Citrus Sinensis ID: 026893
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 231 | ||||||
| 225456323 | 427 | PREDICTED: ubiquitin-like modifier-activ | 0.956 | 0.517 | 0.882 | 1e-112 | |
| 449454828 | 426 | PREDICTED: ubiquitin-like modifier-activ | 0.956 | 0.518 | 0.886 | 1e-111 | |
| 224133968 | 428 | predicted protein [Populus trichocarpa] | 0.956 | 0.516 | 0.878 | 1e-110 | |
| 255540239 | 428 | Ubiquitin-activating enzyme E1 domain-co | 0.956 | 0.516 | 0.864 | 1e-109 | |
| 357465057 | 427 | Ubiquitin-like modifier-activating enzym | 0.956 | 0.517 | 0.809 | 1e-103 | |
| 357450289 | 427 | Ubiquitin-like modifier-activating enzym | 0.956 | 0.517 | 0.805 | 1e-102 | |
| 217073700 | 407 | unknown [Medicago truncatula] | 0.956 | 0.542 | 0.805 | 1e-102 | |
| 388491632 | 428 | unknown [Lotus japonicus] | 0.952 | 0.514 | 0.816 | 1e-100 | |
| 334182302 | 431 | ubiquitin-like modifier-activating enzym | 0.943 | 0.505 | 0.810 | 3e-98 | |
| 297848806 | 447 | thiF family protein [Arabidopsis lyrata | 0.943 | 0.487 | 0.810 | 3e-98 |
| >gi|225456323|ref|XP_002283797.1| PREDICTED: ubiquitin-like modifier-activating enzyme 5 isoform 1 [Vitis vinifera] gi|297734421|emb|CBI15668.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 410 bits (1055), Expect = e-112, Method: Compositional matrix adjust.
Identities = 195/221 (88%), Positives = 209/221 (94%)
Query: 1 MEAELKDMIDDLESLKRSLPDSSLHASIDKLELRVENLTKMAMSATARRSKVKDMSSEVV 60
M+ ELK+M+DDL++LKRSLPD S ASIDKL++ VE+LT +A A ARRSKVKDMS+EVV
Sbjct: 1 MDVELKEMLDDLQALKRSLPDPSHQASIDKLQVHVEHLTNLAQYAPARRSKVKDMSAEVV 60
Query: 61 DSNPYSRLMALQRMGIVENYERIREFSVAIVGVGGVGSVAAEMLTRCGIGRLLLYDYDKV 120
DSNPYSRLMALQRMGIVENYERIREFSVAIVG+GGVGSVAAEMLTRCGIGRLLLYDYDKV
Sbjct: 61 DSNPYSRLMALQRMGIVENYERIREFSVAIVGIGGVGSVAAEMLTRCGIGRLLLYDYDKV 120
Query: 121 ELANMNRLFFRPEQVGMTKTDAAVQTLADINPDVVLESFTLNITTVQGFETFMSSLRNKS 180
ELANMNRLFFRPEQVGMTKTDAAVQTL+DINPDVVLES+TLNITTVQGFETFMSSLR K+
Sbjct: 121 ELANMNRLFFRPEQVGMTKTDAAVQTLSDINPDVVLESYTLNITTVQGFETFMSSLRKKT 180
Query: 181 FRPSKEGSGVDLVLSCVDNYEARMAVNQACNELNQTWMESG 221
FRP KEGSGVDLVLSCVDNYEARM VNQACNELNQTWMESG
Sbjct: 181 FRPKKEGSGVDLVLSCVDNYEARMVVNQACNELNQTWMESG 221
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449454828|ref|XP_004145156.1| PREDICTED: ubiquitin-like modifier-activating enzyme 5-like [Cucumis sativus] gi|449474254|ref|XP_004154119.1| PREDICTED: ubiquitin-like modifier-activating enzyme 5-like [Cucumis sativus] gi|449503682|ref|XP_004162124.1| PREDICTED: ubiquitin-like modifier-activating enzyme 5-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224133968|ref|XP_002321704.1| predicted protein [Populus trichocarpa] gi|222868700|gb|EEF05831.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255540239|ref|XP_002511184.1| Ubiquitin-activating enzyme E1 domain-containing protein, putative [Ricinus communis] gi|223550299|gb|EEF51786.1| Ubiquitin-activating enzyme E1 domain-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|357465057|ref|XP_003602810.1| Ubiquitin-like modifier-activating enzyme [Medicago truncatula] gi|355491858|gb|AES73061.1| Ubiquitin-like modifier-activating enzyme [Medicago truncatula] gi|388517059|gb|AFK46591.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357450289|ref|XP_003595421.1| Ubiquitin-like modifier-activating enzyme [Medicago truncatula] gi|355484469|gb|AES65672.1| Ubiquitin-like modifier-activating enzyme [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|217073700|gb|ACJ85210.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388491632|gb|AFK33882.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|334182302|ref|NP_172027.2| ubiquitin-like modifier-activating enzyme 5 [Arabidopsis thaliana] gi|290463407|sp|O23034.2|UBA5_ARATH RecName: Full=Ubiquitin-like modifier-activating enzyme 5; Short=Ubiquitin-activating enzyme 5 gi|332189707|gb|AEE27828.1| ubiquitin-like modifier-activating enzyme 5 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297848806|ref|XP_002892284.1| thiF family protein [Arabidopsis lyrata subsp. lyrata] gi|297338126|gb|EFH68543.1| thiF family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 231 | ||||||
| UNIPROTKB|A7MAZ3 | 404 | UBA5 "Ubiquitin-like modifier- | 0.831 | 0.475 | 0.563 | 4.3e-54 | |
| UNIPROTKB|Q3KQ23 | 397 | uba5 "Ubiquitin-like modifier- | 0.735 | 0.428 | 0.630 | 2.4e-53 | |
| RGD|1311702 | 403 | Uba5 "ubiquitin-like modifier | 0.809 | 0.464 | 0.584 | 2.4e-53 | |
| MGI|MGI:1913913 | 403 | Uba5 "ubiquitin-like modifier | 0.831 | 0.476 | 0.558 | 3e-53 | |
| UNIPROTKB|E2QZV1 | 427 | UBA5 "Uncharacterized protein" | 0.826 | 0.447 | 0.551 | 1e-52 | |
| ZFIN|ZDB-GENE-031112-2 | 399 | uba5 "ubiquitin-like modifier | 0.839 | 0.486 | 0.539 | 1e-52 | |
| UNIPROTKB|E7EQ61 | 377 | UBA5 "Ubiquitin-like modifier- | 0.831 | 0.509 | 0.548 | 1.3e-52 | |
| UNIPROTKB|E7EWE1 | 347 | UBA5 "Ubiquitin-like modifier- | 0.831 | 0.553 | 0.548 | 1.3e-52 | |
| UNIPROTKB|Q9GZZ9 | 404 | UBA5 "Ubiquitin-like modifier- | 0.831 | 0.475 | 0.548 | 1.3e-52 | |
| UNIPROTKB|Q5R8X4 | 404 | UBA5 "Ubiquitin-like modifier- | 0.831 | 0.475 | 0.548 | 1.3e-52 |
| UNIPROTKB|A7MAZ3 UBA5 "Ubiquitin-like modifier-activating enzyme 5" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Score = 559 (201.8 bits), Expect = 4.3e-54, P = 4.3e-54
Identities = 116/206 (56%), Positives = 143/206 (69%)
Query: 27 SIDKLELRVENLTK-MAMSATAR----------RSKVKDMSSEVVDSNPYSRLMALQRMG 75
S+++L+ RVE L + +A + R R++++ MSSEVVDSNPYSRLMAL+RMG
Sbjct: 4 SVERLQQRVEELERELAQERSRRALGSGDGGGGRARIEKMSSEVVDSNPYSRLMALKRMG 63
Query: 76 IVENYERIREFXXXXXXXXXXXXXXXEMLTRCGIGRLLLYDYDKVELANMNRLFFRPEQV 135
IV +YE+IR F EMLTRCGIG+LLL+DYDKVELANMNRLFF+P Q
Sbjct: 64 IVSDYEKIRTFTVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPHQA 123
Query: 136 GMTKTDAAVQTLADINPDVVLESFTLNITTVQGFETFMSSLRNKSFRPSKEGSGVDLVLS 195
G++K AA TL +INPDV+ E NITTV+ FE FM+ + N +EG VDLVLS
Sbjct: 124 GLSKVQAAEHTLRNINPDVLFEVHNYNITTVENFEHFMNRISNGGL---EEGKPVDLVLS 180
Query: 196 CVDNYEARMAVNQACNELNQTWMESG 221
CVDN+EARM +N ACNEL QTWMESG
Sbjct: 181 CVDNFEARMTINTACNELGQTWMESG 206
|
|
| UNIPROTKB|Q3KQ23 uba5 "Ubiquitin-like modifier-activating enzyme 5" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| RGD|1311702 Uba5 "ubiquitin-like modifier activating enzyme 5" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1913913 Uba5 "ubiquitin-like modifier activating enzyme 5" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QZV1 UBA5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-031112-2 uba5 "ubiquitin-like modifier activating enzyme 5" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EQ61 UBA5 "Ubiquitin-like modifier-activating enzyme 5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EWE1 UBA5 "Ubiquitin-like modifier-activating enzyme 5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9GZZ9 UBA5 "Ubiquitin-like modifier-activating enzyme 5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R8X4 UBA5 "Ubiquitin-like modifier-activating enzyme 5" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 231 | |||
| cd00757 | 228 | cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA | 7e-55 | |
| pfam00899 | 134 | pfam00899, ThiF, ThiF family | 4e-38 | |
| TIGR02356 | 202 | TIGR02356, adenyl_thiF, thiazole biosynthesis aden | 2e-28 | |
| PRK08644 | 212 | PRK08644, PRK08644, thiamine biosynthesis protein | 1e-27 | |
| COG0476 | 254 | COG0476, ThiF, Dinucleotide-utilizing enzymes invo | 3e-25 | |
| cd01483 | 143 | cd01483, E1_enzyme_family, Superfamily of activati | 6e-24 | |
| cd00755 | 231 | cd00755, YgdL_like, Family of activating enzymes ( | 3e-23 | |
| PRK05690 | 245 | PRK05690, PRK05690, molybdopterin biosynthesis pro | 6e-23 | |
| PRK08762 | 376 | PRK08762, PRK08762, molybdopterin biosynthesis pro | 2e-20 | |
| TIGR02354 | 200 | TIGR02354, thiF_fam2, thiamine biosynthesis protei | 2e-20 | |
| PRK07688 | 339 | PRK07688, PRK07688, thiamine/molybdopterin biosynt | 7e-20 | |
| cd01487 | 174 | cd01487, E1_ThiF_like, E1_ThiF_like | 1e-19 | |
| COG1179 | 263 | COG1179, COG1179, Dinucleotide-utilizing enzymes i | 3e-19 | |
| TIGR02355 | 240 | TIGR02355, moeB, molybdopterin synthase sulfurylas | 8e-19 | |
| PRK12475 | 338 | PRK12475, PRK12475, thiamine/molybdopterin biosynt | 2e-17 | |
| PRK05597 | 355 | PRK05597, PRK05597, molybdopterin biosynthesis pro | 9e-16 | |
| PRK08328 | 231 | PRK08328, PRK08328, hypothetical protein; Provisio | 5e-15 | |
| cd01489 | 312 | cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E | 2e-14 | |
| cd01484 | 234 | cd01484, E1-2_like, Ubiquitin activating enzyme (E | 3e-14 | |
| PRK05600 | 370 | PRK05600, PRK05600, thiamine biosynthesis protein | 7e-14 | |
| PRK08223 | 287 | PRK08223, PRK08223, hypothetical protein; Validate | 1e-12 | |
| PRK07411 | 390 | PRK07411, PRK07411, hypothetical protein; Validate | 2e-11 | |
| PRK15116 | 268 | PRK15116, PRK15116, sulfur acceptor protein CsdL; | 4e-11 | |
| PRK07878 | 392 | PRK07878, PRK07878, molybdopterin biosynthesis-lik | 2e-10 | |
| PRK14851 | 679 | PRK14851, PRK14851, hypothetical protein; Provisio | 5e-10 | |
| cd01490 | 435 | cd01490, Ube1_repeat2, Ubiquitin activating enzyme | 1e-09 | |
| TIGR01408 | 1008 | TIGR01408, Ube1, ubiquitin-activating enzyme E1 | 2e-09 | |
| TIGR01408 | 1008 | TIGR01408, Ube1, ubiquitin-activating enzyme E1 | 2e-07 | |
| PRK14852 | 989 | PRK14852, PRK14852, hypothetical protein; Provisio | 5e-07 | |
| cd01491 | 286 | cd01491, Ube1_repeat1, Ubiquitin activating enzyme | 2e-05 | |
| TIGR03736 | 244 | TIGR03736, PRTRC_ThiF, PRTRC system ThiF family pr | 2e-05 | |
| cd01488 | 291 | cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1 | 3e-05 | |
| PRK07877 | 722 | PRK07877, PRK07877, hypothetical protein; Provisio | 7e-05 | |
| cd01492 | 197 | cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E | 0.001 | |
| PRK06153 | 393 | PRK06153, PRK06153, hypothetical protein; Provisio | 0.002 | |
| cd12158 | 343 | cd12158, ErythrP_dh, D-Erythronate-4-Phosphate Deh | 0.003 | |
| cd01485 | 198 | cd01485, E1-1_like, Ubiquitin activating enzyme (E | 0.004 |
| >gnl|CDD|238386 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA | Back alignment and domain information |
|---|
Score = 174 bits (445), Expect = 7e-55
Identities = 55/159 (34%), Positives = 81/159 (50%), Gaps = 17/159 (10%)
Query: 64 PYSRLMALQRMGIVENYERIREFSVAIVGVGGVGSVAAEMLTRCGIGRLLLYDYDKVELA 123
YSR + L +G E E+++ V +VG GG+GS AAE L G+G+L L D D VEL+
Sbjct: 1 RYSRQILLPEIGE-EGQEKLKNARVLVVGAGGLGSPAAEYLAAAGVGKLGLVDDDVVELS 59
Query: 124 NMNR-LFFRPEQVGMTKTDAAVQTLADINPDVVLESFTLNITTVQGFETFMSSLRNKSFR 182
N+ R + VG K +AA + L INPDV +E++ + + E +
Sbjct: 60 NLQRQILHTEADVGQPKAEAAAERLRAINPDVEIEAYNERL-DAENAEELI--------- 109
Query: 183 PSKEGSGVDLVLSCVDNYEARMAVNQACNELNQTWMESG 221
+G DLVL C DN+ R +N AC +L + +
Sbjct: 110 -----AGYDLVLDCTDNFATRYLINDACVKLGKPLVSGA 143
|
Family of E1-like enzymes involved in molybdopterin and thiamine biosynthesis family. The common reaction mechanism catalyzed by MoeB and ThiF, like other E1 enzymes, begins with a nucleophilic attack of the C-terminal carboxylate of MoaD and ThiS, respectively, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of MoaD and ThiS. MoeB, as the MPT synthase (MoaE/MoaD complex) sulfurase, is involved in the biosynthesis of the molybdenum cofactor, a derivative of the tricyclic pterin, molybdopterin (MPT). ThiF catalyzes the adenylation of ThiS, as part of the biosynthesis pathway of thiamin pyrophosphate (vitamin B1). . Length = 228 |
| >gnl|CDD|216180 pfam00899, ThiF, ThiF family | Back alignment and domain information |
|---|
| >gnl|CDD|162820 TIGR02356, adenyl_thiF, thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >gnl|CDD|236320 PRK08644, PRK08644, thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223552 COG0476, ThiF, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238760 cd01483, E1_enzyme_family, Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238384 cd00755, YgdL_like, Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >gnl|CDD|180204 PRK05690, PRK05690, molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|162819 TIGR02354, thiF_fam2, thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >gnl|CDD|181084 PRK07688, PRK07688, thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238764 cd01487, E1_ThiF_like, E1_ThiF_like | Back alignment and domain information |
|---|
| >gnl|CDD|224100 COG1179, COG1179, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|131408 TIGR02355, moeB, molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >gnl|CDD|183547 PRK12475, PRK12475, thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|169382 PRK08328, PRK08328, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238766 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E1) subunit UBA2 | Back alignment and domain information |
|---|
| >gnl|CDD|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like | Back alignment and domain information |
|---|
| >gnl|CDD|235528 PRK05600, PRK05600, thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181302 PRK08223, PRK08223, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180967 PRK07411, PRK07411, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|185071 PRK15116, PRK15116, sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181156 PRK07878, PRK07878, molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|184853 PRK14851, PRK14851, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238767 cd01490, Ube1_repeat2, Ubiquitin activating enzyme (E1), repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|130475 TIGR01408, Ube1, ubiquitin-activating enzyme E1 | Back alignment and domain information |
|---|
| >gnl|CDD|130475 TIGR01408, Ube1, ubiquitin-activating enzyme E1 | Back alignment and domain information |
|---|
| >gnl|CDD|184854 PRK14852, PRK14852, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238768 cd01491, Ube1_repeat1, Ubiquitin activating enzyme (E1), repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|163448 TIGR03736, PRTRC_ThiF, PRTRC system ThiF family protein | Back alignment and domain information |
|---|
| >gnl|CDD|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3 | Back alignment and domain information |
|---|
| >gnl|CDD|236122 PRK07877, PRK07877, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >gnl|CDD|235717 PRK06153, PRK06153, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240635 cd12158, ErythrP_dh, D-Erythronate-4-Phosphate Dehydrogenase NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|238762 cd01485, E1-1_like, Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 231 | |||
| KOG2336 | 422 | consensus Molybdopterin biosynthesis-related prote | 100.0 | |
| PRK06153 | 393 | hypothetical protein; Provisional | 100.0 | |
| cd01492 | 197 | Aos1_SUMO Ubiquitin activating enzyme (E1) subunit | 100.0 | |
| cd01485 | 198 | E1-1_like Ubiquitin activating enzyme (E1), repeat | 100.0 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 100.0 | |
| PRK05690 | 245 | molybdopterin biosynthesis protein MoeB; Provision | 100.0 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 100.0 | |
| PRK08223 | 287 | hypothetical protein; Validated | 100.0 | |
| cd00757 | 228 | ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 | 100.0 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 100.0 | |
| PRK08328 | 231 | hypothetical protein; Provisional | 100.0 | |
| PRK07411 | 390 | hypothetical protein; Validated | 100.0 | |
| PRK07878 | 392 | molybdopterin biosynthesis-like protein MoeZ; Vali | 100.0 | |
| cd01491 | 286 | Ube1_repeat1 Ubiquitin activating enzyme (E1), rep | 100.0 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 100.0 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 100.0 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 100.0 | |
| PRK15116 | 268 | sulfur acceptor protein CsdL; Provisional | 100.0 | |
| PRK14851 | 679 | hypothetical protein; Provisional | 100.0 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 100.0 | |
| cd01493 | 425 | APPBP1_RUB Ubiquitin activating enzyme (E1) subuni | 100.0 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 100.0 | |
| cd01484 | 234 | E1-2_like Ubiquitin activating enzyme (E1), repeat | 100.0 | |
| COG0476 | 254 | ThiF Dinucleotide-utilizing enzymes involved in mo | 100.0 | |
| COG1179 | 263 | Dinucleotide-utilizing enzymes involved in molybdo | 100.0 | |
| TIGR01408 | 1008 | Ube1 ubiquitin-activating enzyme E1. This model re | 100.0 | |
| TIGR01408 | 1008 | Ube1 ubiquitin-activating enzyme E1. This model re | 100.0 | |
| KOG2017 | 427 | consensus Molybdopterin synthase sulfurylase [Coen | 100.0 | |
| PRK14852 | 989 | hypothetical protein; Provisional | 100.0 | |
| cd00755 | 231 | YgdL_like Family of activating enzymes (E1) of ubi | 100.0 | |
| cd01483 | 143 | E1_enzyme_family Superfamily of activating enzymes | 100.0 | |
| cd01489 | 312 | Uba2_SUMO Ubiquitin activating enzyme (E1) subunit | 99.98 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 99.97 | |
| PRK07877 | 722 | hypothetical protein; Provisional | 99.97 | |
| cd01488 | 291 | Uba3_RUB Ubiquitin activating enzyme (E1) subunit | 99.97 | |
| cd01490 | 435 | Ube1_repeat2 Ubiquitin activating enzyme (E1), rep | 99.97 | |
| TIGR01381 | 664 | E1_like_apg7 E1-like protein-activating enzyme Gsa | 99.96 | |
| KOG2013 | 603 | consensus SMT3/SUMO-activating complex, catalytic | 99.96 | |
| cd01487 | 174 | E1_ThiF_like E1_ThiF_like. Member of superfamily o | 99.96 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 99.96 | |
| cd01486 | 307 | Apg7 Apg7 is an E1-like protein, that activates tw | 99.96 | |
| KOG2014 | 331 | consensus SMT3/SUMO-activating complex, AOS1/RAD31 | 99.95 | |
| TIGR03736 | 244 | PRTRC_ThiF PRTRC system ThiF family protein. A nov | 99.95 | |
| TIGR03603 | 318 | cyclo_dehy_ocin bacteriocin biosynthesis cyclodehy | 99.95 | |
| PTZ00245 | 287 | ubiquitin activating enzyme; Provisional | 99.95 | |
| KOG2015 | 422 | consensus NEDD8-activating complex, catalytic comp | 99.94 | |
| KOG2018 | 430 | consensus Predicted dinucleotide-utilizing enzyme | 99.94 | |
| KOG2012 | 1013 | consensus Ubiquitin activating enzyme UBA1 [Posttr | 99.92 | |
| KOG2012 | 1013 | consensus Ubiquitin activating enzyme UBA1 [Posttr | 99.92 | |
| KOG2016 | 523 | consensus NEDD8-activating complex, APP-BP1/UBA5 c | 99.88 | |
| KOG2337 | 669 | consensus Ubiquitin activating E1 enzyme-like prot | 99.58 | |
| TIGR03693 | 637 | ocin_ThiF_like putative thiazole-containing bacter | 99.54 | |
| COG4015 | 217 | Predicted dinucleotide-utilizing enzyme of the Thi | 98.79 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 98.57 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 98.35 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 98.26 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 98.24 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 98.19 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 98.19 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 98.13 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 98.0 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 97.85 | |
| PRK14027 | 283 | quinate/shikimate dehydrogenase; Provisional | 97.76 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 97.73 | |
| TIGR01809 | 282 | Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO | 97.6 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 97.51 | |
| COG1648 | 210 | CysG Siroheme synthase (precorrin-2 oxidase/ferroc | 97.48 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 97.4 | |
| PRK10637 | 457 | cysG siroheme synthase; Provisional | 97.39 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 97.38 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 97.37 | |
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 97.33 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 97.33 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 97.29 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 97.29 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 97.29 | |
| COG0169 | 283 | AroE Shikimate 5-dehydrogenase [Amino acid transpo | 97.26 | |
| PTZ00142 | 470 | 6-phosphogluconate dehydrogenase; Provisional | 97.26 | |
| COG0373 | 414 | HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | 97.23 | |
| COG0300 | 265 | DltE Short-chain dehydrogenases of various substra | 97.23 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 97.23 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 97.22 | |
| TIGR03882 | 193 | cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydr | 97.21 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 97.21 | |
| PRK13940 | 414 | glutamyl-tRNA reductase; Provisional | 97.21 | |
| KOG4169 | 261 | consensus 15-hydroxyprostaglandin dehydrogenase an | 97.2 | |
| PRK12749 | 288 | quinate/shikimate dehydrogenase; Reviewed | 97.19 | |
| COG1086 | 588 | Predicted nucleoside-diphosphate sugar epimerases | 97.17 | |
| PRK09599 | 301 | 6-phosphogluconate dehydrogenase-like protein; Rev | 97.17 | |
| PLN02350 | 493 | phosphogluconate dehydrogenase (decarboxylating) | 97.16 | |
| PRK08251 | 248 | short chain dehydrogenase; Provisional | 97.15 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 97.12 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 97.1 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 97.05 | |
| PF00106 | 167 | adh_short: short chain dehydrogenase alcohol dehyd | 97.02 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 97.02 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 97.01 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 96.98 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 96.96 | |
| PRK07523 | 255 | gluconate 5-dehydrogenase; Provisional | 96.96 | |
| PF01118 | 121 | Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi | 96.95 | |
| TIGR00872 | 298 | gnd_rel 6-phosphogluconate dehydrogenase (decarbox | 96.94 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 96.93 | |
| TIGR00873 | 467 | gnd 6-phosphogluconate dehydrogenase, decarboxylat | 96.91 | |
| cd05290 | 307 | LDH_3 A subgroup of L-lactate dehydrogenases. L-la | 96.9 | |
| PRK08217 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 96.89 | |
| PRK05875 | 276 | short chain dehydrogenase; Provisional | 96.87 | |
| TIGR01832 | 248 | kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod | 96.86 | |
| PRK03562 | 621 | glutathione-regulated potassium-efflux system prot | 96.86 | |
| PRK05867 | 253 | short chain dehydrogenase; Provisional | 96.85 | |
| PRK12384 | 259 | sorbitol-6-phosphate dehydrogenase; Provisional | 96.83 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 96.83 | |
| PRK06194 | 287 | hypothetical protein; Provisional | 96.82 | |
| PRK08339 | 263 | short chain dehydrogenase; Provisional | 96.79 | |
| PRK08213 | 259 | gluconate 5-dehydrogenase; Provisional | 96.78 | |
| PRK06949 | 258 | short chain dehydrogenase; Provisional | 96.76 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 96.76 | |
| PRK07478 | 254 | short chain dehydrogenase; Provisional | 96.74 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 96.74 | |
| PRK09186 | 256 | flagellin modification protein A; Provisional | 96.73 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 96.71 | |
| PRK12939 | 250 | short chain dehydrogenase; Provisional | 96.71 | |
| PRK12490 | 299 | 6-phosphogluconate dehydrogenase-like protein; Rev | 96.7 | |
| PRK06138 | 252 | short chain dehydrogenase; Provisional | 96.69 | |
| PF02719 | 293 | Polysacc_synt_2: Polysaccharide biosynthesis prote | 96.69 | |
| PRK05866 | 293 | short chain dehydrogenase; Provisional | 96.69 | |
| PRK06139 | 330 | short chain dehydrogenase; Provisional | 96.69 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 96.68 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 96.67 | |
| PRK06940 | 275 | short chain dehydrogenase; Provisional | 96.67 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 96.65 | |
| PRK05708 | 305 | 2-dehydropantoate 2-reductase; Provisional | 96.64 | |
| cd01076 | 227 | NAD_bind_1_Glu_DH NAD(P) binding domain of glutama | 96.61 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of | 96.61 | |
| PRK05876 | 275 | short chain dehydrogenase; Provisional | 96.6 | |
| PRK13394 | 262 | 3-hydroxybutyrate dehydrogenase; Provisional | 96.6 | |
| PRK08277 | 278 | D-mannonate oxidoreductase; Provisional | 96.6 | |
| PRK12429 | 258 | 3-hydroxybutyrate dehydrogenase; Provisional | 96.59 | |
| PLN00203 | 519 | glutamyl-tRNA reductase | 96.59 | |
| PRK06198 | 260 | short chain dehydrogenase; Provisional | 96.59 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 96.59 | |
| PRK08063 | 250 | enoyl-(acyl carrier protein) reductase; Provisiona | 96.59 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 96.59 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 96.58 | |
| PLN02253 | 280 | xanthoxin dehydrogenase | 96.58 | |
| PRK07774 | 250 | short chain dehydrogenase; Provisional | 96.58 | |
| PRK07666 | 239 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 96.55 | |
| PRK06196 | 315 | oxidoreductase; Provisional | 96.55 | |
| PRK07453 | 322 | protochlorophyllide oxidoreductase; Validated | 96.54 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 96.54 | |
| PRK06124 | 256 | gluconate 5-dehydrogenase; Provisional | 96.54 | |
| PRK06172 | 253 | short chain dehydrogenase; Provisional | 96.52 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 96.52 | |
| PRK05872 | 296 | short chain dehydrogenase; Provisional | 96.52 | |
| PRK08085 | 254 | gluconate 5-dehydrogenase; Provisional | 96.51 | |
| cd05293 | 312 | LDH_1 A subgroup of L-lactate dehydrogenases. L-la | 96.51 | |
| PRK08643 | 256 | acetoin reductase; Validated | 96.5 | |
| PRK06181 | 263 | short chain dehydrogenase; Provisional | 96.5 | |
| PRK08265 | 261 | short chain dehydrogenase; Provisional | 96.49 | |
| PRK08589 | 272 | short chain dehydrogenase; Validated | 96.48 | |
| PRK03659 | 601 | glutathione-regulated potassium-efflux system prot | 96.47 | |
| TIGR03206 | 250 | benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr | 96.47 | |
| PRK07576 | 264 | short chain dehydrogenase; Provisional | 96.47 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 96.46 | |
| PRK06125 | 259 | short chain dehydrogenase; Provisional | 96.43 | |
| PRK00045 | 423 | hemA glutamyl-tRNA reductase; Reviewed | 96.42 | |
| cd00300 | 300 | LDH_like L-lactate dehydrogenase-like enzymes. Mem | 96.41 | |
| PRK07814 | 263 | short chain dehydrogenase; Provisional | 96.39 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.37 | |
| PLN02427 | 386 | UDP-apiose/xylose synthase | 96.37 | |
| PRK06500 | 249 | short chain dehydrogenase; Provisional | 96.37 | |
| PRK12829 | 264 | short chain dehydrogenase; Provisional | 96.37 | |
| TIGR03589 | 324 | PseB UDP-N-acetylglucosamine 4,6-dehydratase. This | 96.37 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 96.37 | |
| PRK07035 | 252 | short chain dehydrogenase; Provisional | 96.36 | |
| PRK07326 | 237 | short chain dehydrogenase; Provisional | 96.36 | |
| PRK07097 | 265 | gluconate 5-dehydrogenase; Provisional | 96.35 | |
| PRK00048 | 257 | dihydrodipicolinate reductase; Provisional | 96.35 | |
| PRK07677 | 252 | short chain dehydrogenase; Provisional | 96.35 | |
| PRK08618 | 325 | ornithine cyclodeaminase; Validated | 96.34 | |
| PRK08945 | 247 | putative oxoacyl-(acyl carrier protein) reductase; | 96.34 | |
| PRK06113 | 255 | 7-alpha-hydroxysteroid dehydrogenase; Validated | 96.34 | |
| PRK06522 | 304 | 2-dehydropantoate 2-reductase; Reviewed | 96.33 | |
| PRK05565 | 247 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 96.33 | |
| PLN02602 | 350 | lactate dehydrogenase | 96.32 | |
| PRK07024 | 257 | short chain dehydrogenase; Provisional | 96.32 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.32 | |
| PRK08594 | 257 | enoyl-(acyl carrier protein) reductase; Provisiona | 96.3 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 96.3 | |
| PRK12825 | 249 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 96.28 | |
| PRK12744 | 257 | short chain dehydrogenase; Provisional | 96.28 | |
| PRK06914 | 280 | short chain dehydrogenase; Provisional | 96.28 | |
| TIGR02622 | 349 | CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member | 96.27 | |
| PRK07890 | 258 | short chain dehydrogenase; Provisional | 96.25 | |
| PRK07109 | 334 | short chain dehydrogenase; Provisional | 96.25 | |
| PRK07067 | 257 | sorbitol dehydrogenase; Provisional | 96.24 | |
| PRK06935 | 258 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 96.24 | |
| PRK07074 | 257 | short chain dehydrogenase; Provisional | 96.24 | |
| PLN02240 | 352 | UDP-glucose 4-epimerase | 96.24 | |
| PRK07984 | 262 | enoyl-(acyl carrier protein) reductase; Provisiona | 96.24 | |
| TIGR02992 | 326 | ectoine_eutC ectoine utilization protein EutC. Mem | 96.23 | |
| PRK05717 | 255 | oxidoreductase; Validated | 96.23 | |
| PRK06223 | 307 | malate dehydrogenase; Reviewed | 96.22 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.21 | |
| PRK08416 | 260 | 7-alpha-hydroxysteroid dehydrogenase; Provisional | 96.21 | |
| PRK08309 | 177 | short chain dehydrogenase; Provisional | 96.2 | |
| PRK08628 | 258 | short chain dehydrogenase; Provisional | 96.2 | |
| PRK06114 | 254 | short chain dehydrogenase; Provisional | 96.19 | |
| PRK06841 | 255 | short chain dehydrogenase; Provisional | 96.18 | |
| PRK06079 | 252 | enoyl-(acyl carrier protein) reductase; Provisiona | 96.17 | |
| PRK00094 | 325 | gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr | 96.17 | |
| PRK07825 | 273 | short chain dehydrogenase; Provisional | 96.16 | |
| PRK08303 | 305 | short chain dehydrogenase; Provisional | 96.14 | |
| PRK07340 | 304 | ornithine cyclodeaminase; Validated | 96.12 | |
| PRK05650 | 270 | short chain dehydrogenase; Provisional | 96.1 | |
| PRK12823 | 260 | benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat | 96.09 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 96.08 | |
| PRK06057 | 255 | short chain dehydrogenase; Provisional | 96.08 | |
| PRK08340 | 259 | glucose-1-dehydrogenase; Provisional | 96.08 | |
| PRK08936 | 261 | glucose-1-dehydrogenase; Provisional | 96.07 | |
| KOG0024 | 354 | consensus Sorbitol dehydrogenase [Secondary metabo | 96.07 | |
| PRK08278 | 273 | short chain dehydrogenase; Provisional | 96.07 | |
| PRK11880 | 267 | pyrroline-5-carboxylate reductase; Reviewed | 96.07 | |
| PRK10669 | 558 | putative cation:proton antiport protein; Provision | 96.06 | |
| PRK08226 | 263 | short chain dehydrogenase; Provisional | 96.06 | |
| PRK12748 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 96.02 | |
| KOG1201 | 300 | consensus Hydroxysteroid 17-beta dehydrogenase 11 | 96.02 | |
| TIGR01289 | 314 | LPOR light-dependent protochlorophyllide reductase | 96.01 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 96.01 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.01 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 96.01 | |
| PRK12743 | 256 | oxidoreductase; Provisional | 96.01 | |
| cd05292 | 308 | LDH_2 A subgroup of L-lactate dehydrogenases. L-la | 96.01 | |
| PRK12937 | 245 | short chain dehydrogenase; Provisional | 96.01 | |
| COG1893 | 307 | ApbA Ketopantoate reductase [Coenzyme metabolism] | 96.0 | |
| TIGR03325 | 262 | BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro | 96.0 | |
| PRK07791 | 286 | short chain dehydrogenase; Provisional | 96.0 | |
| PRK05653 | 246 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 95.99 | |
| PRK07502 | 307 | cyclohexadienyl dehydrogenase; Validated | 95.98 | |
| PRK08862 | 227 | short chain dehydrogenase; Provisional | 95.98 | |
| PRK08324 | 681 | short chain dehydrogenase; Validated | 95.97 | |
| PRK07454 | 241 | short chain dehydrogenase; Provisional | 95.97 | |
| PLN02206 | 442 | UDP-glucuronate decarboxylase | 95.96 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.92 | |
| PRK12938 | 246 | acetyacetyl-CoA reductase; Provisional | 95.91 | |
| PRK07904 | 253 | short chain dehydrogenase; Provisional | 95.91 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 95.9 | |
| PRK06141 | 314 | ornithine cyclodeaminase; Validated | 95.89 | |
| PF08659 | 181 | KR: KR domain; InterPro: IPR013968 This domain is | 95.89 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-depende | 95.86 | |
| PRK06200 | 263 | 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog | 95.86 | |
| TIGR01963 | 255 | PHB_DH 3-hydroxybutyrate dehydrogenase. This model | 95.84 | |
| PRK12828 | 239 | short chain dehydrogenase; Provisional | 95.84 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.81 | |
| KOG1205 | 282 | consensus Predicted dehydrogenase [Secondary metab | 95.81 | |
| cd00762 | 254 | NAD_bind_malic_enz NAD(P) binding domain of malic | 95.77 | |
| PRK08291 | 330 | ectoine utilization protein EutC; Validated | 95.77 | |
| PRK05786 | 238 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 95.77 | |
| PRK06505 | 271 | enoyl-(acyl carrier protein) reductase; Provisiona | 95.77 | |
| PRK13304 | 265 | L-aspartate dehydrogenase; Reviewed | 95.77 | |
| cd05313 | 254 | NAD_bind_2_Glu_DH NAD(P) binding domain of glutama | 95.76 | |
| PRK07792 | 306 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 95.76 | |
| PRK08690 | 261 | enoyl-(acyl carrier protein) reductase; Provisiona | 95.76 | |
| PRK08993 | 253 | 2-deoxy-D-gluconate 3-dehydrogenase; Validated | 95.75 | |
| PTZ00325 | 321 | malate dehydrogenase; Provisional | 95.75 | |
| PTZ00079 | 454 | NADP-specific glutamate dehydrogenase; Provisional | 95.75 | |
| PRK08415 | 274 | enoyl-(acyl carrier protein) reductase; Provisiona | 95.74 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 95.73 | |
| PRK05599 | 246 | hypothetical protein; Provisional | 95.73 | |
| PRK11908 | 347 | NAD-dependent epimerase/dehydratase family protein | 95.72 | |
| TIGR02415 | 254 | 23BDH acetoin reductases. One member of this famil | 95.72 | |
| PRK12827 | 249 | short chain dehydrogenase; Provisional | 95.72 | |
| TIGR01181 | 317 | dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This | 95.71 | |
| PRK15181 | 348 | Vi polysaccharide biosynthesis protein TviC; Provi | 95.69 | |
| PLN02780 | 320 | ketoreductase/ oxidoreductase | 95.68 | |
| PRK09072 | 263 | short chain dehydrogenase; Provisional | 95.68 | |
| PRK12936 | 245 | 3-ketoacyl-(acyl-carrier-protein) reductase NodG; | 95.67 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.67 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 95.67 | |
| PRK09135 | 249 | pteridine reductase; Provisional | 95.67 | |
| PRK07533 | 258 | enoyl-(acyl carrier protein) reductase; Provisiona | 95.67 | |
| PRK10217 | 355 | dTDP-glucose 4,6-dehydratase; Provisional | 95.67 | |
| TIGR01915 | 219 | npdG NADPH-dependent F420 reductase. This model re | 95.66 | |
| PRK07806 | 248 | short chain dehydrogenase; Provisional | 95.66 | |
| PRK07069 | 251 | short chain dehydrogenase; Validated | 95.66 | |
| PRK12859 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 95.66 | |
| PRK08267 | 260 | short chain dehydrogenase; Provisional | 95.66 | |
| PRK07832 | 272 | short chain dehydrogenase; Provisional | 95.65 | |
| TIGR02632 | 676 | RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc | 95.64 | |
| PF01113 | 124 | DapB_N: Dihydrodipicolinate reductase, N-terminus; | 95.64 | |
| PRK08159 | 272 | enoyl-(acyl carrier protein) reductase; Provisiona | 95.63 | |
| PRK10538 | 248 | malonic semialdehyde reductase; Provisional | 95.63 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 95.62 | |
| PRK07102 | 243 | short chain dehydrogenase; Provisional | 95.62 | |
| PRK06270 | 341 | homoserine dehydrogenase; Provisional | 95.61 | |
| PRK12746 | 254 | short chain dehydrogenase; Provisional | 95.61 | |
| PRK06398 | 258 | aldose dehydrogenase; Validated | 95.58 | |
| PRK12481 | 251 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 95.57 | |
| TIGR01202 | 308 | bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl | 95.56 | |
| PRK12935 | 247 | acetoacetyl-CoA reductase; Provisional | 95.56 | |
| PRK09880 | 343 | L-idonate 5-dehydrogenase; Provisional | 95.56 | |
| PRK06720 | 169 | hypothetical protein; Provisional | 95.55 | |
| COG0039 | 313 | Mdh Malate/lactate dehydrogenases [Energy producti | 95.55 | |
| PRK07680 | 273 | late competence protein ComER; Validated | 95.54 | |
| COG1062 | 366 | AdhC Zn-dependent alcohol dehydrogenases, class II | 95.54 | |
| PRK08229 | 341 | 2-dehydropantoate 2-reductase; Provisional | 95.53 | |
| cd01339 | 300 | LDH-like_MDH L-lactate dehydrogenase-like malate d | 95.52 | |
| PF01408 | 120 | GFO_IDH_MocA: Oxidoreductase family, NAD-binding R | 95.52 | |
| PRK07856 | 252 | short chain dehydrogenase; Provisional | 95.51 | |
| PRK05557 | 248 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 95.51 | |
| PRK06129 | 308 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 95.51 | |
| PRK15461 | 296 | NADH-dependent gamma-hydroxybutyrate dehydrogenase | 95.5 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 95.5 | |
| PRK06947 | 248 | glucose-1-dehydrogenase; Provisional | 95.48 | |
| TIGR00715 | 256 | precor6x_red precorrin-6x reductase. This enzyme w | 95.47 | |
| PRK12745 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 95.46 | |
| KOG0022 | 375 | consensus Alcohol dehydrogenase, class III [Second | 95.42 | |
| KOG1208 | 314 | consensus Dehydrogenases with different specificit | 95.42 | |
| TIGR01759 | 323 | MalateDH-SF1 malate dehydrogenase. This model repr | 95.42 | |
| PRK09310 | 477 | aroDE bifunctional 3-dehydroquinate dehydratase/sh | 95.38 | |
| PRK09134 | 258 | short chain dehydrogenase; Provisional | 95.37 | |
| PRK06128 | 300 | oxidoreductase; Provisional | 95.37 | |
| PRK10675 | 338 | UDP-galactose-4-epimerase; Provisional | 95.34 | |
| PRK06701 | 290 | short chain dehydrogenase; Provisional | 95.34 | |
| PRK06545 | 359 | prephenate dehydrogenase; Validated | 95.34 | |
| PLN02166 | 436 | dTDP-glucose 4,6-dehydratase | 95.34 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 95.33 | |
| PRK10537 | 393 | voltage-gated potassium channel; Provisional | 95.33 | |
| PRK12921 | 305 | 2-dehydropantoate 2-reductase; Provisional | 95.29 | |
| PRK08264 | 238 | short chain dehydrogenase; Validated | 95.28 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 95.27 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 95.27 | |
| PRK07634 | 245 | pyrroline-5-carboxylate reductase; Reviewed | 95.27 | |
| PRK09987 | 299 | dTDP-4-dehydrorhamnose reductase; Provisional | 95.25 | |
| PRK06603 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 95.24 | |
| PLN02653 | 340 | GDP-mannose 4,6-dehydratase | 95.22 | |
| PRK09730 | 247 | putative NAD(P)-binding oxidoreductase; Provisiona | 95.21 | |
| PRK11559 | 296 | garR tartronate semialdehyde reductase; Provisiona | 95.21 | |
| PRK12550 | 272 | shikimate 5-dehydrogenase; Reviewed | 95.21 | |
| PRK07985 | 294 | oxidoreductase; Provisional | 95.21 | |
| PRK07775 | 274 | short chain dehydrogenase; Provisional | 95.17 | |
| TIGR02279 | 503 | PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa | 95.16 | |
| PRK13302 | 271 | putative L-aspartate dehydrogenase; Provisional | 95.15 | |
| TIGR01505 | 291 | tartro_sem_red 2-hydroxy-3-oxopropionate reductase | 95.14 | |
| PRK07889 | 256 | enoyl-(acyl carrier protein) reductase; Provisiona | 95.13 | |
| cd02201 | 304 | FtsZ_type1 FtsZ is a GTPase that is similar to the | 95.11 | |
| PRK08374 | 336 | homoserine dehydrogenase; Provisional | 95.11 | |
| TIGR01472 | 343 | gmd GDP-mannose 4,6-dehydratase. Excluded from thi | 95.1 | |
| PRK12491 | 272 | pyrroline-5-carboxylate reductase; Reviewed | 95.09 | |
| PRK08220 | 252 | 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | 95.09 | |
| PLN02572 | 442 | UDP-sulfoquinovose synthase | 95.09 | |
| PRK07201 | 657 | short chain dehydrogenase; Provisional | 95.09 | |
| cd00650 | 263 | LDH_MDH_like NAD-dependent, lactate dehydrogenase- | 95.07 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 95.07 | |
| PRK08642 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 95.06 | |
| PRK14618 | 328 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 95.06 | |
| COG0281 | 432 | SfcA Malic enzyme [Energy production and conversio | 95.05 | |
| PRK07370 | 258 | enoyl-(acyl carrier protein) reductase; Validated | 95.04 | |
| PRK10084 | 352 | dTDP-glucose 4,6 dehydratase; Provisional | 95.0 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 94.99 | |
| PLN02688 | 266 | pyrroline-5-carboxylate reductase | 94.95 | |
| PLN02657 | 390 | 3,8-divinyl protochlorophyllide a 8-vinyl reductas | 94.94 | |
| TIGR03466 | 328 | HpnA hopanoid-associated sugar epimerase. The sequ | 94.94 | |
| PRK07679 | 279 | pyrroline-5-carboxylate reductase; Reviewed | 94.92 | |
| PRK14031 | 444 | glutamate dehydrogenase; Provisional | 94.91 | |
| COG1023 | 300 | Gnd Predicted 6-phosphogluconate dehydrogenase [Ca | 94.91 | |
| PRK06476 | 258 | pyrroline-5-carboxylate reductase; Reviewed | 94.91 | |
| KOG0069 | 336 | consensus Glyoxylate/hydroxypyruvate reductase (D- | 94.89 | |
| PF03949 | 255 | Malic_M: Malic enzyme, NAD binding domain; InterPr | 94.84 | |
| PRK02006 | 498 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.82 | |
| PRK14030 | 445 | glutamate dehydrogenase; Provisional | 94.81 | |
| PF10727 | 127 | Rossmann-like: Rossmann-like domain; InterPro: IPR | 94.81 | |
| PRK08268 | 507 | 3-hydroxy-acyl-CoA dehydrogenase; Validated | 94.77 | |
| PLN02695 | 370 | GDP-D-mannose-3',5'-epimerase | 94.76 | |
| smart00846 | 149 | Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, | 94.76 | |
| PF02571 | 249 | CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: | 94.73 | |
| PRK15059 | 292 | tartronate semialdehyde reductase; Provisional | 94.72 | |
| TIGR01179 | 328 | galE UDP-glucose-4-epimerase. This enzyme intercon | 94.72 | |
| PRK01710 | 458 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.71 | |
| PRK06182 | 273 | short chain dehydrogenase; Validated | 94.71 | |
| PRK02705 | 459 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.7 | |
| PRK06171 | 266 | sorbitol-6-phosphate 2-dehydrogenase; Provisional | 94.7 | |
| PRK11730 | 715 | fadB multifunctional fatty acid oxidation complex | 94.7 | |
| PRK11199 | 374 | tyrA bifunctional chorismate mutase/prephenate deh | 94.69 | |
| cd08230 | 355 | glucose_DH Glucose dehydrogenase. Glucose dehydrog | 94.68 | |
| PLN02896 | 353 | cinnamyl-alcohol dehydrogenase | 94.68 | |
| PRK06123 | 248 | short chain dehydrogenase; Provisional | 94.67 | |
| PLN03075 | 296 | nicotianamine synthase; Provisional | 94.67 | |
| cd05296 | 419 | GH4_P_beta_glucosidase Glycoside Hydrolases Family | 94.65 | |
| TIGR01850 | 346 | argC N-acetyl-gamma-glutamyl-phosphate reductase, | 94.65 | |
| PRK07060 | 245 | short chain dehydrogenase; Provisional | 94.64 | |
| PRK13018 | 378 | cell division protein FtsZ; Provisional | 94.62 | |
| PRK14620 | 326 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 94.62 | |
| PRK08703 | 239 | short chain dehydrogenase; Provisional | 94.61 | |
| TIGR01771 | 299 | L-LDH-NAD L-lactate dehydrogenase. This model repr | 94.61 | |
| PRK02472 | 447 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.6 | |
| TIGR01500 | 256 | sepiapter_red sepiapterin reductase. This model de | 94.58 | |
| PRK08655 | 437 | prephenate dehydrogenase; Provisional | 94.57 | |
| TIGR01757 | 387 | Malate-DH_plant malate dehydrogenase, NADP-depende | 94.57 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 94.56 | |
| PRK06463 | 255 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 94.54 | |
| PRK08125 | 660 | bifunctional UDP-glucuronic acid decarboxylase/UDP | 94.54 | |
| TIGR01214 | 287 | rmlD dTDP-4-dehydrorhamnose reductase. This enzyme | 94.51 | |
| PLN02256 | 304 | arogenate dehydrogenase | 94.46 | |
| PRK12439 | 341 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 94.46 | |
| PLN02650 | 351 | dihydroflavonol-4-reductase | 94.43 | |
| KOG1200 | 256 | consensus Mitochondrial/plastidial beta-ketoacyl-A | 94.43 | |
| PLN02214 | 342 | cinnamoyl-CoA reductase | 94.42 | |
| PRK11154 | 708 | fadJ multifunctional fatty acid oxidation complex | 94.39 | |
| PRK12824 | 245 | acetoacetyl-CoA reductase; Provisional | 94.39 | |
| PRK13303 | 265 | L-aspartate dehydrogenase; Provisional | 94.37 | |
| TIGR01373 | 407 | soxB sarcosine oxidase, beta subunit family, heter | 94.36 | |
| PLN02662 | 322 | cinnamyl-alcohol dehydrogenase family protein | 94.36 | |
| TIGR03451 | 358 | mycoS_dep_FDH mycothiol-dependent formaldehyde deh | 94.35 | |
| PRK13403 | 335 | ketol-acid reductoisomerase; Provisional | 94.35 | |
| PRK06997 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 94.33 | |
| PRK05993 | 277 | short chain dehydrogenase; Provisional | 94.32 | |
| TIGR01692 | 288 | HIBADH 3-hydroxyisobutyrate dehydrogenase. This en | 94.3 | |
| COG0665 | 387 | DadA Glycine/D-amino acid oxidases (deaminating) [ | 94.29 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 94.28 | |
| PRK06179 | 270 | short chain dehydrogenase; Provisional | 94.26 | |
| cd08239 | 339 | THR_DH_like L-threonine dehydrogenase (TDH)-like. | 94.25 | |
| PRK06077 | 252 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 94.22 | |
| PRK05884 | 223 | short chain dehydrogenase; Provisional | 94.22 | |
| PRK06392 | 326 | homoserine dehydrogenase; Provisional | 94.21 | |
| PRK08261 | 450 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 94.19 | |
| PRK12742 | 237 | oxidoreductase; Provisional | 94.19 | |
| PRK14982 | 340 | acyl-ACP reductase; Provisional | 94.18 | |
| PLN02989 | 325 | cinnamyl-alcohol dehydrogenase family protein | 94.17 | |
| TIGR01829 | 242 | AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy | 94.16 | |
| COG4221 | 246 | Short-chain alcohol dehydrogenase of unknown speci | 94.15 | |
| PRK09330 | 384 | cell division protein FtsZ; Validated | 94.15 | |
| PRK06928 | 277 | pyrroline-5-carboxylate reductase; Reviewed | 94.15 | |
| cd05312 | 279 | NAD_bind_1_malic_enz NAD(P) binding domain of mali | 94.12 | |
| TIGR03026 | 411 | NDP-sugDHase nucleotide sugar dehydrogenase. All o | 94.1 | |
| COG1712 | 255 | Predicted dinucleotide-utilizing enzyme [General f | 94.1 | |
| TIGR02437 | 714 | FadB fatty oxidation complex, alpha subunit FadB. | 94.08 | |
| PLN02366 | 308 | spermidine synthase | 94.08 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 94.04 | |
| PRK06035 | 291 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 94.01 | |
| PTZ00345 | 365 | glycerol-3-phosphate dehydrogenase; Provisional | 93.99 | |
| PLN00198 | 338 | anthocyanidin reductase; Provisional | 93.96 | |
| PLN00016 | 378 | RNA-binding protein; Provisional | 93.93 | |
| PRK08057 | 248 | cobalt-precorrin-6x reductase; Reviewed | 93.91 | |
| COG2084 | 286 | MmsB 3-hydroxyisobutyrate dehydrogenase and relate | 93.91 | |
| cd05298 | 437 | GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; | 93.88 | |
| PLN02740 | 381 | Alcohol dehydrogenase-like | 93.85 | |
| TIGR00036 | 266 | dapB dihydrodipicolinate reductase. | 93.84 | |
| PRK11150 | 308 | rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro | 93.83 | |
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 93.82 | |
| PRK06483 | 236 | dihydromonapterin reductase; Provisional | 93.81 | |
| TIGR00065 | 349 | ftsZ cell division protein FtsZ. This family consi | 93.81 | |
| TIGR02197 | 314 | heptose_epim ADP-L-glycero-D-manno-heptose-6-epime | 93.78 | |
| PRK15076 | 431 | alpha-galactosidase; Provisional | 93.78 | |
| PLN02520 | 529 | bifunctional 3-dehydroquinate dehydratase/shikimat | 93.78 | |
| PRK06482 | 276 | short chain dehydrogenase; Provisional | 93.76 | |
| PF01370 | 236 | Epimerase: NAD dependent epimerase/dehydratase fam | 93.74 | |
| PRK08263 | 275 | short chain dehydrogenase; Provisional | 93.73 | |
| cd05197 | 425 | GH4_glycoside_hydrolases Glycoside Hydrases Family | 93.72 | |
| TIGR01772 | 312 | MDH_euk_gproteo malate dehydrogenase, NAD-dependen | 93.67 | |
| PRK04308 | 445 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 93.66 | |
| PLN00106 | 323 | malate dehydrogenase | 93.65 | |
| TIGR01830 | 239 | 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re | 93.65 | |
| PRK06249 | 313 | 2-dehydropantoate 2-reductase; Provisional | 93.64 | |
| TIGR01763 | 305 | MalateDH_bact malate dehydrogenase, NAD-dependent. | 93.64 | |
| PRK09291 | 257 | short chain dehydrogenase; Provisional | 93.62 | |
| PRK06199 | 379 | ornithine cyclodeaminase; Validated | 93.62 | |
| PRK03803 | 448 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 93.59 | |
| PRK12747 | 252 | short chain dehydrogenase; Provisional | 93.59 | |
| PRK06180 | 277 | short chain dehydrogenase; Provisional | 93.57 | |
| PF01266 | 358 | DAO: FAD dependent oxidoreductase; InterPro: IPR00 | 93.56 | |
| TIGR03376 | 342 | glycerol3P_DH glycerol-3-phosphate dehydrogenase ( | 93.52 | |
| PRK12480 | 330 | D-lactate dehydrogenase; Provisional | 93.51 | |
| TIGR02441 | 737 | fa_ox_alpha_mit fatty acid oxidation complex, alph | 93.48 | |
| PRK13243 | 333 | glyoxylate reductase; Reviewed | 93.45 | |
| PRK05693 | 274 | short chain dehydrogenase; Provisional | 93.45 | |
| PLN02852 | 491 | ferredoxin-NADP+ reductase | 93.45 | |
| PRK12409 | 410 | D-amino acid dehydrogenase small subunit; Provisio | 93.43 | |
| PLN02260 | 668 | probable rhamnose biosynthetic enzyme | 93.43 | |
| PF02558 | 151 | ApbA: Ketopantoate reductase PanE/ApbA; InterPro: | 93.41 | |
| cd01337 | 310 | MDH_glyoxysomal_mitochondrial Glyoxysomal and mito | 93.38 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 93.38 | |
| PRK12367 | 245 | short chain dehydrogenase; Provisional | 93.35 | |
| PRK13301 | 267 | putative L-aspartate dehydrogenase; Provisional | 93.33 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 93.32 | |
| smart00822 | 180 | PKS_KR This enzymatic domain is part of bacterial | 93.31 | |
| PRK08818 | 370 | prephenate dehydrogenase; Provisional | 93.31 | |
| PRK06523 | 260 | short chain dehydrogenase; Provisional | 93.31 | |
| PLN02712 | 667 | arogenate dehydrogenase | 93.29 | |
| PRK08177 | 225 | short chain dehydrogenase; Provisional | 93.29 | |
| PF05368 | 233 | NmrA: NmrA-like family; InterPro: IPR008030 NmrA i | 93.29 | |
| PF01494 | 356 | FAD_binding_3: FAD binding domain; InterPro: IPR00 | 93.28 | |
| TIGR02818 | 368 | adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr | 93.27 | |
| COG1064 | 339 | AdhP Zn-dependent alcohol dehydrogenases [General | 93.25 | |
| cd08281 | 371 | liver_ADH_like1 Zinc-dependent alcohol dehydrogena | 93.24 | |
| PRK11259 | 376 | solA N-methyltryptophan oxidase; Provisional | 93.22 | |
| PRK00676 | 338 | hemA glutamyl-tRNA reductase; Validated | 93.21 | |
| PRK05479 | 330 | ketol-acid reductoisomerase; Provisional | 93.17 | |
| PRK08040 | 336 | putative semialdehyde dehydrogenase; Provisional | 93.16 | |
| COG1250 | 307 | FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo | 93.14 |
| >KOG2336 consensus Molybdopterin biosynthesis-related protein [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.1e-46 Score=314.70 Aligned_cols=220 Identities=68% Similarity=1.045 Sum_probs=196.5
Q ss_pred CHHHHHHHHHHHHHhhhcCCCCchhHhHHHHHHHHHHhhhhhhhhhhhhcccccCCcccccCCchhHHHhhhhcChhHHH
Q 026893 1 MEAELKDMIDDLESLKRSLPDSSLHASIDKLELRVENLTKMAMSATARRSKVKDMSSEVVDSNPYSRLMALQRMGIVENY 80 (231)
Q Consensus 1 ~~~~~~~~~~~~~~~~~~~p~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~Rq~~l~~~g~~~~~ 80 (231)
|+.-.+++.++|+.|.+.+.+.-. ..++.+.........++.|..|.|+.++|.|++|++||||.|+|.||||+..+
T Consensus 1 ~~~~~~~l~~~ld~l~~~l~d~~~---~~~~e~~~~~~~t~~~~~p~~R~kieklSsEVVDSNPYSRLMALqRMgIV~dY 77 (422)
T KOG2336|consen 1 MEVGFKALLDDLDVLQKRLSDLKL---ELKLESSSENLATLSKCNPHRRSKIEKLSSEVVDSNPYSRLMALQRMGIVDDY 77 (422)
T ss_pred CchhHHHHHHHHHHHHHHhhhhhh---hccccccccCcccCCCCCchhhHHHHHhhhhHhcCChHHHHHHHHHhcchhhH
Confidence 677788899999988888665321 22333333333333445578899999999999999999999999999999999
Q ss_pred HHHhcCcEEEEecCchHHHHHHHHHHhcCceEEEEeCCccccccccccCCCcCccCCcHHHHHHHHHHhhCCCcEEEEEe
Q 026893 81 ERIREFSVAIVGVGGVGSVAAEMLTRCGIGRLLLYDYDKVELANMNRLFFRPEQVGMTKTDAAVQTLADINPDVVLESFT 160 (231)
Q Consensus 81 ~kl~~~~V~IvG~GgvGs~ia~~La~~Gv~~i~LiD~D~v~~~Nl~R~~~~~~dvG~~Ka~~~~~~l~~~np~v~v~~~~ 160 (231)
+||+.+.|+|||.||+||.+|++|.|||+|++.|+|+|.|+..|+||.||.|++.|.+|++++...|..+||+|.++.|+
T Consensus 78 ErIR~~aVAiVGvGGVGSV~AeMLTRCGIGkLlLfDYDkVElANMNRLFf~P~QaGlsKv~AA~~TL~~iNPDV~iE~hn 157 (422)
T KOG2336|consen 78 ERIREFAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPDQAGLSKVDAAVQTLAEINPDVVIEVHN 157 (422)
T ss_pred HHHhhheeEEEecCchhHHHHHHHHhcCcceEEEeecchhhhhcccccccCcccccchHHHHHHHHHHhcCCCeEEEEee
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ecccCccchHHHHhhhhccCCCCCCCCCCCcEEEEccCCHHHHHHHHHHHHHcCCcEEEeCccCce
Q 026893 161 LNITTVQGFETFMSSLRNKSFRPSKEGSGVDLVLSCVDNYEARMAVNQACNELNQTWMESGKQSSS 226 (231)
Q Consensus 161 ~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~DiVi~~~D~~~~r~~i~~~~~~~~~p~i~~g~~g~~ 226 (231)
++|++.++++.|.+.|+.+++- ..++.|+|+.|+||+++|+.||.+|.+.+..|+++|++++.
T Consensus 158 ~NITTvenFd~F~~~is~g~~~---~gkpvDLVLSCVDNfEARMavN~ACNE~~q~WmESGVSEnA 220 (422)
T KOG2336|consen 158 YNITTVENFDTFTDRISNGSLC---PGKPVDLVLSCVDNFEARMAVNQACNELNQTWMESGVSENA 220 (422)
T ss_pred cceeeehhHHHHHHHhhcCCCC---CCCcceEEeeehhhHHHHHHHHHHHHHhhhHHHHccCcccc
Confidence 9999999999999999998842 45679999999999999999999999999999999998764
|
|
| >PRK06153 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >PRK05690 molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >PRK08223 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PRK08328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07411 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >PRK15116 sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >PRK14851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like | Back alignment and domain information |
|---|
| >COG0476 ThiF Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR01408 Ube1 ubiquitin-activating enzyme E1 | Back alignment and domain information |
|---|
| >TIGR01408 Ube1 ubiquitin-activating enzyme E1 | Back alignment and domain information |
|---|
| >KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14852 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >PRK07877 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 | Back alignment and domain information |
|---|
| >cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 | Back alignment and domain information |
|---|
| >TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p | Back alignment and domain information |
|---|
| >KOG2013 consensus SMT3/SUMO-activating complex, catalytic component UBA2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01487 E1_ThiF_like E1_ThiF_like | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively | Back alignment and domain information |
|---|
| >KOG2014 consensus SMT3/SUMO-activating complex, AOS1/RAD31 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein | Back alignment and domain information |
|---|
| >TIGR03603 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehydratase, SagC family | Back alignment and domain information |
|---|
| >PTZ00245 ubiquitin activating enzyme; Provisional | Back alignment and domain information |
|---|
| >KOG2015 consensus NEDD8-activating complex, catalytic component UBA3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2018 consensus Predicted dinucleotide-utilizing enzyme involved in molybdopterin and thiamine biosynthesis [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2012 consensus Ubiquitin activating enzyme UBA1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2012 consensus Ubiquitin activating enzyme UBA1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2016 consensus NEDD8-activating complex, APP-BP1/UBA5 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2337 consensus Ubiquitin activating E1 enzyme-like protein [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein | Back alignment and domain information |
|---|
| >COG4015 Predicted dinucleotide-utilizing enzyme of the ThiF/HesA family [General function prediction only] | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14027 quinate/shikimate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK10637 cysG siroheme synthase; Provisional | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00142 6-phosphogluconate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03882 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydratase domain | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13940 glutamyl-tRNA reductase; Provisional | Back alignment and domain information |
|---|
| >KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PRK12749 quinate/shikimate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PLN02350 phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK08251 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating | Back alignment and domain information |
|---|
| >cd05290 LDH_3 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05875 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase | Back alignment and domain information |
|---|
| >PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional | Back alignment and domain information |
|---|
| >PRK05867 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK06194 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08339 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08213 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06949 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PRK07478 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >PRK09186 flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >PRK12939 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK06138 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases | Back alignment and domain information |
|---|
| >PRK05866 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06139 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK06940 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PRK05708 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 | Back alignment and domain information |
|---|
| >cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK05876 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13394 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08277 D-mannonate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12429 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN00203 glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PRK06198 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >PRK08063 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02253 xanthoxin dehydrogenase | Back alignment and domain information |
|---|
| >PRK07774 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06196 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07453 protochlorophyllide oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PRK06124 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06172 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >PRK05872 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08085 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05293 LDH_1 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK08643 acetoin reductase; Validated | Back alignment and domain information |
|---|
| >PRK06181 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08265 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08589 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional | Back alignment and domain information |
|---|
| >TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK07576 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK06125 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00045 hemA glutamyl-tRNA reductase; Reviewed | Back alignment and domain information |
|---|
| >cd00300 LDH_like L-lactate dehydrogenase-like enzymes | Back alignment and domain information |
|---|
| >PRK07814 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02427 UDP-apiose/xylose synthase | Back alignment and domain information |
|---|
| >PRK06500 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12829 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK07035 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07326 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07097 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00048 dihydrodipicolinate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07677 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08618 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06522 2-dehydropantoate 2-reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02602 lactate dehydrogenase | Back alignment and domain information |
|---|
| >PRK07024 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08594 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12744 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06914 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK07890 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07109 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07067 sorbitol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07074 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02240 UDP-glucose 4-epimerase | Back alignment and domain information |
|---|
| >PRK07984 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02992 ectoine_eutC ectoine utilization protein EutC | Back alignment and domain information |
|---|
| >PRK05717 oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK06223 malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08309 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08628 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06114 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06841 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06079 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07825 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08303 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07340 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK05650 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PRK06057 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08340 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08936 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK08278 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11880 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK10669 putative cation:proton antiport protein; Provisional | Back alignment and domain information |
|---|
| >PRK08226 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR01289 LPOR light-dependent protochlorophyllide reductase | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12743 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd05292 LDH_2 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK12937 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase | Back alignment and domain information |
|---|
| >PRK07791 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK07502 cyclohexadienyl dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08862 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08324 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07454 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02206 UDP-glucuronate decarboxylase | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12938 acetyacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07904 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >PRK06141 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain | Back alignment and domain information |
|---|
| >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase | Back alignment and domain information |
|---|
| >PRK12828 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme | Back alignment and domain information |
|---|
| >PRK08291 ectoine utilization protein EutC; Validated | Back alignment and domain information |
|---|
| >PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06505 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK13304 L-aspartate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 | Back alignment and domain information |
|---|
| >PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08690 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PTZ00325 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00079 NADP-specific glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08415 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PRK05599 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02415 23BDH acetoin reductases | Back alignment and domain information |
|---|
| >PRK12827 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional | Back alignment and domain information |
|---|
| >PLN02780 ketoreductase/ oxidoreductase | Back alignment and domain information |
|---|
| >PRK09072 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >PRK09135 pteridine reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07533 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK10217 dTDP-glucose 4,6-dehydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR01915 npdG NADPH-dependent F420 reductase | Back alignment and domain information |
|---|
| >PRK07806 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07069 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08267 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07832 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] | Back alignment and domain information |
|---|
| >PRK08159 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK10538 malonic semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >PRK07102 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06270 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12746 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06398 aldose dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase | Back alignment and domain information |
|---|
| >PRK12935 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09880 L-idonate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06720 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07680 late competence protein ComER; Validated | Back alignment and domain information |
|---|
| >COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK08229 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins | Back alignment and domain information |
|---|
| >PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot | Back alignment and domain information |
|---|
| >PRK07856 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06947 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00715 precor6x_red precorrin-6x reductase | Back alignment and domain information |
|---|
| >PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR01759 MalateDH-SF1 malate dehydrogenase | Back alignment and domain information |
|---|
| >PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed | Back alignment and domain information |
|---|
| >PRK09134 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06128 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK10675 UDP-galactose-4-epimerase; Provisional | Back alignment and domain information |
|---|
| >PRK06701 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06545 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02166 dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >PRK10537 voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
| >PRK12921 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08264 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK07634 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06603 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02653 GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK09730 putative NAD(P)-binding oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK11559 garR tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12550 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07985 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07775 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC | Back alignment and domain information |
|---|
| >PRK13302 putative L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase | Back alignment and domain information |
|---|
| >PRK07889 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >cd02201 FtsZ_type1 FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes | Back alignment and domain information |
|---|
| >PRK08374 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01472 gmd GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK12491 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02572 UDP-sulfoquinovose synthase | Back alignment and domain information |
|---|
| >PRK07201 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0281 SfcA Malic enzyme [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07370 enoyl-(acyl carrier protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK10084 dTDP-glucose 4,6 dehydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PLN02688 pyrroline-5-carboxylate reductase | Back alignment and domain information |
|---|
| >PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >TIGR03466 HpnA hopanoid-associated sugar epimerase | Back alignment and domain information |
|---|
| >PRK07679 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK14031 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06476 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e | Back alignment and domain information |
|---|
| >PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK14030 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02695 GDP-D-mannose-3',5'-epimerase | Back alignment and domain information |
|---|
| >smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >PF02571 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: IPR003723 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt | Back alignment and domain information |
|---|
| >PRK15059 tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01179 galE UDP-glucose-4-epimerase | Back alignment and domain information |
|---|
| >PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06182 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08230 glucose_DH Glucose dehydrogenase | Back alignment and domain information |
|---|
| >PLN02896 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK06123 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN03075 nicotianamine synthase; Provisional | Back alignment and domain information |
|---|
| >cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase | Back alignment and domain information |
|---|
| >TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form | Back alignment and domain information |
|---|
| >PRK07060 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13018 cell division protein FtsZ; Provisional | Back alignment and domain information |
|---|
| >PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08703 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01771 L-LDH-NAD L-lactate dehydrogenase | Back alignment and domain information |
|---|
| >PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR01500 sepiapter_red sepiapterin reductase | Back alignment and domain information |
|---|
| >PRK08655 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase | Back alignment and domain information |
|---|
| >PLN02256 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02650 dihydroflavonol-4-reductase | Back alignment and domain information |
|---|
| >KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02214 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK12824 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK13303 L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >PLN02662 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase | Back alignment and domain information |
|---|
| >PRK13403 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK06997 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05993 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase | Back alignment and domain information |
|---|
| >COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >PRK06179 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like | Back alignment and domain information |
|---|
| >PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05884 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06392 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12742 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK14982 acyl-ACP reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02989 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase | Back alignment and domain information |
|---|
| >COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09330 cell division protein FtsZ; Validated | Back alignment and domain information |
|---|
| >PRK06928 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 | Back alignment and domain information |
|---|
| >TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase | Back alignment and domain information |
|---|
| >COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02437 FadB fatty oxidation complex, alpha subunit FadB | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN00198 anthocyanidin reductase; Provisional | Back alignment and domain information |
|---|
| >PLN00016 RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK08057 cobalt-precorrin-6x reductase; Reviewed | Back alignment and domain information |
|---|
| >COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases | Back alignment and domain information |
|---|
| >PLN02740 Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
| >TIGR00036 dapB dihydrodipicolinate reductase | Back alignment and domain information |
|---|
| >PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06483 dihydromonapterin reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR00065 ftsZ cell division protein FtsZ | Back alignment and domain information |
|---|
| >TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase | Back alignment and domain information |
|---|
| >PRK15076 alpha-galactosidase; Provisional | Back alignment and domain information |
|---|
| >PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PRK06482 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor | Back alignment and domain information |
|---|
| >PRK08263 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 | Back alignment and domain information |
|---|
| >TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN00106 malate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase | Back alignment and domain information |
|---|
| >PRK06249 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >PRK09291 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06199 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12747 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06180 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 | Back alignment and domain information |
|---|
| >TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) | Back alignment and domain information |
|---|
| >PRK12480 D-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial | Back alignment and domain information |
|---|
| >PRK13243 glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK05693 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02852 ferredoxin-NADP+ reductase | Back alignment and domain information |
|---|
| >PRK12409 D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >PLN02260 probable rhamnose biosynthetic enzyme | Back alignment and domain information |
|---|
| >PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 | Back alignment and domain information |
|---|
| >cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >PRK12367 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13301 putative L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain | Back alignment and domain information |
|---|
| >PRK08818 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06523 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PRK08177 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA | Back alignment and domain information |
|---|
| >PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways | Back alignment and domain information |
|---|
| >TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | Back alignment and domain information |
|---|
| >COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) | Back alignment and domain information |
|---|
| >PRK11259 solA N-methyltryptophan oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK00676 hemA glutamyl-tRNA reductase; Validated | Back alignment and domain information |
|---|
| >PRK05479 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK08040 putative semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 231 | ||||
| 3guc_A | 292 | Human Ubiquitin-Activating Enzyme 5 In Complex With | 4e-50 | ||
| 1zfn_A | 253 | Structural Analysis Of Escherichia Coli Thif Length | 7e-08 | ||
| 1zud_1 | 251 | Structure Of This-Thif Protein Complex Length = 251 | 7e-08 | ||
| 3cmm_A | 1015 | Crystal Structure Of The Uba1-Ubiquitin Complex Len | 3e-07 | ||
| 4ii2_A | 1001 | Crystal Structure Of Ubiquitin Activating Enzyme 1 | 5e-07 | ||
| 1jwb_B | 249 | Structure Of The Covalent Acyl-Adenylate Form Of Th | 1e-04 |
| >pdb|3GUC|A Chain A, Human Ubiquitin-Activating Enzyme 5 In Complex With Amppnp Length = 292 | Back alignment and structure |
|
| >pdb|1ZFN|A Chain A, Structural Analysis Of Escherichia Coli Thif Length = 253 | Back alignment and structure |
| >pdb|1ZUD|1 Chain 1, Structure Of This-Thif Protein Complex Length = 251 | Back alignment and structure |
| >pdb|3CMM|A Chain A, Crystal Structure Of The Uba1-Ubiquitin Complex Length = 1015 | Back alignment and structure |
| >pdb|4II2|A Chain A, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 1001 | Back alignment and structure |
| >pdb|1JWB|B Chain B, Structure Of The Covalent Acyl-Adenylate Form Of The Moeb-Moad Protein Complex Length = 249 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 231 | |||
| 3h8v_A | 292 | Ubiquitin-like modifier-activating enzyme 5; rossm | 1e-68 | |
| 1zud_1 | 251 | Adenylyltransferase THIF; thiamin, thiazole, prote | 2e-28 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 4e-28 | |
| 3h5n_A | 353 | MCCB protein; ubiquitin-activating enzyme, microci | 4e-27 | |
| 3rui_A | 340 | Ubiquitin-like modifier-activating enzyme ATG7; au | 3e-26 | |
| 3vh1_A | 598 | Ubiquitin-like modifier-activating enzyme ATG7; au | 2e-25 | |
| 1y8q_B | 640 | Anthracycline-, ubiquitin-like 2 activating enzyme | 6e-25 | |
| 1y8q_A | 346 | Ubiquitin-like 1 activating enzyme E1A; SUMO, hete | 2e-21 | |
| 1tt5_B | 434 | Ubiquitin-activating enzyme E1C isoform 1; cell cy | 9e-21 | |
| 3cmm_A | 1015 | Ubiquitin-activating enzyme E1 1; UBA1, protein tu | 1e-20 | |
| 3cmm_A | 1015 | Ubiquitin-activating enzyme E1 1; UBA1, protein tu | 3e-15 | |
| 1tt5_A | 531 | APPBP1, amyloid protein-binding protein 1; cell cy | 3e-17 | |
| 2nvu_B | 805 | Maltose binding protein/NEDD8-activating enzyme E1 | 8e-16 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-06 | |
| 1qzv_F | 154 | Plant photosystem I: subunit PSAF; photosynthesis, | 6e-05 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 8e-05 |
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Length = 292 | Back alignment and structure |
|---|
Score = 211 bits (540), Expect = 1e-68
Identities = 105/157 (66%), Positives = 122/157 (77%), Gaps = 3/157 (1%)
Query: 65 YSRLMALQRMGIVENYERIREFSVAIVGVGGVGSVAAEMLTRCGIGRLLLYDYDKVELAN 124
MAL+RMGIV +YE+IR F+VAIVGVGGVGSV AEMLTRCGIG+LLL+DYDKVELAN
Sbjct: 16 PRGSMALKRMGIVSDYEKIRTFAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELAN 75
Query: 125 MNRLFFRPEQVGMTKTDAAVQTLADINPDVVLESFTLNITTVQGFETFMSSLRNKSFRPS 184
MNRLFF+P Q G++K AA TL +INPDV+ E NITTV+ F+ FM + N
Sbjct: 76 MNRLFFQPHQAGLSKVQAAEHTLRNINPDVLFEVHNYNITTVENFQHFMDRISNGG---L 132
Query: 185 KEGSGVDLVLSCVDNYEARMAVNQACNELNQTWMESG 221
+EG VDLVLSCVDN+EARM +N ACNEL QTWMESG
Sbjct: 133 EEGKPVDLVLSCVDNFEARMTINTACNELGQTWMESG 169
|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Length = 251 | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Length = 249 | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Length = 353 | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Length = 340 | Back alignment and structure |
|---|
| >3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Length = 598 | Back alignment and structure |
|---|
| >1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Length = 640 | Back alignment and structure |
|---|
| >1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Length = 346 | Back alignment and structure |
|---|
| >1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Length = 434 | Back alignment and structure |
|---|
| >3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 | Back alignment and structure |
|---|
| >3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 | Back alignment and structure |
|---|
| >1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Length = 531 | Back alignment and structure |
|---|
| >2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Length = 805 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Length = 118 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 231 | |||
| 3h8v_A | 292 | Ubiquitin-like modifier-activating enzyme 5; rossm | 100.0 | |
| 1y8q_A | 346 | Ubiquitin-like 1 activating enzyme E1A; SUMO, hete | 100.0 | |
| 1zud_1 | 251 | Adenylyltransferase THIF; thiamin, thiazole, prote | 100.0 | |
| 1tt5_A | 531 | APPBP1, amyloid protein-binding protein 1; cell cy | 100.0 | |
| 3h5n_A | 353 | MCCB protein; ubiquitin-activating enzyme, microci | 100.0 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 100.0 | |
| 3cmm_A | 1015 | Ubiquitin-activating enzyme E1 1; UBA1, protein tu | 100.0 | |
| 1y8q_B | 640 | Anthracycline-, ubiquitin-like 2 activating enzyme | 100.0 | |
| 3cmm_A | 1015 | Ubiquitin-activating enzyme E1 1; UBA1, protein tu | 100.0 | |
| 3rui_A | 340 | Ubiquitin-like modifier-activating enzyme ATG7; au | 99.97 | |
| 1tt5_B | 434 | Ubiquitin-activating enzyme E1C isoform 1; cell cy | 99.97 | |
| 3vh1_A | 598 | Ubiquitin-like modifier-activating enzyme ATG7; au | 99.97 | |
| 4gsl_A | 615 | Ubiquitin-like modifier-activating enzyme ATG7; ub | 99.96 | |
| 2nvu_B | 805 | Maltose binding protein/NEDD8-activating enzyme E1 | 99.96 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 98.42 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 98.13 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 98.08 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 98.07 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 98.06 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 98.01 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 97.98 | |
| 3tum_A | 269 | Shikimate dehydrogenase family protein; rossmann-f | 97.87 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 97.86 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 97.84 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 97.84 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 97.8 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 97.8 | |
| 2ph5_A | 480 | Homospermidine synthase; alpha-beta protein, struc | 97.79 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 97.71 | |
| 1pjq_A | 457 | CYSG, siroheme synthase; rossman fold, nucleotide | 97.7 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 97.69 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 97.67 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 97.58 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 97.58 | |
| 3t4e_A | 312 | Quinate/shikimate dehydrogenase; structural genomi | 97.52 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 97.45 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 97.44 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 97.43 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 97.41 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 97.39 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 97.35 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 97.34 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 97.33 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 97.33 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 97.31 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 97.28 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 97.27 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 97.26 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 97.24 | |
| 3obb_A | 300 | Probable 3-hydroxyisobutyrate dehydrogenase; struc | 97.24 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 97.23 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 97.2 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 97.2 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 97.2 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 97.19 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 97.18 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 97.18 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 97.18 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 97.17 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 97.17 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 97.15 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 97.14 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 97.14 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 97.13 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 97.12 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 97.12 | |
| 2d4a_B | 308 | Malate dehydrogenase; archaea, hyperthermophIle, o | 97.11 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 97.1 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 97.09 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 97.09 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 97.09 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 97.09 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 97.09 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 97.08 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 97.07 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 97.07 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 97.06 | |
| 1ldn_A | 316 | L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA | 97.05 | |
| 1ff9_A | 450 | Saccharopine reductase; lysine biosynthesis, alpha | 97.05 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 97.05 | |
| 3o26_A | 311 | Salutaridine reductase; short chain dehydrogenase/ | 97.05 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 97.04 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 97.03 | |
| 3tsc_A | 277 | Putative oxidoreductase; structural genomics, seat | 97.02 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 97.02 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 97.01 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 97.01 | |
| 4ibo_A | 271 | Gluconate dehydrogenase; enzyme function initiativ | 97.0 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 96.99 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 96.99 | |
| 2bd0_A | 244 | Sepiapterin reductase; oxidoreductase; HET: NAP BI | 96.99 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 96.98 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 96.98 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 96.97 | |
| 1npy_A | 271 | Hypothetical shikimate 5-dehydrogenase-like protei | 96.95 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 96.95 | |
| 1oaa_A | 259 | Sepiapterin reductase; tetrahydrobiopterin, oxidor | 96.94 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 96.94 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 96.94 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 96.93 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 96.93 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 96.93 | |
| 3cxt_A | 291 | Dehydrogenase with different specificities; rossma | 96.92 | |
| 2v6b_A | 304 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ra | 96.91 | |
| 4iiu_A | 267 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 96.91 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 96.9 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 96.89 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 96.89 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 96.89 | |
| 3e03_A | 274 | Short chain dehydrogenase; structural genomics, PS | 96.88 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 96.88 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 96.87 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 96.86 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 96.85 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 96.85 | |
| 3rih_A | 293 | Short chain dehydrogenase or reductase; structural | 96.85 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 96.85 | |
| 4g81_D | 255 | Putative hexonate dehydrogenase; enzyme function i | 96.84 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 96.84 | |
| 4fs3_A | 256 | Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; | 96.83 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 96.83 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 96.83 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 96.82 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 96.82 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 96.82 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 96.81 | |
| 4dry_A | 281 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 96.81 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 96.81 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 96.8 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 96.8 | |
| 3edm_A | 259 | Short chain dehydrogenase; structural genomics, ox | 96.8 | |
| 3f1l_A | 252 | Uncharacterized oxidoreductase YCIK; E. coli, NADP | 96.8 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 96.8 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 96.79 | |
| 3rwb_A | 247 | TPLDH, pyridoxal 4-dehydrogenase; short chain dehy | 96.79 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 96.79 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 96.79 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 96.78 | |
| 3pxx_A | 287 | Carveol dehydrogenase; structural genomics, seattl | 96.77 | |
| 1hyh_A | 309 | L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 | 96.76 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 96.75 | |
| 1wma_A | 276 | Carbonyl reductase [NADPH] 1; oxidoreductase; HET: | 96.74 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 96.74 | |
| 3oec_A | 317 | Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; | 96.73 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 96.73 | |
| 1mxh_A | 276 | Pteridine reductase 2; SDR topology, protein-subst | 96.72 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 96.72 | |
| 4gwg_A | 484 | 6-phosphogluconate dehydrogenase, decarboxylating; | 96.71 | |
| 2pnf_A | 248 | 3-oxoacyl-[acyl-carrier-protein] reductase; short | 96.71 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 96.71 | |
| 3uve_A | 286 | Carveol dehydrogenase ((+)-trans-carveol dehydrog; | 96.71 | |
| 2uvd_A | 246 | 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k | 96.7 | |
| 2qq5_A | 260 | DHRS1, dehydrogenase/reductase SDR family member 1 | 96.7 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 96.7 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 96.7 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 96.69 | |
| 1geg_A | 256 | Acetoin reductase; SDR family, oxidoreductase; HET | 96.69 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 96.69 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 96.69 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 96.69 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 96.68 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 96.68 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 96.67 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 96.67 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 96.67 | |
| 3oid_A | 258 | Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa | 96.67 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 96.67 | |
| 3uf0_A | 273 | Short-chain dehydrogenase/reductase SDR; gluconate | 96.67 | |
| 3ksu_A | 262 | 3-oxoacyl-acyl carrier protein reductase; structur | 96.66 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 96.66 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 96.66 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 96.64 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 96.64 | |
| 2c07_A | 285 | 3-oxoacyl-(acyl-carrier protein) reductase; oxidor | 96.64 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 96.63 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 96.63 | |
| 3t7c_A | 299 | Carveol dehydrogenase; structural genomics, seattl | 96.62 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 96.62 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 96.62 | |
| 3u5t_A | 267 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 96.61 | |
| 3tox_A | 280 | Short chain dehydrogenase; structural genomics, PS | 96.6 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 96.59 | |
| 3d0o_A | 317 | L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly | 96.58 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 96.58 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 96.58 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 96.58 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 96.58 | |
| 1lld_A | 319 | L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N | 96.57 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 96.56 | |
| 3tzq_B | 271 | Short-chain type dehydrogenase/reductase; ssgcid, | 96.56 | |
| 3grp_A | 266 | 3-oxoacyl-(acyl carrierprotein) reductase; structu | 96.56 | |
| 2zyd_A | 480 | 6-phosphogluconate dehydrogenase, decarboxylating; | 96.56 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 96.56 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 96.56 | |
| 3kvo_A | 346 | Hydroxysteroid dehydrogenase-like protein 2; HSDL2 | 96.55 | |
| 1h5q_A | 265 | NADP-dependent mannitol dehydrogenase; oxidoreduct | 96.55 | |
| 3u9l_A | 324 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 96.54 | |
| 3a28_C | 258 | L-2.3-butanediol dehydrogenase; chiral substrate r | 96.54 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 96.54 | |
| 1edo_A | 244 | Beta-keto acyl carrier protein reductase; nucleoti | 96.54 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 96.53 | |
| 4gbj_A | 297 | 6-phosphogluconate dehydrogenase NAD-binding; stru | 96.53 | |
| 3ctm_A | 279 | Carbonyl reductase; alcohol dehydrogenase, short-c | 96.53 | |
| 2b4q_A | 276 | Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier | 96.52 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 96.52 | |
| 1ez4_A | 318 | Lactate dehydrogenase; rossmann fold, oxidoreducta | 96.52 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 96.52 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 96.51 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 96.51 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 96.51 | |
| 3osu_A | 246 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 96.51 | |
| 1xkq_A | 280 | Short-chain reductase family member (5D234); parra | 96.5 | |
| 2nwq_A | 272 | Probable short-chain dehydrogenase; oxidoreductase | 96.5 | |
| 1jay_A | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma | 96.48 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 96.48 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 96.48 | |
| 2x6t_A | 357 | ADP-L-glycero-D-manno-heptose-6-epimerase; isomera | 96.48 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 96.45 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 96.45 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 96.45 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 96.45 | |
| 1spx_A | 278 | Short-chain reductase family member (5L265); paral | 96.45 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 96.44 | |
| 1hxh_A | 253 | 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b | 96.44 | |
| 3tri_A | 280 | Pyrroline-5-carboxylate reductase; amino acid bios | 96.43 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 96.43 | |
| 3k31_A | 296 | Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI | 96.42 | |
| 1x1t_A | 260 | D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S | 96.42 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 96.42 | |
| 3oig_A | 266 | Enoyl-[acyl-carrier-protein] reductase [NADH]; fat | 96.4 | |
| 2x9g_A | 288 | PTR1, pteridine reductase; short chain dehydrogena | 96.4 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 96.39 | |
| 1xhl_A | 297 | Short-chain dehydrogenase/reductase family member | 96.39 | |
| 3r3s_A | 294 | Oxidoreductase; structural genomics, csgid, center | 96.39 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 96.39 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 96.39 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 96.39 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 96.38 | |
| 3tpc_A | 257 | Short chain alcohol dehydrogenase-related dehydro; | 96.38 | |
| 4dmm_A | 269 | 3-oxoacyl-[acyl-carrier-protein] reductase; rossma | 96.38 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 96.37 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 96.37 | |
| 1yqg_A | 263 | Pyrroline-5-carboxylate reductase; structural geno | 96.37 | |
| 2p4q_A | 497 | 6-phosphogluconate dehydrogenase, decarboxylating; | 96.37 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 96.36 | |
| 1e7w_A | 291 | Pteridine reductase; dihydrofolate reductase, shor | 96.36 | |
| 3ezl_A | 256 | Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA | 96.36 | |
| 3ek2_A | 271 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 96.36 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 96.34 | |
| 2cfc_A | 250 | 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor | 96.34 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 96.33 | |
| 2x0j_A | 294 | Malate dehydrogenase; oxidoreductase, hyperthermop | 96.33 | |
| 2a4k_A | 263 | 3-oxoacyl-[acyl carrier protein] reductase; reduct | 96.33 | |
| 3grk_A | 293 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 96.33 | |
| 1a5z_A | 319 | L-lactate dehydrogenase; oxidoreductase, glycolysi | 96.33 | |
| 1nff_A | 260 | Putative oxidoreductase RV2002; directed evolution | 96.32 | |
| 4e3z_A | 272 | Putative oxidoreductase protein; PSI-biology, stru | 96.32 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 96.32 | |
| 3zv4_A | 281 | CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox | 96.31 | |
| 1hdc_A | 254 | 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi | 96.29 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 96.27 | |
| 1yde_A | 270 | Retinal dehydrogenase/reductase 3; oxidoreductase, | 96.27 | |
| 2iz1_A | 474 | 6-phosphogluconate dehydrogenase, decarboxylating; | 96.27 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 96.27 | |
| 3op4_A | 248 | 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto | 96.27 | |
| 2zqz_A | 326 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ro | 96.27 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 96.25 | |
| 1nvt_A | 287 | Shikimate 5'-dehydrogenase; structural genomics, P | 96.25 | |
| 2hrz_A | 342 | AGR_C_4963P, nucleoside-diphosphate-sugar epimeras | 96.25 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 96.25 | |
| 2g5c_A | 281 | Prephenate dehydrogenase; TYRA, oxidoreductase; HE | 96.23 | |
| 3gk3_A | 269 | Acetoacetyl-COA reductase; acetoacetyl-CO reductas | 96.23 | |
| 2fr1_A | 486 | Erythromycin synthase, eryai; short chain dehydrog | 96.22 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 96.22 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 96.22 | |
| 1z82_A | 335 | Glycerol-3-phosphate dehydrogenase; TM0378, struct | 96.22 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 96.22 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 96.21 | |
| 2f1k_A | 279 | Prephenate dehydrogenase; tyrosine synthesis, X-RA | 96.21 | |
| 3m6i_A | 363 | L-arabinitol 4-dehydrogenase; medium chain dehydro | 96.2 | |
| 3mje_A | 496 | AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. | 96.2 | |
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 96.2 | |
| 1y6j_A | 318 | L-lactate dehydrogenase; southeast collaboratory f | 96.2 | |
| 2cvz_A | 289 | Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; | 96.2 | |
| 3cky_A | 301 | 2-hydroxymethyl glutarate dehydrogenase; rossmann | 96.2 | |
| 2d1y_A | 256 | Hypothetical protein TT0321; strucrtural genomics, | 96.19 | |
| 3nep_X | 314 | Malate dehydrogenase; halophIle, molecular adpatat | 96.19 | |
| 1g0o_A | 283 | Trihydroxynaphthalene reductase; protein-NADPH-act | 96.19 | |
| 2hun_A | 336 | 336AA long hypothetical DTDP-glucose 4,6-dehydrat; | 96.17 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 96.17 | |
| 2xxj_A | 310 | L-LDH, L-lactate dehydrogenase; oxidoreductase, hy | 96.17 | |
| 2qhx_A | 328 | Pteridine reductase 1; oxidoreductase, short-chain | 96.17 | |
| 1sny_A | 267 | Sniffer CG10964-PA; alpha and beta protein, rossma | 96.16 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 96.14 | |
| 3c1o_A | 321 | Eugenol synthase; phenylpropene, PIP reductase, sh | 96.13 | |
| 1guz_A | 310 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 96.13 | |
| 3hwr_A | 318 | 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A | 96.1 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 96.1 | |
| 3fi9_A | 343 | Malate dehydrogenase; structural genomics, oxidore | 96.1 | |
| 1qsg_A | 265 | Enoyl-[acyl-carrier-protein] reductase; enoyl redu | 96.1 | |
| 2ew8_A | 249 | (S)-1-phenylethanol dehydrogenase; transferase; 2. | 96.1 | |
| 2pgd_A | 482 | 6-phosphogluconate dehydrogenase; oxidoreductase ( | 96.09 | |
| 3gt0_A | 247 | Pyrroline-5-carboxylate reductase; structural geno | 96.08 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 96.07 | |
| 1yo6_A | 250 | Putative carbonyl reductase sniffer; tyrosine-depe | 96.06 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 96.06 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 96.05 | |
| 3i4f_A | 264 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 96.03 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 96.0 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 95.99 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 95.99 | |
| 2dc1_A | 236 | L-aspartate dehydrogenase; NAD, oxidoreductase; HE | 95.98 | |
| 1pgj_A | 478 | 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o | 95.97 | |
| 2ehd_A | 234 | Oxidoreductase, oxidoreductase, short-chain dehydr | 95.97 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 95.97 | |
| 1orr_A | 347 | CDP-tyvelose-2-epimerase; rossmann fold, short-cha | 95.95 | |
| 1x7d_A | 350 | Ornithine cyclodeaminase; binds NAD+, binds L-orni | 95.95 | |
| 3nrc_A | 280 | Enoyl-[acyl-carrier-protein] reductase (NADH); ros | 95.94 | |
| 1r6d_A | 337 | TDP-glucose-4,6-dehydratase; rossmann fold, short- | 95.93 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 95.92 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 95.92 | |
| 1p9l_A | 245 | Dihydrodipicolinate reductase; oxidoreductase, lys | 95.91 | |
| 3gdg_A | 267 | Probable NADP-dependent mannitol dehydrogenase; ro | 95.91 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 95.9 | |
| 1vpd_A | 299 | Tartronate semialdehyde reductase; structural geno | 95.88 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 95.84 | |
| 3ego_A | 307 | Probable 2-dehydropantoate 2-reductase; structural | 95.84 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 95.84 | |
| 3ehe_A | 313 | UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, | 95.82 | |
| 3b1f_A | 290 | Putative prephenate dehydrogenase; enzyme, 4-hydro | 95.81 | |
| 2dtx_A | 264 | Glucose 1-dehydrogenase related protein; rossmann | 95.81 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 95.81 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 95.8 | |
| 4a2c_A | 346 | Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc | 95.8 | |
| 2i99_A | 312 | MU-crystallin homolog; thyroid hormine binding pro | 95.8 | |
| 2wm3_A | 299 | NMRA-like family domain containing protein 1; unkn | 95.8 | |
| 1gy8_A | 397 | UDP-galactose 4-epimerase; oxidoreductase; HET: NA | 95.8 | |
| 2ph3_A | 245 | 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 | 95.79 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 95.78 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 95.78 | |
| 3rc1_A | 350 | Sugar 3-ketoreductase; sugar biosynthesis, TDP bin | 95.78 | |
| 1uls_A | 245 | Putative 3-oxoacyl-acyl carrier protein reductase; | 95.78 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 95.77 | |
| 1omo_A | 322 | Alanine dehydrogenase; two-domain, beta-sandwich-d | 95.77 | |
| 3dii_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 95.77 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 95.75 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 95.75 | |
| 3k96_A | 356 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA | 95.74 | |
| 3p19_A | 266 | BFPVVD8, putative blue fluorescent protein; rossma | 95.73 | |
| 2wyu_A | 261 | Enoyl-[acyl carrier protein] reductase; oxidoreduc | 95.72 | |
| 1rpn_A | 335 | GDP-mannose 4,6-dehydratase; short-chain dehydroge | 95.7 | |
| 3icc_A | 255 | Putative 3-oxoacyl-(acyl carrier protein) reducta; | 95.68 | |
| 3kzv_A | 254 | Uncharacterized oxidoreductase YIR035C; cytoplasmi | 95.68 | |
| 2p91_A | 285 | Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD | 95.68 | |
| 2i6t_A | 303 | Ubiquitin-conjugating enzyme E2-like isoform A; L- | 95.67 | |
| 2ahr_A | 259 | Putative pyrroline carboxylate reductase; pyrrolin | 95.67 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 95.67 | |
| 4gkb_A | 258 | 3-oxoacyl-[acyl-carrier protein] reductase; putati | 95.67 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 95.67 | |
| 3ip1_A | 404 | Alcohol dehydrogenase, zinc-containing; structural | 95.66 | |
| 1oc2_A | 348 | DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos | 95.63 | |
| 3asu_A | 248 | Short-chain dehydrogenase/reductase SDR; SDR famil | 95.62 | |
| 3guy_A | 230 | Short-chain dehydrogenase/reductase SDR; structura | 95.61 | |
| 2a35_A | 215 | Hypothetical protein PA4017; alpha-beta-alpha sand | 95.59 | |
| 3qp9_A | 525 | Type I polyketide synthase pikaii; rossmann fold, | 95.55 | |
| 3sc6_A | 287 | DTDP-4-dehydrorhamnose reductase; RFBD, structural | 95.49 | |
| 3q2i_A | 354 | Dehydrogenase; rossmann fold, UDP-sugar binding, N | 95.44 | |
| 3qy9_A | 243 | DHPR, dihydrodipicolinate reductase; rossmann fold | 95.44 | |
| 1vl0_A | 292 | DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s | 95.44 | |
| 2c20_A | 330 | UDP-glucose 4-epimerase; carbohydrate metabolism, | 95.43 | |
| 3nkl_A | 141 | UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo | 95.43 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 95.43 | |
| 3db2_A | 354 | Putative NADPH-dependent oxidoreductase; two domai | 95.43 | |
| 2zcu_A | 286 | Uncharacterized oxidoreductase YTFG; alpha-beta sa | 95.42 | |
| 2nm0_A | 253 | Probable 3-oxacyl-(acyl-carrier-protein) reductas; | 95.42 | |
| 1evy_A | 366 | Glycerol-3-phosphate dehydrogenase; rossmann fold, | 95.41 | |
| 3ec7_A | 357 | Putative dehydrogenase; alpha-beta, structural gen | 95.4 | |
| 4hkt_A | 331 | Inositol 2-dehydrogenase; structural genomics, nys | 95.37 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 95.37 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 95.35 | |
| 3uko_A | 378 | Alcohol dehydrogenase class-3; alcohol dehydrogena | 95.33 | |
| 2pd4_A | 275 | Enoyl-[acyl-carrier-protein] reductase [NADH]; ant | 95.33 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 95.33 | |
| 2h7i_A | 269 | Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi | 95.25 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 95.21 | |
| 3tl3_A | 257 | Short-chain type dehydrogenase/reductase; ssgcid, | 95.19 | |
| 1i24_A | 404 | Sulfolipid biosynthesis protein SQD1; SDR, short-c | 95.18 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 95.18 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 95.17 | |
| 3ged_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 95.17 | |
| 2dvm_A | 439 | Malic enzyme, 439AA long hypothetical malate oxido | 95.15 | |
| 3uuw_A | 308 | Putative oxidoreductase with NAD(P)-binding rossm | 95.15 | |
| 1hye_A | 313 | L-lactate/malate dehydrogenase; nucleotide binding | 95.12 | |
| 2d8a_A | 348 | PH0655, probable L-threonine 3-dehydrogenase; pyro | 95.12 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 95.11 | |
| 3fef_A | 450 | Putative glucosidase LPLD; gulosidase, structural | 95.09 | |
| 3mz0_A | 344 | Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; | 95.09 | |
| 1o6z_A | 303 | MDH, malate dehydrogenase; halophilic, ION-binding | 95.06 | |
| 2z5l_A | 511 | Tylkr1, tylactone synthase starter module and modu | 95.06 | |
| 1dih_A | 273 | Dihydrodipicolinate reductase; oxidoreductase; HET | 95.03 | |
| 4f6c_A | 427 | AUSA reductase domain protein; thioester reductase | 95.02 | |
| 1eq2_A | 310 | ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin | 95.01 | |
| 3ajr_A | 317 | NDP-sugar epimerase; L-threonine dehydrogenase, L- | 95.01 | |
| 1n7h_A | 381 | GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, | 94.99 | |
| 1pl8_A | 356 | Human sorbitol dehydrogenase; NAD, oxidoreductase; | 94.98 | |
| 1e6u_A | 321 | GDP-fucose synthetase; epimerase/reductase, SDR, R | 94.98 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 94.97 | |
| 3bio_A | 304 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 94.95 | |
| 2pk3_A | 321 | GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor | 94.95 | |
| 3euw_A | 344 | MYO-inositol dehydrogenase; protein structure init | 94.94 | |
| 1obb_A | 480 | Maltase, alpha-glucosidase; glycosidase, sulfinic | 94.93 | |
| 1db3_A | 372 | GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya | 94.93 | |
| 4had_A | 350 | Probable oxidoreductase protein; structural genomi | 94.92 | |
| 1udb_A | 338 | Epimerase, UDP-galactose-4-epimerase; isomerase; H | 94.88 | |
| 2bll_A | 345 | Protein YFBG; decarboxylase, short chain dehydroge | 94.88 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 94.86 | |
| 1uay_A | 242 | Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid | 94.85 | |
| 2q2v_A | 255 | Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore | 94.84 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 94.83 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 94.83 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 94.81 | |
| 3gg2_A | 450 | Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd | 94.81 | |
| 4dqv_A | 478 | Probable peptide synthetase NRP (peptide synthase; | 94.8 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 94.8 | |
| 2ag5_A | 246 | DHRS6, dehydrogenase/reductase (SDR family) member | 94.79 | |
| 1kew_A | 361 | RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo | 94.74 | |
| 3ay3_A | 267 | NAD-dependent epimerase/dehydratase; glucuronic ac | 94.74 | |
| 4b8w_A | 319 | GDP-L-fucose synthase; oxidoreductase; HET: NAP GD | 94.73 | |
| 3fpc_A | 352 | NADP-dependent alcohol dehydrogenase; oxydoreducta | 94.73 | |
| 1n2s_A | 299 | DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold | 94.72 | |
| 1xgk_A | 352 | Nitrogen metabolite repression regulator NMRA; ros | 94.7 | |
| 3vtz_A | 269 | Glucose 1-dehydrogenase; rossmann fold, oxidoreduc | 94.64 | |
| 2ixa_A | 444 | Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver | 94.63 | |
| 1z45_A | 699 | GAL10 bifunctional protein; epimerase, mutarotase, | 94.62 | |
| 3slk_A | 795 | Polyketide synthase extender module 2; rossmann fo | 94.61 | |
| 3o9z_A | 312 | Lipopolysaccaride biosynthesis protein WBPB; oxido | 94.6 | |
| 1np3_A | 338 | Ketol-acid reductoisomerase; A DEEP figure-OF-eigh | 94.58 | |
| 2yy7_A | 312 | L-threonine dehydrogenase; thermolabIle, flavobact | 94.57 | |
| 1ks9_A | 291 | KPA reductase;, 2-dehydropantoate 2-reductase; PAN | 94.55 | |
| 3aoe_E | 419 | Glutamate dehydrogenase; rossmann fold, NADH, oxid | 94.55 | |
| 3mw9_A | 501 | GDH 1, glutamate dehydrogenase 1; allostery, inhib | 94.54 | |
| 3ezy_A | 344 | Dehydrogenase; structural genomics, unknown functi | 94.54 | |
| 2rcy_A | 262 | Pyrroline carboxylate reductase; malaria, structur | 94.53 | |
| 3hn2_A | 312 | 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str | 94.53 | |
| 1yb4_A | 295 | Tartronic semialdehyde reductase; structural genom | 94.52 | |
| 3e9m_A | 330 | Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, | 94.51 | |
| 3i83_A | 320 | 2-dehydropantoate 2-reductase; structural genomics | 94.51 | |
| 2ejw_A | 332 | HDH, homoserine dehydrogenase; NAD-dependent, oxid | 94.47 | |
| 3aog_A | 440 | Glutamate dehydrogenase; NAD(H), oxidoreducta; HET | 94.44 | |
| 3g17_A | 294 | Similar to 2-dehydropantoate 2-reductase; structur | 94.44 | |
| 3ijp_A | 288 | DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, | 94.42 | |
| 3ghy_A | 335 | Ketopantoate reductase protein; oxidoreductase, NA | 94.42 | |
| 1t2a_A | 375 | GDP-mannose 4,6 dehydratase; structural genomics c | 94.42 | |
| 3u0b_A | 454 | Oxidoreductase, short chain dehydrogenase/reducta | 94.4 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 94.4 | |
| 1y81_A | 138 | Conserved hypothetical protein; hyperthermophIle, | 94.39 | |
| 3r3j_A | 456 | Glutamate dehydrogenase; rossman fold, oxidoreduct | 94.36 | |
| 2glx_A | 332 | 1,5-anhydro-D-fructose reductase; NADP(H) dependen | 94.36 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 94.36 | |
| 1vkn_A | 351 | N-acetyl-gamma-glutamyl-phosphate reductase; TM178 | 94.36 | |
| 1leh_A | 364 | Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi | 94.33 | |
| 1f8f_A | 371 | Benzyl alcohol dehydrogenase; rossmann fold, oxido | 94.33 | |
| 2c29_D | 337 | Dihydroflavonol 4-reductase; flavonoids, short deh | 94.32 | |
| 1tlt_A | 319 | Putative oxidoreductase (virulence factor MVIM HO; | 94.32 | |
| 4f3y_A | 272 | DHPR, dihydrodipicolinate reductase; structural ge | 94.32 | |
| 1zh8_A | 340 | Oxidoreductase; TM0312, structural genomics, JO ce | 94.3 | |
| 1gz6_A | 319 | Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF | 94.28 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 94.26 | |
| 3ohs_X | 334 | Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d | 94.24 | |
| 3hsk_A | 381 | Aspartate-semialdehyde dehydrogenase; candida albi | 94.23 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 94.2 | |
| 3evn_A | 329 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 94.18 | |
| 3upl_A | 446 | Oxidoreductase; rossmann fold, NADPH binding; 1.50 | 94.17 | |
| 3lk7_A | 451 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; a | 94.17 | |
| 4dpl_A | 359 | Malonyl-COA/succinyl-COA reductase; dinucleotide b | 94.16 | |
| 4dpk_A | 359 | Malonyl-COA/succinyl-COA reductase; dinucleotide b | 94.16 | |
| 3ing_A | 325 | Homoserine dehydrogenase; NP_394635.1, structural | 94.16 | |
| 3ip3_A | 337 | Oxidoreductase, putative; structural genomics, PSI | 94.15 | |
| 3u3x_A | 361 | Oxidoreductase; structural genomics, PSI-biology, | 94.15 | |
| 3dje_A | 438 | Fructosyl amine: oxygen oxidoreductase; fructosyl- | 94.14 | |
| 3rp8_A | 407 | Flavoprotein monooxygenase; FAD-binding protein, o | 94.14 | |
| 2fwm_X | 250 | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e | 94.13 | |
| 1c0p_A | 363 | D-amino acid oxidase; alpha-beta-alpha motif, flav | 94.13 | |
| 2rh8_A | 338 | Anthocyanidin reductase; flavonoids, rossmann fold | 94.12 | |
| 2ywl_A | 180 | Thioredoxin reductase related protein; uncharacter | 94.09 | |
| 1nvm_B | 312 | Acetaldehyde dehydrogenase (acylating), 4-hydroxy- | 94.07 | |
| 3hhp_A | 312 | Malate dehydrogenase; MDH, citric acid cycle, TCA | 94.02 | |
| 2ekp_A | 239 | 2-deoxy-D-gluconate 3-dehydrogenase; structural ge | 94.02 | |
| 3e18_A | 359 | Oxidoreductase; dehydrogenase, NAD-binding, struct | 94.02 | |
| 1u8x_X | 472 | Maltose-6'-phosphate glucosidase; structural genom | 94.01 | |
| 2dq4_A | 343 | L-threonine 3-dehydrogenase; NAD-dependent, oxidor | 93.99 | |
| 4ej6_A | 370 | Putative zinc-binding dehydrogenase; structural ge | 93.98 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 93.98 | |
| 3u95_A | 477 | Glycoside hydrolase, family 4; hydrolysis, cytosol | 93.97 | |
| 3gms_A | 340 | Putative NADPH:quinone reductase; structural genom | 93.95 | |
| 2jhf_A | 374 | Alcohol dehydrogenase E chain; oxidoreductase, met | 93.94 | |
| 1yvv_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 93.92 | |
| 4b79_A | 242 | PA4098, probable short-chain dehydrogenase; oxidor | 93.88 | |
| 3uxy_A | 266 | Short-chain dehydrogenase/reductase SDR; structura | 93.88 | |
| 1zmt_A | 254 | Haloalcohol dehalogenase HHEC; halohydrin dehaloge | 93.85 |
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.3e-39 Score=282.37 Aligned_cols=165 Identities=64% Similarity=1.018 Sum_probs=121.2
Q ss_pred CchhHHHhhhhcChhHHHHHHhcCcEEEEecCchHHHHHHHHHHhcCceEEEEeCCccccccccccCCCcCccCCcHHHH
Q 026893 63 NPYSRLMALQRMGIVENYERIREFSVAIVGVGGVGSVAAEMLTRCGIGRLLLYDYDKVELANMNRLFFRPEQVGMTKTDA 142 (231)
Q Consensus 63 ~~y~Rq~~l~~~g~~~~~~kl~~~~V~IvG~GgvGs~ia~~La~~Gv~~i~LiD~D~v~~~Nl~R~~~~~~dvG~~Ka~~ 142 (231)
-||+||+.|.++|+.++|+||++++|+|||+||+||+++++|+++|||+|+|+|+|.|+.+|++||||.++|+|++|+++
T Consensus 14 ~~y~r~i~L~~~G~~~~q~kL~~~~VlVvGaGGlGs~va~~La~aGVG~i~lvD~D~Ve~sNL~Rq~~~~~diG~~Ka~a 93 (292)
T 3h8v_A 14 LVPRGSMALKRMGIVSDYEKIRTFAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPHQAGLSKVQA 93 (292)
T ss_dssp ------------------CGGGGCEEEEECCSHHHHHHHHHHHHHTCSEEEEECCCBC------------CCTTSBHHHH
T ss_pred CCchHhhcccccChHHHHHHHhCCeEEEECcCHHHHHHHHHHHHcCCCEEEEECCCccChhhcccccCChhhcCchHHHH
Confidence 58999999999997689999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHhhCCCcEEEEEeecccCccchHHHHhhhhccCCCCCCCCCCCcEEEEccCCHHHHHHHHHHHHHcCCcEEEeCc
Q 026893 143 AVQTLADINPDVVLESFTLNITTVQGFETFMSSLRNKSFRPSKEGSGVDLVLSCVDNYEARMAVNQACNELNQTWMESGK 222 (231)
Q Consensus 143 ~~~~l~~~np~v~v~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~DiVi~~~D~~~~r~~i~~~~~~~~~p~i~~g~ 222 (231)
++++|+++||+++++++..++++.++++.|++.++...+ ....++|+||+|+||+++|..|+++|+++++|||++|+
T Consensus 94 a~~~L~~iNP~v~v~~~~~~l~~~~~~~~~~~~~~~~~l---~~~~~~DlVid~~Dn~~~R~~in~~c~~~~~Pli~~gv 170 (292)
T 3h8v_A 94 AEHTLRNINPDVLFEVHNYNITTVENFQHFMDRISNGGL---EEGKPVDLVLSCVDNFEARMTINTACNELGQTWMESGV 170 (292)
T ss_dssp HHHHHHHHCTTSEEEEECCCTTSHHHHHHHHHHHHHBSS---STTBCCSEEEECCSSHHHHHHHHHHHHHHTCCEEEEEE
T ss_pred HHHHHHhhCCCcEEEEecccCCcHHHHHHHhhhhccccc---ccCCCCCEEEECCcchhhhhHHHHHHHHhCCCEEEeee
Confidence 999999999999999999999876777777654433320 01258999999999999999999999999999999999
Q ss_pred cC--ceeEEe
Q 026893 223 QS--SSCIVF 230 (231)
Q Consensus 223 ~g--~~g~vf 230 (231)
.| +.|++.
T Consensus 171 ~~~~~~Gqv~ 180 (292)
T 3h8v_A 171 SENAVSGHIQ 180 (292)
T ss_dssp CTTSSEEEEE
T ss_pred ecceeEEEEE
Confidence 86 788775
|
| >1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A | Back alignment and structure |
|---|
| >1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A | Back alignment and structure |
|---|
| >3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* | Back alignment and structure |
|---|
| >1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* | Back alignment and structure |
|---|
| >3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A | Back alignment and structure |
|---|
| >4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A | Back alignment and structure |
|---|
| >2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* | Back alignment and structure |
|---|
| >1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* | Back alignment and structure |
|---|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* | Back alignment and structure |
|---|
| >3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* | Back alignment and structure |
|---|
| >3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* | Back alignment and structure |
|---|
| >3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
| >4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A | Back alignment and structure |
|---|
| >2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* | Back alignment and structure |
|---|
| >2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A | Back alignment and structure |
|---|
| >3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* | Back alignment and structure |
|---|
| >2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* | Back alignment and structure |
|---|
| >1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A | Back alignment and structure |
|---|
| >2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} | Back alignment and structure |
|---|
| >2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* | Back alignment and structure |
|---|
| >1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} | Back alignment and structure |
|---|
| >1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A | Back alignment and structure |
|---|
| >1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* | Back alignment and structure |
|---|
| >1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* | Back alignment and structure |
|---|
| >3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* | Back alignment and structure |
|---|
| >2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A | Back alignment and structure |
|---|
| >1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* | Back alignment and structure |
|---|
| >2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* | Back alignment and structure |
|---|
| >3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A | Back alignment and structure |
|---|
| >2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* | Back alignment and structure |
|---|
| >2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* | Back alignment and structure |
|---|
| >2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* | Back alignment and structure |
|---|
| >1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* | Back alignment and structure |
|---|
| >4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* | Back alignment and structure |
|---|
| >1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E | Back alignment and structure |
|---|
| >2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} | Back alignment and structure |
|---|
| >3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* | Back alignment and structure |
|---|
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... | Back alignment and structure |
|---|
| >1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* | Back alignment and structure |
|---|
| >3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} | Back alignment and structure |
|---|
| >1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* | Back alignment and structure |
|---|
| >2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A | Back alignment and structure |
|---|
| >2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 | Back alignment and structure |
|---|
| >3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} | Back alignment and structure |
|---|
| >1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* | Back alignment and structure |
|---|
| >3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* | Back alignment and structure |
|---|
| >2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* | Back alignment and structure |
|---|
| >2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* | Back alignment and structure |
|---|
| >3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* | Back alignment and structure |
|---|
| >3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* | Back alignment and structure |
|---|
| >1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* | Back alignment and structure |
|---|
| >3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A | Back alignment and structure |
|---|
| >2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} | Back alignment and structure |
|---|
| >2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A | Back alignment and structure |
|---|
| >1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* | Back alignment and structure |
|---|
| >2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* | Back alignment and structure |
|---|
| >1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* | Back alignment and structure |
|---|
| >1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A | Back alignment and structure |
|---|
| >2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* | Back alignment and structure |
|---|
| >3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* | Back alignment and structure |
|---|
| >3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* | Back alignment and structure |
|---|
| >3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} | Back alignment and structure |
|---|
| >2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* | Back alignment and structure |
|---|
| >2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* | Back alignment and structure |
|---|
| >3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* | Back alignment and structure |
|---|
| >2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* | Back alignment and structure |
|---|
| >3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} | Back alignment and structure |
|---|
| >1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* | Back alignment and structure |
|---|
| >2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* | Back alignment and structure |
|---|
| >1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A | Back alignment and structure |
|---|
| >2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} | Back alignment and structure |
|---|
| >1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* | Back alignment and structure |
|---|
| >4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* | Back alignment and structure |
|---|
| >1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* | Back alignment and structure |
|---|
| >1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A | Back alignment and structure |
|---|
| >1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} | Back alignment and structure |
|---|
| >3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 | Back alignment and structure |
|---|
| >1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* | Back alignment and structure |
|---|
| >2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* | Back alignment and structure |
|---|
| >2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* | Back alignment and structure |
|---|
| >3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} | Back alignment and structure |
|---|
| >4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A | Back alignment and structure |
|---|
| >1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* | Back alignment and structure |
|---|
| >1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* | Back alignment and structure |
|---|
| >3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* | Back alignment and structure |
|---|
| >1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 | Back alignment and structure |
|---|
| >3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} | Back alignment and structure |
|---|
| >3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* | Back alignment and structure |
|---|
| >1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 | Back alignment and structure |
|---|
| >2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} | Back alignment and structure |
|---|
| >1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* | Back alignment and structure |
|---|
| >3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* | Back alignment and structure |
|---|
| >3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A | Back alignment and structure |
|---|
| >3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} | Back alignment and structure |
|---|
| >3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 | Back alignment and structure |
|---|
| >3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* | Back alignment and structure |
|---|
| >1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X | Back alignment and structure |
|---|
| >3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} | Back alignment and structure |
|---|
| >3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* | Back alignment and structure |
|---|
| >3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* | Back alignment and structure |
|---|
| >4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* | Back alignment and structure |
|---|
| >3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* | Back alignment and structure |
|---|
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* | Back alignment and structure |
|---|
| >2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* | Back alignment and structure |
|---|
| >2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A | Back alignment and structure |
|---|
| >2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* | Back alignment and structure |
|---|
| >1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* | Back alignment and structure |
|---|
| >2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A | Back alignment and structure |
|---|
| >3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} | Back alignment and structure |
|---|
| >1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 | Back alignment and structure |
|---|
| >2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* | Back alignment and structure |
|---|
| >4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* | Back alignment and structure |
|---|
| >3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... | Back alignment and structure |
|---|
| >4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 231 | ||||
| d1yova1 | 529 | c.111.1.2 (A:6-534) Amyloid beta precursor protein | 6e-32 | |
| d1yovb1 | 426 | c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T | 7e-24 | |
| d1jw9b_ | 247 | c.111.1.1 (B:) Molybdenum cofactor biosynthesis pr | 2e-12 | |
| d1t2da1 | 150 | c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria p | 5e-04 | |
| d3c96a1 | 288 | c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps | 0.004 |
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Activating enzymes of the ubiquitin-like proteins superfamily: Activating enzymes of the ubiquitin-like proteins family: Ubiquitin activating enzymes (UBA) domain: Amyloid beta precursor protein-binding protein 1, APPBP1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 119 bits (300), Expect = 6e-32
Identities = 24/165 (14%), Positives = 54/165 (32%), Gaps = 17/165 (10%)
Query: 58 EVVDSNPYSRLMALQRMGIVENYERIREFSVAIVGVGGVGSVAAEMLTRCGIGRLLLYDY 117
+++ Y R + L G E + V ++ G+ + L GIG + D
Sbjct: 1 KLLKEQKYDRQLRL--WGD-HGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDG 57
Query: 118 DKVELANMNR-LFFRPEQVGMTKTDAAVQTLADINPDVVLESFTLNITTVQGFETFMSSL 176
++V + F + +G + +AA++ L ++N DV + +
Sbjct: 58 NQVSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDN------- 110
Query: 177 RNKSFRPSKEGSGVDLVLSCVDNYEARMAVNQACNELNQTWMESG 221
+ SF +V++ + + +
Sbjct: 111 -DPSF-----FCRFTVVVATQLPESTSLRLADVLWNSQIPLLICR 149
|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Length = 247 | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 150 | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 231 | |||
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 100.0 | |
| d1yova1 | 529 | Amyloid beta precursor protein-binding protein 1, | 100.0 | |
| d1yovb1 | 426 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 99.97 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 98.33 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 98.03 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 98.0 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 98.0 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 97.86 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 97.81 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 97.76 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 97.76 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 97.74 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 97.74 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 97.72 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 97.71 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 97.67 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 97.57 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 97.55 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 97.52 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 97.51 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 97.49 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 97.49 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 97.48 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 97.47 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 97.46 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 97.43 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 97.43 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 97.42 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 97.42 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 97.4 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 97.4 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 97.39 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 97.38 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 97.37 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 97.36 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 97.35 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 97.34 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 97.33 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 97.33 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 97.32 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 97.32 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 97.29 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 97.28 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 97.25 | |
| d1wmaa1 | 275 | Carbonyl reductase/20beta-hydroxysteroid dehydroge | 97.25 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 97.25 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 97.24 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 97.24 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 97.21 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 97.21 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 97.2 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 97.2 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 97.17 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 97.16 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 97.15 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 97.15 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 97.15 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 97.15 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 97.13 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 97.12 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 97.11 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 97.11 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 97.09 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 97.09 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 97.07 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 97.07 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 97.07 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 97.04 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 97.04 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 97.04 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 97.02 | |
| d1x1ta1 | 260 | D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas | 97.02 | |
| d2cvza2 | 156 | Hydroxyisobutyrate dehydrogenase {Thermus thermoph | 96.99 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 96.96 | |
| d1ja9a_ | 259 | 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl | 96.94 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 96.94 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 96.92 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 96.91 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 96.91 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 96.85 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 96.85 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 96.84 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 96.82 | |
| d2bd0a1 | 240 | Bacterial sepiapterin reductase {Chlorobium tepidu | 96.82 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 96.81 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 96.81 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 96.81 | |
| d1oaaa_ | 259 | Sepiapterin reductase {Mouse (Mus musculus) [TaxId | 96.81 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 96.77 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 96.7 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 96.69 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 96.68 | |
| d1o6za1 | 142 | Malate dehydrogenase {Archaeon Haloarcula marismor | 96.68 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 96.67 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 96.67 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 96.66 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 96.66 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 96.66 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 96.62 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 96.61 | |
| d1kewa_ | 361 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 96.59 | |
| d2fr1a1 | 259 | Erythromycin synthase, eryAI, 1st ketoreductase mo | 96.56 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 96.54 | |
| d1edoa_ | 244 | beta-keto acyl carrier protein reductase {Oil seed | 96.49 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 96.44 | |
| d2fy8a1 | 129 | Potassium channel-related protein MthK {Archaeon M | 96.37 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 96.36 | |
| d1ydwa1 | 184 | Probable oxidoreductase At4g09670 {Thale cress (Ar | 96.35 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 96.34 | |
| d1db3a_ | 357 | GDP-mannose 4,6-dehydratase {Escherichia coli [Tax | 96.31 | |
| d1ulua_ | 256 | Enoyl-ACP reductase {Thermus thermophilus [TaxId: | 96.29 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 96.24 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 96.22 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 96.21 | |
| d1j5pa4 | 132 | Hypothetical protein TM1643 {Thermotoga maritima [ | 96.2 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 96.16 | |
| d1z45a2 | 347 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 96.15 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 96.14 | |
| d1xeaa1 | 167 | Putative oxidoreductase VCA1048 {Vibrio cholerae [ | 96.1 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 96.08 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 96.05 | |
| d2h7ma1 | 268 | Enoyl-ACP reductase {Mycobacterium tuberculosis, T | 95.99 | |
| d2pd4a1 | 274 | Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 | 95.98 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 95.97 | |
| d1i24a_ | 393 | Sulfolipid biosynthesis protein SQD1 {Thale cress | 95.94 | |
| d2d1ya1 | 248 | Hypothetical protein TTHA0369 {Thermus thermophilu | 95.92 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 95.91 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 95.89 | |
| d1zh8a1 | 181 | Hypothetical protein TM0312 {Thermotoga maritima [ | 95.86 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 95.85 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 95.84 | |
| d1u8xx1 | 167 | Maltose-6'-phosphate glucosidase GlvA {Bacillus su | 95.84 | |
| d1w5fa1 | 194 | Cell-division protein FtsZ {Thermotoga maritima [T | 95.83 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 95.82 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 95.81 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 95.8 | |
| d1xu9a_ | 269 | 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom | 95.79 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 95.78 | |
| d1tlta1 | 164 | Virulence factor MviM {Escherichia coli [TaxId: 56 | 95.77 | |
| d1rkxa_ | 356 | CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc | 95.77 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 95.76 | |
| d1obba1 | 171 | Alpha-glucosidase AglA {Thermotoga maritima [TaxId | 95.76 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 95.75 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 95.74 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 95.7 | |
| d1up7a1 | 162 | 6-phospho-beta-glucosidase {Thermotoga maritima [T | 95.63 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 95.62 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 95.58 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 95.56 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 95.51 | |
| d1gz6a_ | 302 | (3R)-hydroxyacyl-CoA dehydrogenase domain of estra | 95.49 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 95.44 | |
| d1bgva1 | 255 | Glutamate dehydrogenase {Clostridium symbiosum [Ta | 95.43 | |
| d2vapa1 | 209 | Cell-division protein FtsZ {Archaeon Methanococcus | 95.41 | |
| d1udca_ | 338 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 95.33 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 95.32 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 95.3 | |
| d1uzma1 | 237 | beta-keto acyl carrier protein reductase {Mycobact | 95.3 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 95.3 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 95.29 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 95.28 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 95.27 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 95.22 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 95.19 | |
| d1qsga_ | 258 | Enoyl-ACP reductase {Escherichia coli [TaxId: 562] | 95.18 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 95.15 | |
| d2blla1 | 342 | Polymyxin resistance protein ArnA (PrmI) {Escheric | 95.13 | |
| d1vl6a1 | 222 | Malate oxidoreductase (malic enzyme) {Thermotoga m | 95.13 | |
| d1nvmb1 | 157 | Acetaldehyde dehydrogenase (acylating) {Pseudomona | 95.12 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 95.09 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 95.07 | |
| d1y1pa1 | 342 | Aldehyde reductase II {Sporobolomyces salmonicolor | 95.04 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 95.04 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 95.02 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 94.93 | |
| d1vm6a3 | 128 | Dihydrodipicolinate reductase {Thermotoga maritima | 94.92 | |
| d1yl7a1 | 135 | Dihydrodipicolinate reductase {Mycobacterium tuber | 94.92 | |
| d1r6da_ | 322 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces | 94.88 | |
| d1hwxa1 | 293 | Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: | 94.86 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 94.84 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 94.83 | |
| d1rpna_ | 321 | GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos | 94.71 | |
| d1yo6a1 | 250 | Putative carbonyl reductase sniffer {Caenorhabditi | 94.68 | |
| d1h6da1 | 221 | Glucose-fructose oxidoreductase, N-terminal domain | 94.51 | |
| d1ek6a_ | 346 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 94.47 | |
| d1kifa1 | 246 | D-aminoacid oxidase, N-terminal domain {Pig (Sus s | 94.42 | |
| d1y7ta1 | 154 | Malate dehydrogenase {Thermus thermophilus [TaxId: | 94.37 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 94.3 | |
| d1pqwa_ | 183 | Putative enoyl reductase domain of polyketide synt | 94.3 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 94.27 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 94.27 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 94.26 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 94.26 | |
| d1sb8a_ | 341 | UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo | 94.26 | |
| d1e7wa_ | 284 | Dihydropteridin reductase (pteridine reductase) {L | 94.17 | |
| d2hjsa1 | 144 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 94.16 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 94.09 | |
| d1q1ra1 | 185 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 94.06 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 94.06 | |
| d7mdha1 | 175 | Malate dehydrogenase {Sorghum (Sorghum vulgare), c | 94.03 | |
| d5mdha1 | 154 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 94.0 | |
| d1lqta2 | 239 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 93.99 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 93.93 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 93.91 | |
| d2dt5a2 | 126 | Transcriptional repressor Rex, C-terminal domain { | 93.91 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 93.87 | |
| d1ebfa1 | 168 | Homoserine dehydrogenase {Baker's yeast (Saccharom | 93.85 | |
| d1e6ua_ | 315 | GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( | 93.85 | |
| d2cmda1 | 145 | Malate dehydrogenase {Escherichia coli [TaxId: 562 | 93.82 | |
| d3bswa1 | 193 | Acetyltransferase PglD {Campylobacter jejuni [TaxI | 93.81 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 93.71 | |
| d1t2aa_ | 347 | GDP-mannose 4,6-dehydratase {Human (Homo sapiens) | 93.69 | |
| d1snya_ | 248 | Carbonyl reductase sniffer {Fruit fly (Drosophila | 93.69 | |
| d1mxha_ | 266 | Dihydropteridin reductase (pteridine reductase) {T | 93.61 | |
| d2i76a2 | 153 | Hypothetical protein TM1727 {Thermotoga maritima [ | 93.5 | |
| d1f06a1 | 170 | Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb | 93.49 | |
| d1s6ya1 | 169 | 6-phospho-beta-glucosidase {Bacillus stearothermop | 93.42 | |
| d1v9la1 | 242 | Glutamate dehydrogenase {Pyrobaculum islandicum [T | 93.27 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 93.19 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 93.18 | |
| d2o23a1 | 248 | Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho | 93.16 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 93.16 | |
| d1gu7a2 | 189 | 2,4-dienoyl-CoA reductase {Yeast (Candida tropical | 93.15 | |
| d1leha1 | 230 | Leucine dehydrogenase {Bacillus sphaericus [TaxId: | 93.07 | |
| d1t4ba1 | 146 | Aspartate beta-semialdehyde dehydrogenase {Escheri | 93.03 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 92.97 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 92.96 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 92.94 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 92.93 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 92.93 | |
| d1gtea3 | 153 | Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su | 92.92 | |
| d2gz1a1 | 154 | Aspartate beta-semialdehyde dehydrogenase {Strepto | 92.91 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 92.79 | |
| d1orra_ | 338 | CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: | 92.67 | |
| d1j6ua1 | 89 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 92.65 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 92.62 | |
| d1jtva_ | 285 | Human estrogenic 17beta-hydroxysteroid dehydrogena | 92.56 | |
| d1gdha1 | 191 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 92.51 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 92.45 | |
| d1n2sa_ | 298 | dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S | 92.41 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 92.36 | |
| d1i8ta1 | 298 | UDP-galactopyranose mutase, N-terminal domain {Esc | 92.36 | |
| d1o5ia_ | 234 | beta-keto acyl carrier protein reductase {Thermoto | 92.32 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 92.3 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 92.23 | |
| d1o0sa1 | 308 | Mitochondrial NAD(P)-dependent malic enzyme {Pig r | 92.19 | |
| d1gq2a1 | 298 | Mitochondrial NAD(P)-dependent malic enzyme {Domes | 92.05 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 92.01 | |
| d1x7da_ | 340 | Ornithine cyclodeaminase {Pseudomonas putida [TaxI | 91.87 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 91.75 | |
| d1pj3a1 | 294 | Mitochondrial NAD(P)-dependent malic enzyme {Human | 91.73 | |
| d1oc2a_ | 346 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 91.65 | |
| d1lvla1 | 220 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 91.61 | |
| d1gesa1 | 217 | Glutathione reductase {Escherichia coli [TaxId: 56 | 91.61 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 91.59 | |
| d1vdca1 | 192 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 91.55 | |
| d1w4xa2 | 235 | Phenylacetone monooxygenase {Thermobifida fusca [T | 91.52 | |
| d1gy8a_ | 383 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 91.52 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 91.46 | |
| d1trba1 | 190 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 91.38 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 91.29 | |
| d1ebda1 | 223 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 91.27 | |
| d3grsa1 | 221 | Glutathione reductase {Human (Homo sapiens) [TaxId | 91.03 | |
| d1lc0a1 | 172 | Biliverdin reductase {Rat (Rattus norvegicus) [Tax | 90.98 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 90.96 | |
| d1d7oa_ | 297 | Enoyl-ACP reductase {Oil seed rape (Brassica napus | 90.85 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 90.83 | |
| d1b26a1 | 234 | Glutamate dehydrogenase {Thermotoga maritima [TaxI | 90.78 | |
| d1gtma1 | 239 | Glutamate dehydrogenase {Archaeon Pyrococcus furio | 90.77 | |
| d1dxla1 | 221 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 90.6 | |
| d1vl0a_ | 281 | DTDP-4-dehydrorhamnose reductase RfbD {Clostridium | 90.57 | |
| d1n7ha_ | 339 | GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop | 90.41 | |
| d2nvwa1 | 237 | Galactose/lactose metabolism regulatory protein GA | 90.4 | |
| d1ygya1 | 184 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 90.17 | |
| d1pn0a1 | 360 | Phenol hydroxylase {Soil-living yeast (Trichosporo | 90.16 | |
| d1ofua1 | 198 | Cell-division protein FtsZ {Pseudomonas aeruginosa | 89.89 | |
| d1dlja2 | 196 | UDP-glucose dehydrogenase (UDPGDH) {Streptococcus | 89.85 | |
| d1ps9a2 | 162 | 2,4-dienoyl-CoA reductase, C-terminal domain {Esch | 89.81 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 89.8 | |
| d1dhra_ | 236 | Dihydropteridin reductase (pteridine reductase) {R | 89.77 | |
| d1xdia1 | 233 | Dihydrolipoamide dehydrogenase {Mycobacterium tube | 89.72 | |
| d1aoga1 | 238 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 89.68 | |
| d1vjta1 | 193 | Putative alpha-glucosidase TM0752 {Thermotoga mari | 89.59 | |
| d2czca2 | 172 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 89.56 | |
| d2gv8a2 | 107 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 89.52 | |
| d1uaya_ | 241 | Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t | 89.44 | |
| d1v8ba1 | 163 | S-adenosylhomocystein hydrolase {Plasmodium falcip | 89.29 | |
| d1b7go1 | 178 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 89.25 | |
| d1rp0a1 | 278 | Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara | 89.21 | |
| d1ojta1 | 229 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 89.15 | |
| d1mb4a1 | 147 | Aspartate beta-semialdehyde dehydrogenase {Vibrio | 89.06 | |
| d1v59a1 | 233 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 88.89 | |
| d2f5va1 | 379 | Pyranose 2-oxidase {White-rot fungus (Peniophora s | 88.87 | |
| d2bs2a2 | 336 | Fumarate reductase {Wolinella succinogenes [TaxId: | 88.64 | |
| d2cula1 | 230 | GidA-related protein TTHA1897 {Thermus thermophilu | 88.58 | |
| d1vkna1 | 176 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 88.44 | |
| d2csua1 | 129 | Acetate-CoA ligase alpha chain, AcdA, N-terminal d | 88.35 | |
| d1eq2a_ | 307 | ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric | 88.29 | |
| d3etja2 | 78 | N5-carboxyaminoimidazole ribonucleotide synthetase | 88.25 | |
| d1diha1 | 162 | Dihydrodipicolinate reductase {Escherichia coli [T | 88.15 | |
| d1m6ia1 | 213 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 88.09 | |
| d1n4wa1 | 367 | Cholesterol oxidase of GMC family {Streptomyces sp | 88.06 | |
| d3lada1 | 229 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 88.03 | |
| d1omoa_ | 320 | Archaeal alanine dehydrogenase {Archaeon Archaeogl | 87.9 | |
| d2cvoa1 | 183 | Putative semialdehyde dehydrogenase {Rice (Oryza s | 87.81 | |
| d1li4a1 | 163 | S-adenosylhomocystein hydrolase {Human (Homo sapie | 87.6 | |
| d1d4ca2 | 322 | Flavocytochrome c3 (respiratory fumarate reductase | 87.52 | |
| d1ooea_ | 235 | Dihydropteridin reductase (pteridine reductase) {N | 87.44 | |
| d1qora2 | 179 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 87.41 | |
| d1dssg1 | 169 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 87.39 | |
| d1onfa1 | 259 | Glutathione reductase {Plasmodium falciparum [TaxI | 87.27 | |
| d1rq2a1 | 198 | Cell-division protein FtsZ {Mycobacterium tubercul | 86.68 | |
| d1feca1 | 240 | Trypanothione reductase {Crithidia fasciculata [Ta | 86.47 | |
| d1vj1a2 | 187 | Putative zinc-binding alcohol dehydrogenase {Mouse | 86.46 | |
| d1xa0a2 | 176 | B. subtilis YhfP homologue {Bacillus stearothermop | 86.37 | |
| d1djqa2 | 156 | Trimethylamine dehydrogenase, C-terminal domain {M | 86.28 | |
| d1qo8a2 | 317 | Flavocytochrome c3 (respiratory fumarate reductase | 86.02 | |
| d1np3a2 | 182 | Class I ketol-acid reductoisomerase (KARI) {Pseudo | 86.02 | |
| d1cf2o1 | 171 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 86.0 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 85.89 | |
| d2g17a1 | 179 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 85.89 | |
| d3coxa1 | 370 | Cholesterol oxidase of GMC family {Brevibacterium | 85.87 | |
| d1fl2a1 | 184 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 85.66 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 85.63 | |
| d2py6a1 | 395 | Methyltransferase FkbM {Methylobacillus flagellatu | 85.62 | |
| d1kf6a2 | 311 | Fumarate reductase {Escherichia coli [TaxId: 562]} | 85.57 | |
| d1fjha_ | 257 | 3-alpha-hydroxysteroid dehydrogenase {Comamonas te | 85.49 | |
| d1cjca1 | 225 | Adrenodoxin reductase of mitochondrial p450 system | 85.27 | |
| d1v3va2 | 182 | Leukotriene b4 12-hydroxydehydrogenase/prostagland | 84.85 | |
| d2gjca1 | 311 | Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( | 84.36 | |
| d1lqta1 | 216 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 84.12 | |
| d1tt7a2 | 167 | Hypothetical protein YhfP {Bacillus subtilis [TaxI | 83.72 | |
| d1neka2 | 330 | Succinate dehydogenase {Escherichia coli [TaxId: 5 | 83.62 | |
| d1kjqa2 | 111 | Glycinamide ribonucleotide transformylase PurT, N- | 83.47 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 83.45 | |
| d1uira_ | 312 | Spermidine synthase {Thermus thermophilus [TaxId: | 82.91 | |
| d1mo9a1 | 261 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 82.81 | |
| d1inla_ | 295 | Spermidine synthase {Thermotoga maritima [TaxId: 2 | 82.71 | |
| d2gmha1 | 380 | Electron transfer flavoprotein-ubiquinone oxidored | 81.71 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 81.65 | |
| d1jnra2 | 356 | Adenylylsulfate reductase A subunit {Archaeon Arch | 81.58 | |
| d1kdga1 | 360 | Flavoprotein domain of flavocytochrome cellobiose | 81.57 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 81.03 | |
| d1zmta1 | 252 | Halohydrin dehalogenase HheC {Agrobacterium tumefa | 80.91 | |
| d1h6va1 | 235 | Mammalian thioredoxin reductase {Rat (Rattus norve | 80.44 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 80.4 |
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Activating enzymes of the ubiquitin-like proteins superfamily: Activating enzymes of the ubiquitin-like proteins family: Molybdenum cofactor biosynthesis protein MoeB domain: Molybdenum cofactor biosynthesis protein MoeB species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=1.4e-39 Score=275.17 Aligned_cols=159 Identities=26% Similarity=0.476 Sum_probs=144.7
Q ss_pred cCCcccccCCchhHHHhhhhcChhHHHHHHhcCcEEEEecCchHHHHHHHHHHhcCceEEEEeCCccccccccccC-CCc
Q 026893 54 DMSSEVVDSNPYSRLMALQRMGIVENYERIREFSVAIVGVGGVGSVAAEMLTRCGIGRLLLYDYDKVELANMNRLF-FRP 132 (231)
Q Consensus 54 ~~~~~~~~~~~y~Rq~~l~~~g~~~~~~kl~~~~V~IvG~GgvGs~ia~~La~~Gv~~i~LiD~D~v~~~Nl~R~~-~~~ 132 (231)
++++++. .||+||+.+|++|. ++|+||++++|+|+||||+||+++++|+++|||+|+|+|+|.|+.+|++||+ |++
T Consensus 2 ~l~~~e~--~ry~Rqi~l~~~g~-~~Q~kL~~~~VliiG~GglGs~va~~La~~Gvg~i~lvD~D~Ve~sNL~RQ~l~~~ 78 (247)
T d1jw9b_ 2 ELSDQEM--LRYNRQIILRGFDF-DGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTLLDFDTVSLSNLQRQTLHSD 78 (247)
T ss_dssp CCCHHHH--HHTHHHHTSTTTHH-HHHHHHHHCEEEEECCSHHHHHHHHHHHHHTCSEEEEECCCBCCGGGGGTCTTCCG
T ss_pred CCCHHHH--HHhhceeccccCCH-HHHHHHhCCCEEEECCCHHHHHHHHHHHHcCCCeEEEECCcccchhhhhhhccccH
Confidence 4566544 69999999999886 9999999999999999999999999999999999999999999999999997 589
Q ss_pred CccCCcHHHHHHHHHHhhCCCcEEEEEeecccCccchHHHHhhhhccCCCCCCCCCCCcEEEEccCCHHHHHHHHHHHHH
Q 026893 133 EQVGMTKTDAAVQTLADINPDVVLESFTLNITTVQGFETFMSSLRNKSFRPSKEGSGVDLVLSCVDNYEARMAVNQACNE 212 (231)
Q Consensus 133 ~dvG~~Ka~~~~~~l~~~np~v~v~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~DiVi~~~D~~~~r~~i~~~~~~ 212 (231)
+|+|++|+++++++|.++||+++++++...++.. +...+ +..+|+|++|+|++..+.+++++|++
T Consensus 79 ~diG~~K~~~a~~~l~~~np~~~i~~~~~~~~~~-~~~~~--------------~~~~divid~~d~~~~~~~in~~~~~ 143 (247)
T d1jw9b_ 79 ATVGQPKVESARDALTRINPHIAITPVNALLDDA-ELAAL--------------IAEHDLVLDCTDNVAVRNQLNAGCFA 143 (247)
T ss_dssp GGTTSBHHHHHHHHHHHHCTTSEEEEECSCCCHH-HHHHH--------------HHTSSEEEECCSSHHHHHHHHHHHHH
T ss_pred hhcCchHHHHHHHHHHHhhcccchhhhhhhhhhc-ccccc--------------ccccceeeeccchhhhhhhHHHHHHH
Confidence 9999999999999999999999999999887753 33322 35899999999999999999999999
Q ss_pred cCCcEEEeCccCceeEEe
Q 026893 213 LNQTWMESGKQSSSCIVF 230 (231)
Q Consensus 213 ~~~p~i~~g~~g~~g~vf 230 (231)
+++||+.+++.|..|++.
T Consensus 144 ~~ip~i~g~~~~~~g~~~ 161 (247)
T d1jw9b_ 144 AKVPLVSGAAIRMEGQIT 161 (247)
T ss_dssp HTCCEEEEEEEBTEEEEE
T ss_pred hCCCcccccccccccceE
Confidence 999999999999999764
|
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} | Back information, alignment and structure |
|---|
| >d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
|---|
| >d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} | Back information, alignment and structure |
|---|
| >d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} | Back information, alignment and structure |
|---|
| >d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} | Back information, alignment and structure |
|---|
| >d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} | Back information, alignment and structure |
|---|
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} | Back information, alignment and structure |
|---|
| >d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} | Back information, alignment and structure |
|---|
| >d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} | Back information, alignment and structure |
|---|
| >d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} | Back information, alignment and structure |
|---|
| >d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|