and structure

>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263	Back alignment and structure

>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117	Back alignment and structure

>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124	Back alignment and structure

>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90	Back alignment and structure

>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117	Back alignment and structure

>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100	Back alignment and structure

>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108	Back alignment and structure

>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126	Back alignment and structure

>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101	Back alignment and structure

>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122	Back alignment and structure

>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91	Back alignment and structure

>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103	Back alignment and structure

>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200	Back alignment and structure

>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200	Back alignment and structure

>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101	Back alignment and structure

>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85	Back alignment and structure

>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108	Back alignment and structure

>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123	Back alignment and structure

>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105	Back alignment and structure

>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94	Back alignment and structure

>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98	Back alignment and structure

>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105	Back alignment and structure

>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110	Back alignment and structure

>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107	Back alignment and structure

>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117	Back alignment and structure

>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117	Back alignment and structure

>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112	Back alignment and structure

>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196	Back alignment and structure

>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196	Back alignment and structure

>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100	Back alignment and structure

>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109	Back alignment and structure

>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104	Back alignment and structure

>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107	Back alignment and structure

>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111	Back alignment and structure

>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128	Back alignment and structure

>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90	Back alignment and structure

>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103	Back alignment and structure

>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114	Back alignment and structure

>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91	Back alignment and structure

>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107	Back alignment and structure

>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108	Back alignment and structure

>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81	Back alignment and structure

>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117	Back alignment and structure

>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100	Back alignment and structure

>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131	Back alignment and structure

>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124	Back alignment and structure

>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113	Back alignment and structure

>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88	Back alignment and structure

>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96	Back alignment and structure

>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88	Back alignment and structure

>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89	Back alignment and structure

>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192	Back alignment and structure

>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103	Back alignment and structure

>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92	Back alignment and structure

>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166	Back alignment and structure

>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83	Back alignment and structure

>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114	Back alignment and structure

>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114	Back alignment and structure

>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91	Back alignment and structure

>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107	Back alignment and structure

>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		232
2qg1_A		92	Multiple PDZ domain protein; MPDZ, MUPP1, structur	98.78
2vwr_A		95	Ligand of NUMB protein X 2; protein-binding, metal	98.76
2jil_A		97	GRIP1 protein, glutamate receptor interacting prot	98.7
1wha_A		105	KIAA0147 protein, scribble; PDZ domain, cellular s	98.67
1n7e_A		97	AMPA receptor interacting protein GRIP; PDZ, prote	98.67
2qkv_A		96	Inactivation-NO-after-potential D protein; PDZ dom	98.65
2iwn_A		97	Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP	98.64
2ejy_A		97	55 kDa erythrocyte membrane protein; GPC, maguk, P	98.62
2la8_A		106	Inactivation-NO-after-potential D protein, KON-TI	98.61
3i4w_A		104	Disks large homolog 4; alpha and beta protein, alt	98.61
2opg_A		98	Multiple PDZ domain protein; structural protein, s	98.6
2yt7_A		101	Amyloid beta A4 precursor protein-binding family A	98.6
3cbz_A		108	Dishevelled-2; PDZ domain, phage derived high affi	98.6
1wf8_A		107	Neurabin-I; PDZ domain, structural genomics, NPPSF	98.58
1i16_A		130	Interleukin 16, LCF; cytokine, lymphocyte chemoatt	98.58
1m5z_A		91	GRIP, AMPA receptor interacting protein; six beta-	98.58
3b76_A		118	E3 ubiquitin-protein ligase LNX; PDZ, bound ligand	98.57
2dmz_A		129	INAD-like protein; PDZ domain, inadl protein, hina	98.57
2i1n_A		102	Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig	98.57
1wi2_A		104	Riken cDNA 2700099C19; structural genomics, riken	98.57
1kwa_A		88	Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca	98.57
1q7x_A		108	PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str	98.56
1va8_A		113	Maguk P55 subfamily member 5; PDZ domain, palmitoy	98.55
1uhp_A		107	Hypothetical protein KIAA1095; PDZ domain, semapho	98.55
2fcf_A		103	Multiple PDZ domain protein; adaptor molecule, pro	98.54
1d5g_A		96	Human phosphatase HPTP1E; protein-peptide complex,	98.53
2jre_A		108	C60-1 PDZ domain peptide; de novo protein; NMR {Sy	98.52
2d92_A		108	INAD-like protein; PDZ domain, inadl protein, hina	98.51
1ueq_A		123	Membrane associated guanylate kinase inverted-2 (M	98.51
3gge_A		95	PDZ domain-containing protein GIPC2; structural ge	98.51
1v62_A		117	KIAA1719 protein; structural genomics, synaptic tr	98.51
2awx_A		105	Synapse associated protein 97; membrane protein, s	98.49
2he4_A		90	Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p	98.49
2pa1_A		87	PDZ and LIM domain protein 2; PDZ domain, structur	98.49
2r4h_A		112	Membrane-associated guanylate kinase, WW and PDZ c	98.48
1qav_A		90	Alpha-1 syntrophin (residues 77-171); beta-finger,	98.48
2dlu_A		111	INAD-like protein; PDZ domain, inadl protein, hina	98.48
2db5_A		128	INAD-like protein; PDZ domain, hinadl, PALS1- asso	98.47
2ehr_A		117	INAD-like protein; PDZ domain, inadl protein, hina	98.47
1wg6_A		127	Hypothetical protein (riken cDNA 2810455B10); stru	98.47
2w4f_A		97	Protein LAP4; structural protein, phosphoprotein,	98.46
2o2t_A		117	Multiple PDZ domain protein; structural protein, s	98.46
2jik_A		101	Synaptojanin-2 binding protein; transmembrane, out	98.45
1qau_A		112	Neuronal nitric oxide synthase (residues 1-130); b	98.45
2fe5_A		94	Presynaptic protein SAP102; PDZ domain, DLG3, huma	98.44
2d90_A		102	PDZ domain containing protein 1; structural genomi	98.44
2byg_A		117	Channel associated protein of synapse-110; DLG2, P	98.42
2e7k_A		91	Maguk P55 subfamily member 2; PDZ domain, MPP2 pro	98.42
1tp5_A		119	Presynaptic density protein 95; PDZ-peptide ligand	98.42
2dm8_A		116	INAD-like protein; PDZ domain, inadl protein, hina	98.42
2q9v_A		90	Membrane-associated guanylate kinase, WW and PDZ c	98.42
2koj_A		111	Partitioning defective 3 homolog; PDZ domain, stru	98.42
1um1_A		110	KIAA1849 protein, RSGI RUH-007; PDZ domain, human	98.41
1rgw_A		85	ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK,	98.41
1x5q_A		110	LAP4 protein; PDZ domain, scribble homolog protein	98.41
2daz_A		124	INAD-like protein; PDZ domain, inadl protein, hina	98.4
2eno_A		120	Synaptojanin-2-binding protein; mitochondrial oute	98.4
1uep_A		103	Membrane associated guanylate kinase inverted-2 (M	98.4
2djt_A		104	Unnamed protein product; PDZ domain, structural ge	98.39
2g5m_B		113	Neurabin-2; spinophilin, PDZ domain, CNS, synaptic	98.39
2eeh_A		100	PDZ domain-containing protein 7; structural genomi	98.39
1mfg_A		95	ERB-B2 interacting protein; PDZ domain, protein-pe	98.39
2uzc_A		88	Human pdlim5, PDZ and LIM domain 5; metal-binding,	98.39
2fne_A		117	Multiple PDZ domain protein; structural protein, s	98.38
1ihj_A		98	INAD; intermolecular disulfide bond, PDZ domain, s	98.38
1whd_A		100	RGS3, regulator of G-protein signaling 3; PDZ doma	98.37
2i04_A		85	Membrane-associated guanylate kinase, WW and PDZ d	98.36
2pkt_A		91	PDZ and LIM domain protein 1; PDZ domain, structur	98.35
2vz5_A		139	TAX1-binding protein 3; WNT signaling pathway, pro	98.35
3axa_A		106	Afadin, nectin-3, protein AF-6; PDZ domain, fusion	98.35
3egg_C		170	Spinophilin; PP1, serine/threonine phosphatase, po	98.34
1wh1_A		124	KIAA1095 protein; PDZ domain, structural genomics,	98.34
1n7t_A		103	99-MER peptide of densin-180-like protein; PDZ dom	98.33
1um7_A		113	Synapse-associated protein 102; PDZ, discs large h	98.32
1nf3_C		128	PAR-6B; semi-CRIB motif, switch I and II, PDZ doma	98.31
2dls_A		93	PDZ-rhogef, RHO guanine nucleotide exchange factor	98.31
2kom_A		121	Partitioning defective 3 homolog; PAR-3B, PDZ doma	98.31
1wf7_A		103	Enigma homologue protein; PDZ domain, structural g	98.3
2iwq_A		123	Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP	98.3
1g9o_A		91	NHE-RF; PDZ domain, complex, signaling protein; 1.	98.29
3l4f_D		132	SH3 and multiple ankyrin repeat domains protein 1;	98.29
3hpk_A		125	Protein interacting with PRKCA 1; oxidized, PDZ do	98.29
1uit_A		117	Human discs large 5 protein; PDZ domain, HDLG5, ma	98.29
1v5q_A		122	GRIP1 homolog, glutamate receptor interacting prot	98.28
2kv8_A		83	RGS12, regulator of G-protein signaling 12; PDZ do	98.28
2h2b_A		107	Tight junction protein ZO-1; PDZ domain, phage der	98.28
2dkr_A		93	LIN-7 homolog B; LIN-7B, PDZ, structural genomics,	98.26
3o46_A		93	Maguk P55 subfamily member 7; PDZ domain, structur	98.26
3tsv_A		124	Tight junction protein ZO-1; PDZ, scaffolding, JAM	98.26
2rcz_A		81	Tight junction protein ZO-1; PDZ, domain-swapping,	98.26
3e17_A		88	Tight junction protein ZO-2; domain swapping, alte	98.26
1wfg_A		131	Regulating synaptic membrane exocytosis protein 2;	98.25
2iwo_A		120	Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP	98.24
2q3g_A		89	PDZ and LIM domain protein 7; structural genomics,	98.24
2kpk_A		129	Membrane-associated guanylate kinase, WW and PDZ c	98.24
3cyy_A		92	Tight junction protein ZO-1; protein-ligand comple	98.24
2edp_A		100	Fragment, shroom family member 4; APX/shroom famil	98.23
1uew_A		114	Membrane associated guanylate kinase inverted-2 (M	98.23
3sfj_A		104	TAX1-binding protein 3; PDZ:peptide complex, signa	98.23
1wfv_A		103	Membrane associated guanylate kinase inverted-2; a	98.23
2csj_A		117	TJP2 protein; PDZ domain, structural genomics, NPP	98.22
3r68_A		95	Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P	98.22
1x6d_A		119	Interleukin-16; PDZ domain, lymphocyte chemoattrac	98.21
1q3o_A		109	Shank1; PDZ, GKAP, peptide binding protein; 1.80A	98.2
1uju_A		111	Scribble; PDZ domain, cellular signaling, structur	98.19
2ego_A		96	General receptor for phosphoinositides 1- associat	98.19
4amh_A		106	Disks large homolog 1; permutation, protein foldin	98.18
2dc2_A		103	GOPC, golgi associated PDZ and coiled-coil motif c	98.18
1ujd_A		117	KIAA0559 protein; PDZ domain, structural genomics,	98.18
2cs5_A		119	Tyrosine-protein phosphatase, non-receptor type 4;	98.17
3r0h_A		206	INAD, inactivation-NO-after-potential D protein; p	98.17
3r0h_A		206	INAD, inactivation-NO-after-potential D protein; p	98.17
4e34_A		87	Golgi-associated PDZ and coiled-coil motif-contai	98.16
3gsl_A		196	Disks large homolog 4; PDZ domain, tandem, PSD-95,	98.15
3nfk_A		107	Tyrosine-protein phosphatase non-receptor type 4;	98.15
3bpu_A		88	Membrane-associated guanylate kinase, WW and PDZ c	98.13
2v90_A		96	PDZ domain-containing protein 3; membrane, protein	98.12
2eaq_A		90	LIM domain only protein 7; conserved hypothetical	98.12
2jxo_A		98	Ezrin-radixin-moesin-binding phosphoprotein 50; nh	98.12
3ngh_A		106	PDZ domain-containing protein 1; adaptor protein,	98.11
2gzv_A		114	PRKCA-binding protein; protein kinase C, PDZ domai	98.1
2vsp_A		91	PDZ domain-containing protein 1; membrane, cytopla	98.1
1vb7_A		94	PDZ and LIM domain 2; PDZ domain PDZ-LIM protein,	98.1
2edz_A		114	PDZ domain-containing protein 1; CFTR-associated p	98.09
1ujv_A		96	Membrane associated guanylate kinase inverted-2 (M	98.08
2d8i_A		114	T-cell lymphoma invasion and metastasis 1 variant;	98.08
1uf1_A		128	KIAA1526 protein; PDZ domain, structural genomics,	98.08
1uez_A		101	KIAA1526 protein; PDZ domain, structural genomics,	98.06
1b8q_A		127	Protein (neuronal nitric oxide synthase); PDZ doma	98.06
2eeg_A		94	PDZ and LIM domain protein 4; PDZ domain, structur	98.06
2eei_A		106	PDZ domain-containing protein 1; regulatory factor	98.05
3k1r_A		192	Harmonin; protein-protein complex, alternative spl	98.05
2f5y_A		91	Regulator of G-protein signalling 3 isoform 1; PDZ	98.04
3qe1_A		107	Sorting nexin-27, G protein-activated inward RECT	98.04
1x5n_A		114	Harmonin; PDZ domain, usher syndrome 1C protein, a	98.04
1wi4_A		109	Synip, syntaxin binding protein 4; syntaxin4-inter	98.02
2z17_A		104	Pleckstrin homology SEC7 and coiled-coil domains-	98.02
3gsl_A		196	Disks large homolog 4; PDZ domain, tandem, PSD-95,	97.99
1v5l_A		103	PDZ and LIM domain 3; actinin alpha 2 associated L	97.99
3kzd_A		94	TIAM-1, T-lymphoma invasion and metastasis-inducin	97.96
2pzd_A		113	Serine protease HTRA2; PDZ domain, apoptosis, mito	97.93
1v6b_A		118	Harmonin isoform A1; structural genomics, usher sy	97.93
1z87_A		263	Alpha-1-syntrophin; protein binding; NMR {Mus musc	97.9
1p1d_A		196	PDZ45, glutamate receptor interacting protein; PDZ	97.89
2qt5_A		200	Glutamate receptor-interacting protein 1; PDZ-pept	97.86
1ufx_A		103	KIAA1526 protein; PDZ domain, structural genomics,	97.85
3tsz_A		391	Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol	97.85
2yub_A		118	LIMK-2, LIM domain kinase 2; PDZ domain, structura	97.84
2qbw_A		195	PDZ-fibronectin fusion protein; fibronectin PDZ, u	97.83
3shw_A		468	Tight junction protein ZO-1; PDZ-SH3-GUK supramodu	97.83
2vsv_A		109	Rhophilin-2; scaffold protein, RHO GTPase binding,	97.82
2qt5_A		200	Glutamate receptor-interacting protein 1; PDZ-pept	97.81
2kjd_A		128	Sodium/hydrogen exchange regulatory cofactor NHE-	97.8
3khf_A		99	Microtubule-associated serine/threonine-protein ki	97.77
1p1d_A		196	PDZ45, glutamate receptor interacting protein; PDZ	97.73
1w9e_A		166	Syntenin 1; cell adhesion, adhesion/complex, PDZ d	97.7
2xkx_A		721	Disks large homolog 4; structural protein, scaffol	97.69
2edv_A		96	FERM and PDZ domain-containing protein 1; cytoskel	97.66
1wif_A		126	RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s	97.61
1r6j_A		82	Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap	97.57
2lob_A		112	Golgi-associated PDZ and coiled-coil motif-contai	96.68
1y7n_A		90	Amyloid beta A4 precursor protein-binding family A	97.49
3qik_A		101	Phosphatidylinositol 3,4,5-trisphosphate-dependen	97.47
2xkx_A		721	Disks large homolog 4; structural protein, scaffol	97.45
1vae_A		111	Rhophilin 2, rhophilin, RHO GTPase binding protein	97.41
2p3w_A		112	Probable serine protease HTRA3; PDZ domain, phage	97.32
2l97_A		134	HTRA, putative serine protease; HTRA-PDZ, protein	97.3
3rle_A		209	Golgi reassembly-stacking protein 2; PDZ, tether,	97.3
3suz_A		388	Amyloid beta A4 precursor protein-binding family 2	97.3
3i18_A		100	LMO2051 protein; alpha-beta protein, structural ge	97.23
2krg_A		216	Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a	97.19
1te0_A		318	Protease DEGS; two domains, serine protease, PDZ,	97.19
2kl1_A		94	YLBL protein; structure genomics, structural genom	97.15
1y8t_A		324	Hypothetical protein RV0983; serine protease, stru	97.14
4fgm_A		597	Aminopeptidase N family protein; structural genomi	97.09
2kjp_A		91	Uncharacterized protein YLBL; mixed alpha-beta pro	97.06
3id1_A		95	Regulator of sigma E protease; hydrolase, cell inn	97.03
2yuy_A		126	RHO GTPase activating protein 21; PDZ domain, stru	96.98
2i6v_A		87	General secretion pathway protein C; EPSC, GSPC, P	96.98
2zpm_A		91	Regulator of sigma E protease; metalloproteinase,	96.8
1lcy_A		325	HTRA2 serine protease; apoptosis, PDZ domain, casp	96.8
1fc6_A		388	Photosystem II D1 protease; D1 C-terminal processi	96.73
2i4s_A		105	General secretion pathway protein C; EPSC, GSPC, P	96.69
4a8c_A		436	Periplasmic PH-dependent serine endoprotease DEGQ;	96.55
3stj_A		345	Protease DEGQ; serine protease, PDZ domain, protea	96.48
3qo6_A		348	Protease DO-like 1, chloroplastic; protease, HTRA,	96.46
3soe_A		113	Membrane-associated guanylate kinase, WW and PDZ c	96.43
2hga_A		125	Conserved protein MTH1368; GFT structural genomics	96.37
3rle_A		209	Golgi reassembly-stacking protein 2; PDZ, tether,	96.2
3pv2_A		451	DEGQ; trypsin fold, PDZ domain, chaperone protease	96.19
1w9e_A		166	Syntenin 1; cell adhesion, adhesion/complex, PDZ d	96.18
4a8c_A		436	Periplasmic PH-dependent serine endoprotease DEGQ;	96.16
3pv2_A		451	DEGQ; trypsin fold, PDZ domain, chaperone protease	96.11
3k50_A		403	Putative S41 protease; structural genomics, joint	95.6
1ky9_A		448	Protease DO, DEGP, HTRA; protein quality control,	95.38
1k32_A		1045	Tricorn protease; protein degradation, substrate g	95.02
3num_A		332	Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom	95.01
1ky9_A		448	Protease DO, DEGP, HTRA; protein quality control,	93.69
4fln_A		539	Protease DO-like 2, chloroplastic; protease, DEG,	93.46
3suz_A		388	Amyloid beta A4 precursor protein-binding family 2	93.43

>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens}	Back alignment and structure

Probab=98.78  E-value=2.4e-08  Score=71.37  Aligned_cols=81  Identities=20%  Similarity=0.413  Sum_probs=61.6

Q ss_pred             ccEEEEEecC----cceeEEeeeC-CCCeEEEEeCCCCCcccccccccCcEEEEeecccCCceeeccchhhHHHHhhccc
Q 026827           84 YEEYEVEIEQ----PYGLKFAKGR-DGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRV  158 (232)
Q Consensus        84 ~eeyeVeL~K----PLGL~Fee~~-dGgvyV~eV~pGGNAaKaG~I~VGD~LvatSA~FGdElWpA~~~G~t~~AIr~Rs  158 (232)
                      ++.++|+|.|    ++|+.+.... +.+++|..|.+++.|+++|.|++||+|+++...   .+=. ..+.++...++...
T Consensus         3 ~~~~~v~l~k~~~~~lG~~~~~~~~~~gv~V~~V~~~spA~~aG~L~~GD~I~~vng~---~v~~-~~~~~~~~~~~~~~   78 (92)
T 2qg1_A            3 SDTLTIGLQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGE---DVRN-ATQEAVAALLKCSL   78 (92)
T ss_dssp             -CEEEEEEECCTTSCCSEEEECCSSSCSCEEEEECTTSHHHHHTCCCTTCEEEEETTE---ECTT-CCHHHHHHHHHHCC
T ss_pred             ceEEEEEEEeCCCCcccEEEEeccCCCCEEEEEECCCCHHHHcCCCCCCCEEEEECCE---ECCC-CCHHHHHHHHHcCC
Confidence            4678999987    4889988754 359999999999999999999999999998753   2211 12345666777656


Q ss_pred             CceEEEEeec
Q 026827          159 GPLLMKMQKR  168 (232)
Q Consensus       159 Gpv~LkLeR~  168 (232)
                      +++.|.+.|+
T Consensus        79 ~~v~l~v~R~   88 (92)
T 2qg1_A           79 GTVTLEVGRI   88 (92)
T ss_dssp             SEEEEEEECC
T ss_pred             CeEEEEEEcc
Confidence            7899999885

PyMOL of 2qg1

>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens}	Back alignment and structure

>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens}	Back alignment and structure

>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A	Back alignment and structure

>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A	Back alignment and structure

>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens}	Back alignment and structure

>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A	Back alignment and structure

>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster}	Back alignment and structure

>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A	Back alignment and structure

>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens}	Back alignment and structure

>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens}	Back alignment and structure

>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A	Back alignment and structure

>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2	Back alignment and structure

>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1	Back alignment and structure

>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens}	Back alignment and structure

>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens}	Back alignment and structure

>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A	Back alignment and structure

>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A	Back alignment and structure

>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic}	Back alignment and structure

>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens}	Back alignment and structure

>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens}	Back alignment and structure

>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A	Back alignment and structure

>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A	Back alignment and structure

>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A	Back alignment and structure

>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens}	Back alignment and structure

>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A	Back alignment and structure

>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens}	Back alignment and structure

>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens}	Back alignment and structure

>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A	Back alignment and structure

>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens}	Back alignment and structure

>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens}	Back alignment and structure

>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A	Back alignment and structure

>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B	Back alignment and structure

>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A	Back alignment and structure

>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A	Back alignment and structure

>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens}	Back alignment and structure

>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens}	Back alignment and structure

>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A	Back alignment and structure

>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A	Back alignment and structure

>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens}	Back alignment and structure

>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus}	Back alignment and structure

>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A	Back alignment and structure

>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens}	Back alignment and structure

>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1	Back alignment and structure

>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus}	Back alignment and structure

>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A*	Back alignment and structure

>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A	Back alignment and structure

>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A	Back alignment and structure

>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A	Back alignment and structure

>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A	Back alignment and structure

>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A	Back alignment and structure

>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A	Back alignment and structure

>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens}	Back alignment and structure

>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens}	Back alignment and structure

>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A	Back alignment and structure

>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus}	Back alignment and structure

>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A	Back alignment and structure

>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens}	Back alignment and structure

>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A	Back alignment and structure

>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0	Back alignment and structure

>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A	Back alignment and structure

>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A	Back alignment and structure

>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens}	Back alignment and structure

>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A	Back alignment and structure

>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A	Back alignment and structure

>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens}	Back alignment and structure

>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A	Back alignment and structure

>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens}	Back alignment and structure

>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A	Back alignment and structure

>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A*	Back alignment and structure

>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2	Back alignment and structure

>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A*	Back alignment and structure

>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A	Back alignment and structure

>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens}	Back alignment and structure

>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens}	Back alignment and structure

>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster}	Back alignment and structure

>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster}	Back alignment and structure

>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A	Back alignment and structure

>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A	Back alignment and structure

>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A	Back alignment and structure

>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens}	Back alignment and structure

>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens}	Back alignment and structure

>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens}	Back alignment and structure

>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens}	Back alignment and structure

>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0	Back alignment and structure

>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A	Back alignment and structure

>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A	Back alignment and structure

>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus}	Back alignment and structure

>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1	Back alignment and structure

>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A	Back alignment and structure

>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A	Back alignment and structure

>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens}	Back alignment and structure

>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A	Back alignment and structure

>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A	Back alignment and structure

>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4	Back alignment and structure

>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus}	Back alignment and structure

>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A	Back alignment and structure

>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus}	Back alignment and structure

>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A	Back alignment and structure

>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A	Back alignment and structure

>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens}	Back alignment and structure

>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens}	Back alignment and structure

>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus}	Back alignment and structure

>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens}	Back alignment and structure

>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A	Back alignment and structure

>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A	Back alignment and structure

>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A	Back alignment and structure

>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus}	Back alignment and structure

>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A	Back alignment and structure

>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens}	Back alignment and structure

>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens}	Back alignment and structure

>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus}	Back alignment and structure

>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens}	Back alignment and structure

>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae}	Back alignment and structure

>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A	Back alignment and structure

>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A	Back alignment and structure

>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A	Back alignment and structure

>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens}	Back alignment and structure

>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A	Back alignment and structure

>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans}	Back alignment and structure

>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A	Back alignment and structure

>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR}	Back alignment and structure

>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis}	Back alignment and structure

>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A	Back alignment and structure

>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5	Back alignment and structure

>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A	Back alignment and structure

>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1	Back alignment and structure

>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A	Back alignment and structure

>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5	Back alignment and structure

>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A	Back alignment and structure

>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli}	Back alignment and structure

>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana}	Back alignment and structure

>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens}	Back alignment and structure

>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6	Back alignment and structure

>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A	Back alignment and structure

>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A	Back alignment and structure

>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A	Back alignment and structure

>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A	Back alignment and structure

>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A	Back alignment and structure

>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343}	Back alignment and structure

>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A*	Back alignment and structure

>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A	Back alignment and structure

>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A	Back alignment and structure

>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana}	Back alignment and structure

>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		232
d1wfva_		103	b.36.1.1 (A:) Membrane associated guanylate kinase	2e-06
d1n7ea_		95	b.36.1.1 (A:) Glutamate receptor-interacting prote	7e-06
d1wi4a1		96	b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou	4e-05
d1uepa_		103	b.36.1.1 (A:) Membrane associated guanylate kinase	5e-05
d1kwaa_		88	b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta	6e-05
d1wifa_		126	b.36.1.1 (A:) hypothetical PDZ domain containing p	1e-04
d1uita_		117	b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma	2e-04
d1ueqa_		123	b.36.1.1 (A:) Membrane associated guanylate kinase	2e-04
d2fnea1		88	b.36.1.1 (A:1955-2042) Multiple PDZ domain protein	3e-04
d1wh1a_		124	b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human	3e-04
d1t2ma1		92	b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta	4e-04
d2fcfa1		96	b.36.1.1 (A:1148-1243) Multiple PDZ domain protein	5e-04
d1v5qa_		122	b.36.1.1 (A:) Glutamate receptor interacting prote	8e-04
d2fe5a1		92	b.36.1.1 (A:223-314) Synapse-associated protein 10	8e-04
d1wf8a1		94	b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens	9e-04
d1x45a1		85	b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei	0.001
d1v6ba_		118	b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI	0.001
d1x5ra1		99	b.36.1.1 (A:8-106) Glutamate receptor interacting	0.002
d1ufxa_		103	b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien	0.002
d1va8a1		100	b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M	0.002
d1p1da2		99	b.36.1.1 (A:115-213) Glutamate receptor interactin	0.003
d1rgra_		93	b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus	0.003
d1g9oa_		91	b.36.1.1 (A:) Na+/H+ exchanger regulatory factor,	0.003
d1v62a_		117	b.36.1.1 (A:) Glutamate receptor interacting prote	0.004

>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure


class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 43.0 bits (101), Expect = 2e-06
 Identities = 17/64 (26%), Positives = 33/64 (51%), Gaps = 7/64 (10%)

Query: 73  AESGSEEQEEKYEEYEVEIE---QPYGLKFAKGRD--GGTYIDAIAPGGSADKTGMFQVG 127
             SGS  Q+  ++ + V++E   + +G     GR+     Y+  +A  G A + G  +VG
Sbjct: 1   GSSGSSGQD--FDYFTVDMEKGAKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVG 58

Query: 128 DKVL 131
           D+++
Sbjct: 59  DQII 62

PyMOL of d1wfva_

>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95	Back information, alignment and structure

>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96	Back information, alignment and structure

>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88	Back information, alignment and structure

>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126	Back information, alignment and structure

>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117	Back information, alignment and structure

>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123	Back information, alignment and structure

>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88	Back information, alignment and structure

>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124	Back information, alignment and structure

>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92	Back information, alignment and structure

>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96	Back information, alignment and structure

>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122	Back information, alignment and structure

>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92	Back information, alignment and structure

>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94	Back information, alignment and structure

>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85	Back information, alignment and structure

>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118	Back information, alignment and structure

>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99	Back information, alignment and structure

>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100	Back information, alignment and structure

>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99	Back information, alignment and structure

>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93	Back information, alignment and structure

>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91	Back information, alignment and structure

>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		232
d1ozia_		99	Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1	99.01
d1tp5a1		102	Synaptic protein PSD-95 {Rat (Rattus norvegicus) [	98.95
d1i16a_		130	Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]	98.86
d1um1a_		110	Hypothetical protein KIAA1849 {Human (Homo sapiens	98.86
d1rgra_		93	Synaptic protein PSD-95 {Rat (Rattus norvegicus) [	98.85
d2fe5a1		92	Synapse-associated protein 102 {Human (Homo sapien	98.84
d1n7ea_		95	Glutamate receptor-interacting protein 1, GRIP1 {R	98.83
d1kwaa_		88	Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]}	98.82
d1wf8a1		94	Neurabin-i {Human (Homo sapiens) [TaxId: 9606]}	98.81
d1t2ma1		92	Afadin {Human (Homo sapiens) [TaxId: 9606]}	98.81
d1p1da2		99	Glutamate receptor interacting protein {Rat (Rattu	98.8
d1m5za_		91	Glutamate receptor interacting protein {Rat (Rattu	98.77
d1uita_		117	Discs large 5 protein KIAA0583 {Human (Homo sapien	98.76
d2f0aa1		92	Segment polarity protein dishevelled homolog Dvl-2	98.75
d1ihja_		94	Inad {Fruit fly (Drosophila melanogaster) [TaxId:	98.74
d1qava_		90	Syntrophin {Mouse (Mus musculus) [TaxId: 10090]}	98.71
d1wifa_		126	hypothetical PDZ domain containing protein Uqcrc2	98.7
d1whaa_		105	Scribble (KIAA0147) {Human (Homo sapiens) [TaxId:	98.69
d1qaua_		112	Neuronal nitric oxide synthase, NNOS {Rat (Rattus	98.69
d1uhpa_		107	Hypothetical protein KIAA1095 {Human (Homo sapiens	98.68
d1wfva_		103	Membrane associated guanylate kinase inverted-2 (M	98.68
d2fcfa1		96	Multiple PDZ domain protein {Human (Homo sapiens)	98.66
d1w9ea1		85	Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}	98.66
d1wg6a_		127	Partitioning-defective 3-like protein, PAR3-L (RIK	98.64
d2fnea1		88	Multiple PDZ domain protein {Human (Homo sapiens)	98.63
d1wi2a_		104	PDZ domain containing protein 11, Pdzk11 {Mouse (M	98.63
d1v62a_		117	Glutamate receptor interacting protein 2, GRIP2 (K	98.63
d1x5qa1		97	Scribble (KIAA0147) {Human (Homo sapiens) [TaxId:	98.63
d1rgwa_		85	Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax	98.6
d1wh1a_		124	Hypothetical protein KIAA1095 {Human (Homo sapiens	98.59
d1uepa_		103	Membrane associated guanylate kinase inverted-2 (M	98.56
d1x45a1		85	Amyloid beta A4 precursor protein-binding family A	98.52
d1v6ba_		118	Harmonin {Mouse (Mus musculus) [TaxId: 10090]}	98.49
d1uewa_		114	Membrane associated guanylate kinase inverted-2 (M	98.47
d1ujda_		117	Hypothetical protein KIAA0559 {Human (Homo sapiens	98.46
d1rzxa_		98	GTPase-binding domain of the cell polarity protein	98.45
d1vb7a_		94	PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta	98.42
d1ueqa_		123	Membrane associated guanylate kinase inverted-2 (M	98.41
d1uf1a_		128	KIAA1526 protein {Human (Homo sapiens) [TaxId: 960	98.41
d1va8a1		100	Maguk p55 subfamily member 5 {Mouse (Mus musculus)	98.41
d2csja1		104	Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc	98.41
d1x6da1		107	Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]	98.41
d1v5qa_		122	Glutamate receptor interacting protein {Mouse (Mus	98.39
d1x5na1		101	Harmonin {Human (Homo sapiens) [TaxId: 9606]}	98.38
d1g9oa_		91	Na+/H+ exchanger regulatory factor, NHERF {Human (	98.33
d2cssa1		108	Regulating synaptic membrane exocytosis protein 1,	98.33
d1q3oa_		104	Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId	98.32
d2h3la1		103	Erbin {Human (Homo sapiens) [TaxId: 9606]}	98.32
d1wi4a1		96	Syntaxin binding protein 4 {Mouse (Mus musculus) [	98.32
d2f5ya1		77	Regulator of G-protein signaling 3, RGS3 {Human (H	98.3
d1ujua_		111	Scribble (KIAA0147) {Human (Homo sapiens) [TaxId:	98.29
d2z9ia1		88	Protease PepD {Mycobacterium tuberculosis [TaxId:	98.24
d1x5ra1		99	Glutamate receptor interacting protein 2, GRIP2 (K	98.2
d1wf7a_		103	Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1	98.13
d1fc6a3		92	Photosystem II D1 C-terminal processing protease {	98.12
d1ufxa_		103	KIAA1526 protein {Human (Homo sapiens) [TaxId: 960	98.1
d1v5la_		103	Alpha-actinin-2 associated LIM protein {Mouse (Mus	98.02
d2cs5a1		106	Tyrosine-protein phosphatase non-receptor type 4,	98.01
d1y7na1		79	Amyloid beta A4 precursor protein-binding family A	97.97
d1r6ja_		82	Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}	97.93
d1ueza_		101	KIAA1526 protein {Human (Homo sapiens) [TaxId: 960	97.92
d1ky9b2		88	Protease Do (DegP, HtrA), C-terminal domains {Esch	97.83
d1vaea_		111	Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]}	97.69
d1lcya1		100	Mitochondrial serine protease HtrA2 {Human (Homo s	97.54
d1ujva_		96	Membrane associated guanylate kinase inverted-2 (M	97.38
d1ky9a1		94	Protease Do (DegP, HtrA), C-terminal domains {Esch	97.25
d1k32a1		91	Tricorn protease {Archaeon Thermoplasma acidophilu	97.2
d1sota1		99	Stress sensor protease DegS, C-terminal domain {Es	97.03
d2hgaa1		103	Uncharacterized protein MTH1368 {Methanobacterium	97.0
d2i6va1		87	General secretion pathway protein C, EpsC {Vibrio	96.01

>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Phosphatase hPTP1e
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.01  E-value=7.3e-10  Score=80.73  Aligned_cols=84  Identities=29%  Similarity=0.463  Sum_probs=66.5

Q ss_pred             cccEEEEEecC---cceeEEeee----------CCCCeEEEEeCCCCCcccccccccCcEEEEeecccCCceeeccchhh
Q 026827           83 KYEEYEVEIEQ---PYGLKFAKG----------RDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGR  149 (232)
Q Consensus        83 ~~eeyeVeL~K---PLGL~Fee~----------~dGgvyV~eV~pGGNAaKaG~I~VGD~LvatSA~FGdElWpA~~~G~  149 (232)
                      |-+.|+|+|.|   +||+.+...          .++++||..|.|+|.|+++|.|++||+|+++-..   .|- -..+-+
T Consensus         2 pg~~~~V~L~k~~~~lG~~i~~~~~~~g~~~~~~~~~i~V~~V~~gg~A~~~G~L~~GD~Il~VNg~---~v~-~~s~~~   77 (99)
T d1ozia_           2 PGDTFEVELAKTDGSLGISVTVLFDKGGVNTSVRHGGIYVKAIIPKGAAESDGRIHKGDRVLAVNGV---SLE-GATHKQ   77 (99)
T ss_dssp             TTCEEEEEEECCSSSCSEEEESCCSSSCSSCSSSCCCEEEEEECSSSHHHHHTCCCTTCEEEEETTE---ECS-SCCHHH
T ss_pred             CCCEEEEEEEECCCCCcEEEEeeccCCCcccccCCCCEEEEEECCCChHHhcCCCCccCEEEEECCE---EcC-CCCHHH
Confidence            34679999976   688988643          2347999999999999999999999999998752   232 226668


Q ss_pred             HHHHhhcccCceEEEEeecCC
Q 026827          150 TMYTIRQRVGPLLMKMQKRYG  170 (232)
Q Consensus       150 t~~AIr~RsGpv~LkLeR~~~  170 (232)
                      ++.+|+.-...|.|++.|..-
T Consensus        78 a~~~lk~~~~~v~L~v~R~~~   98 (99)
T d1ozia_          78 AVETLRNTGQVVHLLLEKGQV   98 (99)
T ss_dssp             HHHHHHHSCSEEEEEEECCCC
T ss_pred             HHHHHHCCCCeEEEEEEeCCC
Confidence            889999767889999999643

PyMOL of d1ozia_

>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]}	Back information, alignment and structure

>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]}	Back information, alignment and structure

>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure