Citrus Sinensis ID: 027032

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MLLQHNRHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSGFVDVHRLASSL
cccccccccccccEEEcEEEEEEcccccccEEEEEEEEEEEEEcccEEEEEEEEEEEEccccEEEEEEEEEEEEEcccccccccccccccccccccccccccccccccEEEEEEccccccEEEEcccccccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEcEEccccccEEEEEEEEccEEEEEEEEcccccEEEEEEEEEEEccccc
cccccccccHHHHHcccEEEEEEccccccEEEEEEEEEEEEEccccEEEEEEEEEEEccccccEEEEEEEEEEEEcccccccccccccccccccccccccccccccccEEEEEcccHccEEEEEHHccccHHHccHHHHHcccccccEccHHHHHHHHHHHHHHHHccccHHHHHEEEEEEccccccccEEEEEEEccccEEEEEEEEEEcccEEEEEEEEEccccccc
mllqhnrhdprlllhgqqymelykpfpssasiRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFlrgaggfsnssqpfsyskyqtipvsvvkipksqpfavfedytqpsQALVYRLsgdynplhsdpmvakaagfsrpilhglCTMGFAVRAIIKFIcrgdpnmvKNIFSRFLlhvypgetlVTEMWLQGLRVIYQVKVKERNRSALSGFVDVHRLASSL
mllqhnrhdprlLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKernrsalsgfvdvhrlassl
MLLQHNRHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSGFVDVHRLASSL
***********LLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSGFVDV*******
*LLQHNRHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGG************************KSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSGFVDVHRL****
MLLQHNRHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSGFVDVHRLASSL
*LLQHNRHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFS*****************VVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSGFVDVHRL****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLQHNRHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSGFVDVHRLASSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query229 2.2.26 [Sep-21-2011]
Q8VYI3309 Enoyl-CoA hydratase 2, pe yes no 0.973 0.721 0.690 3e-91
Q01373894 Peroxisomal hydratase-deh N/A no 0.873 0.223 0.457 7e-45
P51659 736 Peroxisomal multifunction yes no 0.873 0.271 0.438 6e-44
P51660 735 Peroxisomal multifunction yes no 0.873 0.272 0.419 1e-38
Q9VXJ0598 Peroxisomal multifunction yes no 0.930 0.356 0.380 1e-38
P97852 735 Peroxisomal multifunction yes no 0.877 0.273 0.417 2e-38
Q54XZ0294 Probable enoyl-CoA hydrat yes no 0.895 0.697 0.387 1e-32
Q02207900 Peroxisomal hydratase-deh yes no 0.847 0.215 0.367 2e-24
P22414906 Peroxisomal hydratase-deh N/A no 0.864 0.218 0.330 3e-22
Q9UUG0 2073 Fatty acid synthase subun yes no 0.497 0.054 0.289 0.0002
>sp|Q8VYI3|ECH2_ARATH Enoyl-CoA hydratase 2, peroxisomal OS=Arabidopsis thaliana GN=ECH2 PE=1 SV=1 Back     alignment and function desciption
 Score =  334 bits (856), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 154/223 (69%), Positives = 182/223 (81%)

Query: 7   RHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLC 66
           ++DP LLLHGQQY+E+Y+P PS AS+ N+  +AGL DKGKAAILE+ET+SY   SGELLC
Sbjct: 87  KYDPSLLLHGQQYIEIYRPLPSKASLINKVSLAGLQDKGKAAILELETRSYEEGSGELLC 146

Query: 67  MNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLS 126
           MNR T FLRGAGGFSNSSQPFSY  Y +     VKIP+ QP  V E+ TQPSQAL+YRLS
Sbjct: 147 MNRTTVFLRGAGGFSNSSQPFSYKNYPSNQGLAVKIPQRQPLTVCEERTQPSQALLYRLS 206

Query: 127 GDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVY 186
           GDYNPLHSDP  AK AGF RPILHGLCT+GFA++AIIK +C+GDP  VK I  RFL  V+
Sbjct: 207 GDYNPLHSDPEFAKLAGFPRPILHGLCTLGFAIKAIIKCVCKGDPTAVKTISGRFLTTVF 266

Query: 187 PGETLVTEMWLQGLRVIYQVKVKERNRSALSGFVDVHRLASSL 229
           PGETL+TEMWL+GLRVIYQ KVKERN++ L+G+VD+  L+SSL
Sbjct: 267 PGETLITEMWLEGLRVIYQTKVKERNKTVLAGYVDIRGLSSSL 309
Bidirectional monofunctional enoyl-CoA hydratase 2 involved in the degradation of even cis-unsaturated fatty acids. Devoid of 3-hydroxyacyl-CoA dehydrogenase activity.
Arabidopsis thaliana (taxid: 3702)
EC: 4EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 1EC: 9
>sp|Q01373|FOX2_NEUCR Peroxisomal hydratase-dehydrogenase-epimerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fox-2 PE=1 SV=1 Back     alignment and function description
>sp|P51659|DHB4_HUMAN Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens GN=HSD17B4 PE=1 SV=3 Back     alignment and function description
>sp|P51660|DHB4_MOUSE Peroxisomal multifunctional enzyme type 2 OS=Mus musculus GN=Hsd17b4 PE=1 SV=3 Back     alignment and function description
>sp|Q9VXJ0|DHB4_DROME Peroxisomal multifunctional enzyme type 2 OS=Drosophila melanogaster GN=Mfe2 PE=1 SV=1 Back     alignment and function description
>sp|P97852|DHB4_RAT Peroxisomal multifunctional enzyme type 2 OS=Rattus norvegicus GN=Hsd17b4 PE=1 SV=3 Back     alignment and function description
>sp|Q54XZ0|MFEB_DICDI Probable enoyl-CoA hydratase 2 OS=Dictyostelium discoideum GN=mfeB PE=2 SV=1 Back     alignment and function description
>sp|Q02207|FOX2_YEAST Peroxisomal hydratase-dehydrogenase-epimerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOX2 PE=1 SV=1 Back     alignment and function description
>sp|P22414|FOX2_CANTR Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 Back     alignment and function description
>sp|Q9UUG0|FAS1_SCHPO Fatty acid synthase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fas1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query229
225459804306 PREDICTED: enoyl-CoA hydratase 2, peroxi 0.973 0.728 0.771 1e-101
255539120309 estradiol 17 beta-dehydrogenase, putativ 0.965 0.715 0.769 1e-100
388493320306 unknown [Lotus japonicus] 0.965 0.722 0.760 8e-98
224085982309 predicted protein [Populus trichocarpa] 0.973 0.721 0.748 1e-97
363807872308 uncharacterized protein LOC100780490 [Gl 0.973 0.724 0.753 3e-97
356508947308 PREDICTED: enoyl-CoA hydratase 2, peroxi 0.973 0.724 0.748 8e-96
449450474309 PREDICTED: enoyl-CoA hydratase 2, peroxi 0.969 0.718 0.720 2e-92
388520855308 unknown [Medicago truncatula] 0.973 0.724 0.726 3e-92
22330656309 enoyl-CoA hydratase 2 [Arabidopsis thali 0.973 0.721 0.690 2e-89
297842361309 hypothetical protein ARALYDRAFT_895493 [ 0.973 0.721 0.686 3e-89
>gi|225459804|ref|XP_002285911.1| PREDICTED: enoyl-CoA hydratase 2, peroxisomal [Vitis vinifera] gi|302141689|emb|CBI18892.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 197/223 (88%)

Query: 7   RHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLC 66
            +DPRLLLHGQQY+E++K FPSS  ++N+A I+GLHDKGKAAI+EIE +SY  ESGELLC
Sbjct: 84  EYDPRLLLHGQQYIEIHKSFPSSGCVQNKASISGLHDKGKAAIVEIEIESYEKESGELLC 143

Query: 67  MNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLS 126
            NRMT +LRGAG FS SS+P+SYSKY   PVS VK+PKSQPF VFED TQPSQAL+YRLS
Sbjct: 144 KNRMTTYLRGAGSFSRSSEPYSYSKYPNQPVSAVKVPKSQPFVVFEDCTQPSQALLYRLS 203

Query: 127 GDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVY 186
           GDYNPLHSDP  AK AGFSRPILHGLCT+GFAVRAII+ ICRGDPNMVKN+ +RFLLHVY
Sbjct: 204 GDYNPLHSDPGFAKIAGFSRPILHGLCTLGFAVRAIIRCICRGDPNMVKNVQARFLLHVY 263

Query: 187 PGETLVTEMWLQGLRVIYQVKVKERNRSALSGFVDVHRLASSL 229
           PGETL+TEMWLQGLRV+YQ KVKER+R+ LSG+VD+ RLASSL
Sbjct: 264 PGETLITEMWLQGLRVVYQTKVKERSRTVLSGYVDLSRLASSL 306

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255539120|ref|XP_002510625.1| estradiol 17 beta-dehydrogenase, putative [Ricinus communis] gi|223551326|gb|EEF52812.1| estradiol 17 beta-dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|388493320|gb|AFK34726.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|224085982|ref|XP_002307764.1| predicted protein [Populus trichocarpa] gi|222857213|gb|EEE94760.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|363807872|ref|NP_001242700.1| uncharacterized protein LOC100780490 [Glycine max] gi|255642179|gb|ACU21354.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356508947|ref|XP_003523214.1| PREDICTED: enoyl-CoA hydratase 2, peroxisomal-like [Glycine max] Back     alignment and taxonomy information
>gi|449450474|ref|XP_004142987.1| PREDICTED: enoyl-CoA hydratase 2, peroxisomal-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388520855|gb|AFK48489.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|22330656|ref|NP_177742.2| enoyl-CoA hydratase 2 [Arabidopsis thaliana] gi|75161483|sp|Q8VYI3.1|ECH2_ARATH RecName: Full=Enoyl-CoA hydratase 2, peroxisomal gi|17979531|gb|AAL50100.1| At1g76150/T23E18_38 [Arabidopsis thaliana] gi|20147245|gb|AAM10336.1| At1g76150/T23E18_38 [Arabidopsis thaliana] gi|332197682|gb|AEE35803.1| enoyl-CoA hydratase 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297842361|ref|XP_002889062.1| hypothetical protein ARALYDRAFT_895493 [Arabidopsis lyrata subsp. lyrata] gi|297334903|gb|EFH65321.1| hypothetical protein ARALYDRAFT_895493 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query229
TAIR|locus:2199767309 ECH2 "enoyl-CoA hydratase 2" [ 0.973 0.721 0.690 1.7e-82
UNIPROTKB|E1BW32624 HSD17B4 "Uncharacterized prote 0.877 0.322 0.450 4.5e-43
UNIPROTKB|F1NKH9678 HSD17B4 "Uncharacterized prote 0.877 0.296 0.450 8.2e-43
UNIPROTKB|E7EPL9 474 HSD17B4 "(3R)-hydroxyacyl-CoA 0.877 0.424 0.431 2.2e-41
UNIPROTKB|E7ET17 599 HSD17B4 "(3R)-hydroxyacyl-CoA 0.877 0.335 0.431 2.2e-41
UNIPROTKB|G5E9S2 596 HSD17B4 "Hydroxysteroid (17-be 0.877 0.337 0.431 2.2e-41
UNIPROTKB|E7EWE5 712 HSD17B4 "(3R)-hydroxyacyl-CoA 0.877 0.282 0.431 7.8e-41
UNIPROTKB|P51659 736 HSD17B4 "Peroxisomal multifunc 0.877 0.273 0.431 9.4e-41
MGI|MGI:105089 735 Hsd17b4 "hydroxysteroid (17-be 0.873 0.272 0.433 1.2e-40
RGD|621806 735 Hsd17b4 "hydroxysteroid (17-be 0.877 0.273 0.431 1.5e-40
TAIR|locus:2199767 ECH2 "enoyl-CoA hydratase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 827 (296.2 bits), Expect = 1.7e-82, P = 1.7e-82
 Identities = 154/223 (69%), Positives = 182/223 (81%)

Query:     7 RHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLC 66
             ++DP LLLHGQQY+E+Y+P PS AS+ N+  +AGL DKGKAAILE+ET+SY   SGELLC
Sbjct:    87 KYDPSLLLHGQQYIEIYRPLPSKASLINKVSLAGLQDKGKAAILELETRSYEEGSGELLC 146

Query:    67 MNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLS 126
             MNR T FLRGAGGFSNSSQPFSY  Y +     VKIP+ QP  V E+ TQPSQAL+YRLS
Sbjct:   147 MNRTTVFLRGAGGFSNSSQPFSYKNYPSNQGLAVKIPQRQPLTVCEERTQPSQALLYRLS 206

Query:   127 GDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVY 186
             GDYNPLHSDP  AK AGF RPILHGLCT+GFA++AIIK +C+GDP  VK I  RFL  V+
Sbjct:   207 GDYNPLHSDPEFAKLAGFPRPILHGLCTLGFAIKAIIKCVCKGDPTAVKTISGRFLTTVF 266

Query:   187 PGETLVTEMWLQGLRVIYQVKVKERNRSALSGFVDVHRLASSL 229
             PGETL+TEMWL+GLRVIYQ KVKERN++ L+G+VD+  L+SSL
Sbjct:   267 PGETLITEMWLEGLRVIYQTKVKERNKTVLAGYVDIRGLSSSL 309
GO:0008152 "metabolic process" evidence=IEA;ISS
GO:0016491 "oxidoreductase activity" evidence=IEA;ISS
GO:0005777 "peroxisome" evidence=IDA
GO:0033542 "fatty acid beta-oxidation, unsaturated, even number" evidence=IMP
GO:0080023 "3R-hydroxyacyl-CoA dehydratase activity" evidence=IGI;IDA
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0007031 "peroxisome organization" evidence=RCA
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0010260 "organ senescence" evidence=RCA
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
UNIPROTKB|E1BW32 HSD17B4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NKH9 HSD17B4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E7EPL9 HSD17B4 "(3R)-hydroxyacyl-CoA dehydrogenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7ET17 HSD17B4 "(3R)-hydroxyacyl-CoA dehydrogenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G5E9S2 HSD17B4 "Hydroxysteroid (17-beta) dehydrogenase 4, isoform CRA_a" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7EWE5 HSD17B4 "(3R)-hydroxyacyl-CoA dehydrogenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P51659 HSD17B4 "Peroxisomal multifunctional enzyme type 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:105089 Hsd17b4 "hydroxysteroid (17-beta) dehydrogenase 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621806 Hsd17b4 "hydroxysteroid (17-beta) dehydrogenase 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8VYI3ECH2_ARATH4, ., 2, ., 1, ., 1, 1, 90.69050.97370.7216yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0002075501
enoyl-CoA hydratase (EC-4.2.1.17) (309 aa)
(Populus trichocarpa)
Predicted Functional Partners:
fgenesh4_pg.C_scaffold_20516000001
Predicted protein (278 aa)
•••• •• 0.832
eugene3.32360002
annotation not avaliable (164 aa)
• •     0.506
eugene3.33700002
Predicted protein (418 aa)
•       0.503
eugene3.31020003
annotation not avaliable (332 aa)
• •  •  0.473
eugene3.150520001
Predicted protein (286 aa)
•       0.404

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
PLN02864310 PLN02864, PLN02864, enoyl-CoA hydratase 1e-153
cd03448122 cd03448, HDE_HSD, HDE_HSD The R-hydratase-like hot 2e-58
cd03441127 cd03441, R_hydratase_like, (R)-hydratase [(R)-spec 9e-24
pfam01575123 pfam01575, MaoC_dehydratas, MaoC like domain 9e-23
COG2030159 COG2030, MaoC, Acyl dehydratase [Lipid metabolism] 1e-15
cd03447126 cd03447, FAS_MaoC, FAS_MaoC, the MaoC-like hot dog 2e-09
cd03453127 cd03453, SAV4209_like, SAV4209_like 3e-09
PRK13693142 PRK13693, PRK13693, (3R)-hydroxyacyl-ACP dehydrata 2e-07
cd03449128 cd03449, R_hydratase, (R)-hydratase [(R)-specific 7e-07
cd03455123 cd03455, SAV4209, SAV4209 is a Streptomyces avermi 1e-06
cd03446140 cd03446, MaoC_like, MoaC_like Similar to the MaoC 2e-06
>gnl|CDD|178455 PLN02864, PLN02864, enoyl-CoA hydratase Back     alignment and domain information 
 Score =  427 bits (1100), Expect = e-153
 Identities = 175/222 (78%), Positives = 191/222 (86%)

Query: 8   HDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCM 67
           +DP LLLHGQQY+E+YKP PSSAS+RN+  IAGLHDKGKAAILE+ET SY  +SGELLCM
Sbjct: 89  YDPSLLLHGQQYIEIYKPIPSSASVRNKVSIAGLHDKGKAAILELETLSYEKDSGELLCM 148

Query: 68  NRMTAFLRGAGGFSNSSQPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLSG 127
           NR T FLRGAGGFSNSSQPFSYS Y T  VS VKIPKSQP AVFED TQPSQAL+YRLSG
Sbjct: 149 NRSTIFLRGAGGFSNSSQPFSYSNYPTNQVSAVKIPKSQPDAVFEDQTQPSQALLYRLSG 208

Query: 128 DYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVYP 187
           DYNPLHSDPM AK AGF+RPILHGLCT+GFAVRA+IK  C GDP  VK I  RFLLHVYP
Sbjct: 209 DYNPLHSDPMFAKVAGFTRPILHGLCTLGFAVRAVIKCFCNGDPTAVKTISGRFLLHVYP 268

Query: 188 GETLVTEMWLQGLRVIYQVKVKERNRSALSGFVDVHRLASSL 229
           GETLVTEMWL+GLRVIYQ KVKERN++ LSG+VD+  L SSL
Sbjct: 269 GETLVTEMWLEGLRVIYQTKVKERNKAVLSGYVDLRHLTSSL 310

Length = 310
>gnl|CDD|239532 cd03448, HDE_HSD, HDE_HSD The R-hydratase-like hot dog fold of the 17-beta-hydroxysteriod dehydrogenase (HSD), and Hydratase-Dehydrogenase-Epimerase (HDE) proteins Back     alignment and domain information
>gnl|CDD|239525 cd03441, R_hydratase_like, (R)-hydratase [(R)-specific enoyl-CoA hydratase] Back     alignment and domain information
>gnl|CDD|216580 pfam01575, MaoC_dehydratas, MaoC like domain Back     alignment and domain information
>gnl|CDD|224941 COG2030, MaoC, Acyl dehydratase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|239531 cd03447, FAS_MaoC, FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit Back     alignment and domain information
>gnl|CDD|239537 cd03453, SAV4209_like, SAV4209_like Back     alignment and domain information
>gnl|CDD|184249 PRK13693, PRK13693, (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Provisional Back     alignment and domain information
>gnl|CDD|239533 cd03449, R_hydratase, (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway Back     alignment and domain information
>gnl|CDD|239539 cd03455, SAV4209, SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit Back     alignment and domain information
>gnl|CDD|239530 cd03446, MaoC_like, MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 229
PLN02864310 enoyl-CoA hydratase 100.0
KOG1206272 consensus Peroxisomal multifunctional beta-oxidati 100.0
cd03448122 HDE_HSD HDE_HSD The R-hydratase-like hot dog fold 99.95
cd03447126 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of t 99.95
cd03453127 SAV4209_like SAV4209_like. Similar in sequence to 99.92
cd03455123 SAV4209 SAV4209 is a Streptomyces avermitilis prot 99.91
COG3777273 Uncharacterized conserved protein [Function unknow 99.88
cd03449128 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA 99.87
PRK13693142 (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Pro 99.87
cd03452142 MaoC_C MaoC_C The C-terminal hot dog fold of the M 99.87
cd03441127 R_hydratase_like (R)-hydratase [(R)-specific enoyl 99.87
COG2030159 MaoC Acyl dehydratase [Lipid metabolism] 99.86
PF01575122 MaoC_dehydratas: MaoC like domain; InterPro: IPR00 99.85
cd03446140 MaoC_like MoaC_like Similar to the MaoC (monoamine 99.84
cd03451146 FkbR2 FkbR2 is a Streptomyces hygroscopicus protei 99.84
PRK08190 466 bifunctional enoyl-CoA hydratase/phosphate acetylt 99.82
cd03454140 YdeM YdeM is a Bacillus subtilis protein that belo 99.81
cd03450149 NodN NodN (nodulation factor N) contains a single 99.8
PRK13691166 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Pro 99.78
PRK13692159 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Pro 99.76
TIGR02278663 PaaN-DH phenylacetic acid degradation protein paaN 99.71
PRK11563675 bifunctional aldehyde dehydrogenase/enoyl-CoA hydr 99.69
PF13452132 MaoC_dehydrat_N: N-terminal half of MaoC dehydrata 99.37
PRK13691166 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Pro 99.11
PF13452132 MaoC_dehydrat_N: N-terminal half of MaoC dehydrata 99.07
PRK13692159 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Pro 99.0
PRK04424185 fatty acid biosynthesis transcriptional regulator; 98.57
cd01288131 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier 98.43
PRK00006147 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Review 98.42
cd03452142 MaoC_C MaoC_C The C-terminal hot dog fold of the M 98.34
cd03454140 YdeM YdeM is a Bacillus subtilis protein that belo 98.23
cd03446140 MaoC_like MoaC_like Similar to the MaoC (monoamine 98.19
cd03451146 FkbR2 FkbR2 is a Streptomyces hygroscopicus protei 98.13
PRK13188464 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetyl 98.06
cd03450149 NodN NodN (nodulation factor N) contains a single 98.06
TIGR02286114 PaaD phenylacetic acid degradation protein PaaD. S 97.96
cd03441127 R_hydratase_like (R)-hydratase [(R)-specific enoyl 97.95
cd03449128 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA 97.94
TIGR01750140 fabZ beta-hydroxyacyl-[acyl carrier protein] dehyd 97.87
cd03453127 SAV4209_like SAV4209_like. Similar in sequence to 97.86
cd03455123 SAV4209 SAV4209 is a Streptomyces avermitilis prot 97.78
cd03440100 hot_dog The hotdog fold was initially identified i 97.69
cd00493131 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier pr 97.62
PRK08190 466 bifunctional enoyl-CoA hydratase/phosphate acetylt 97.58
PF0306179 4HBT: Thioesterase superfamily; InterPro: IPR00668 97.52
COG2030159 MaoC Acyl dehydratase [Lipid metabolism] 97.51
PLN02864 310 enoyl-CoA hydratase 97.39
cd03443113 PaaI_thioesterase PaaI_thioesterase is a tetrameri 97.21
TIGR02278663 PaaN-DH phenylacetic acid degradation protein paaN 97.12
cd0344594 Thioesterase_II_repeat2 Thioesterase II (TEII) is 97.02
TIGR00369117 unchar_dom_1 uncharacterized domain 1. Most protei 96.99
PRK11563675 bifunctional aldehyde dehydrogenase/enoyl-CoA hydr 96.87
cd00586110 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT). Cat 96.86
cd03447126 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of t 96.82
COG2050141 PaaI HGG motif-containing thioesterase, possibly i 96.78
cd00586110 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT). Cat 96.77
PRK00006147 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Review 96.66
cd03442123 BFIT_BACH Brown fat-inducible thioesterase (BFIT). 96.55
cd03440100 hot_dog The hotdog fold was initially identified i 96.51
COG0764147 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl ca 96.5
TIGR02286114 PaaD phenylacetic acid degradation protein PaaD. S 96.47
cd01289138 FabA_like Domain of unknown function, appears to b 96.41
PRK11688154 hypothetical protein; Provisional 96.39
PF13622 255 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 96.36
PF07977138 FabA: FabA-like domain; InterPro: IPR013114 Fatty 96.32
PRK10800130 acyl-CoA thioesterase YbgC; Provisional 96.24
PLN02322154 acyl-CoA thioesterase 96.2
PF0306179 4HBT: Thioesterase superfamily; InterPro: IPR00668 96.2
PLN02647437 acyl-CoA thioesterase 96.15
COG5496130 Predicted thioesterase [General function predictio 96.12
PRK10293136 acyl-CoA esterase; Provisional 96.03
cd0055699 Thioesterase_II Thioesterase II (TEII) is thought 96.03
PRK10800130 acyl-CoA thioesterase YbgC; Provisional 95.99
TIGR01749169 fabA beta-hydroxyacyl-[acyl carrier protein] dehyd 95.93
PRK10254137 thioesterase; Provisional 95.91
PRK04424185 fatty acid biosynthesis transcriptional regulator; 95.88
PF13279121 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 95.81
TIGR00369117 unchar_dom_1 uncharacterized domain 1. Most protei 95.75
COG0824137 FcbC Predicted thioesterase [General function pred 95.71
TIGR00189 271 tesB acyl-CoA thioesterase II. Subunit: homotetram 95.64
COG1607157 Acyl-CoA hydrolase [Lipid metabolism] 95.64
cd01288131 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier 95.6
PRK05174172 3-hydroxydecanoyl-(acyl carrier protein) dehydrata 95.54
TIGR02799126 thio_ybgC tol-pal system-associated acyl-CoA thioe 95.53
PLN02370419 acyl-ACP thioesterase 95.5
cd03442123 BFIT_BACH Brown fat-inducible thioesterase (BFIT). 95.32
PRK11688154 hypothetical protein; Provisional 95.31
cd03443113 PaaI_thioesterase PaaI_thioesterase is a tetrameri 95.29
PRK10694133 acyl-CoA esterase; Provisional 95.19
cd01287150 FabA FabA, beta-hydroxydecanoyl-acyl carrier prote 95.19
TIGR02799126 thio_ybgC tol-pal system-associated acyl-CoA thioe 95.15
TIGR01750140 fabZ beta-hydroxyacyl-[acyl carrier protein] dehyd 95.08
cd01287150 FabA FabA, beta-hydroxydecanoyl-acyl carrier prote 95.05
PF07977138 FabA: FabA-like domain; InterPro: IPR013114 Fatty 95.04
PRK10526 286 acyl-CoA thioesterase II; Provisional 94.9
COG0824137 FcbC Predicted thioesterase [General function pred 94.9
PF01643261 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR0 94.88
PF12119 218 DUF3581: Protein of unknown function (DUF3581); In 94.75
TIGR00051117 acyl-CoA thioester hydrolase, YbgC/YbaW family. Th 94.51
KOG3328148 consensus HGG motif-containing thioesterase [Gener 94.11
COG2050141 PaaI HGG motif-containing thioesterase, possibly i 94.05
PF13279121 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 93.95
COG1607157 Acyl-CoA hydrolase [Lipid metabolism] 93.84
cd00493131 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier pr 93.82
TIGR02447138 yiiD_Cterm thioesterase domain, putative. This fam 93.78
PRK10254137 thioesterase; Provisional 93.73
PRK13188464 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetyl 93.38
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 93.17
PF01575122 MaoC_dehydratas: MaoC like domain; InterPro: IPR00 93.14
cd0055699 Thioesterase_II Thioesterase II (TEII) is thought 92.96
TIGR00051117 acyl-CoA thioester hydrolase, YbgC/YbaW family. Th 92.88
PRK10694133 acyl-CoA esterase; Provisional 92.74
PLN02322154 acyl-CoA thioesterase 92.64
PRK10293136 acyl-CoA esterase; Provisional 92.43
cd03448122 HDE_HSD HDE_HSD The R-hydratase-like hot dog fold 90.76
TIGR02447138 yiiD_Cterm thioesterase domain, putative. This fam 90.75
COG1946289 TesB Acyl-CoA thioesterase [Lipid metabolism] 90.25
PLN02868 413 acyl-CoA thioesterase family protein 90.23
PRK05174172 3-hydroxydecanoyl-(acyl carrier protein) dehydrata 89.4
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 89.09
cd01289138 FabA_like Domain of unknown function, appears to b 87.4
TIGR00189271 tesB acyl-CoA thioesterase II. Subunit: homotetram 86.82
TIGR01749169 fabA beta-hydroxyacyl-[acyl carrier protein] dehyd 86.77
PF14539132 DUF4442: Domain of unknown function (DUF4442); PDB 86.33
PRK10526286 acyl-CoA thioesterase II; Provisional 86.33
PLN02647437 acyl-CoA thioesterase 86.32
PRK13693142 (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Pro 86.21
COG0764147 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl ca 84.5
cd03444104 Thioesterase_II_repeat1 Thioesterase II (TEII) is 83.01
KOG3328148 consensus HGG motif-containing thioesterase [Gener 82.38
>PLN02864 enoyl-CoA hydratase Back     alignment and domain information 
Probab=100.00  E-value=1.7e-46  Score=318.96  Aligned_cols=223  Identities=78%  Similarity=1.237  Sum_probs=194.5

Q ss_pred             CCCCCceeEeceEEEEEccCCCCCEEEEEEEEeEEEEcCCeEEEEEEEEEEECCCCcEEEEEEEEEEEeCcCCCCCCCCC
Q 027032            7 RHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSSQP   86 (229)
Q Consensus         7 ~~~~~~~vH~~~~~~~~~Pl~~g~~l~~~~~i~~v~~~g~g~~v~~~~~~~~~~~g~~v~~~~~t~~~r~~~~~~~~~~p   86 (229)
                      +||+.++||++|+|++||||+++++|+++++|.++++||+|.++++++++++.++|+++|+.++|+++|+.+++++++.+
T Consensus        88 ~~d~~~lVHgeq~i~~~rPlp~~~~l~~~~~v~~v~dkG~ga~v~~~~~~~d~~~Ge~v~t~~st~~~Rg~gg~g~~~~~  167 (310)
T PLN02864         88 NYDPSLLLHGQQYIEIYKPIPSSASVRNKVSIAGLHDKGKAAILELETLSYEKDSGELLCMNRSTIFLRGAGGFSNSSQP  167 (310)
T ss_pred             CCChhheeeccceEEEECCCCCCCEEEEEEEEEEEEeCCCcEEEEEEEEEEeCCCCcEEEEEEEEEEEeCCCCCCCCCCC
Confidence            68999999999999999999999999999999999999999999999988865689999999999999999877755433


Q ss_pred             CCCCccCCCCccccCCCCCCCCEEEeecChhhHHHHHhhhCCCCCCCCCHHHHHhCCCCCceechhHHHHHHHHHHHHHH
Q 027032           87 FSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFI  166 (229)
Q Consensus        87 ~~~~~~~~~~~~~~~~p~~~p~~~~~~~~~~~~~~~~~~sgd~npiH~d~~~A~~~G~~~~i~hG~~~~~~~~~~~~~~~  166 (229)
                      ......+..+....+.|++.|+...+..+..++.+||++|||+||||+|+++|+..||+++|+||||+++++.+++.+++
T Consensus       168 ~~~~~~~~~~~~~~~~p~~~pd~~~~~~t~~~~~~~a~lSGD~NPiH~d~~~A~~~gf~~~IaHGm~t~g~~~~~~~~~~  247 (310)
T PLN02864        168 FSYSNYPTNQVSAVKIPKSQPDAVFEDQTQPSQALLYRLSGDYNPLHSDPMFAKVAGFTRPILHGLCTLGFAVRAVIKCF  247 (310)
T ss_pred             ccccccccccccccCCCCCCCCeEEeeccChhHHHHHHhhCCCCcccCCHHHHhhCCCCCceeccHHHHHHHHHHHHhhh
Confidence            11011111111123456678899888899999999999999999999999999999999999999999999999988887


Q ss_pred             ccCCCceeeEEEEEECcCCCCCCEEEEEEEEECcEEEEEEEEccCCeEEEEEEEEEEecCCCC
Q 027032          167 CRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSGFVDVHRLASSL  229 (229)
Q Consensus       167 ~~~~~~~~~~~~~rf~~Pv~~gd~l~~~~~~~~~~v~~~~~~~~~g~~v~~g~~~~~~~~~~~  229 (229)
                      .++++..+.++++||.+||++||+|+++.|.+++.+.|++.+|++|++|++|.+++..+.|||
T Consensus       248 ~~~~~~~~~~~~~rF~~PV~pGdtl~~~~~~~~~~v~~~~~~~~~g~~vl~G~a~~~~~~~~~  310 (310)
T PLN02864        248 CNGDPTAVKTISGRFLLHVYPGETLVTEMWLEGLRVIYQTKVKERNKAVLSGYVDLRHLTSSL  310 (310)
T ss_pred             cCCCCceEEEEEEEEcCCccCCCEEEEEEEeCCCEEEEEEEEecCCeEEEEEEEEEecccCCC
Confidence            777778888999999999999999999999888889999888899999999999999999886

>KOG1206 consensus Peroxisomal multifunctional beta-oxidation protein and related enzymes [Lipid transport and metabolism] Back     alignment and domain information
>cd03448 HDE_HSD HDE_HSD The R-hydratase-like hot dog fold of the 17-beta-hydroxysteriod dehydrogenase (HSD), and Hydratase-Dehydrogenase-Epimerase (HDE) proteins Back     alignment and domain information
>cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit Back     alignment and domain information
>cd03453 SAV4209_like SAV4209_like Back     alignment and domain information
>cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit Back     alignment and domain information
>COG3777 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway Back     alignment and domain information
>PRK13693 (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Provisional Back     alignment and domain information
>cd03452 MaoC_C MaoC_C The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein Back     alignment and domain information
>cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase] Back     alignment and domain information
>COG2030 MaoC Acyl dehydratase [Lipid metabolism] Back     alignment and domain information
>PF01575 MaoC_dehydratas: MaoC like domain; InterPro: IPR002539 The C terminus of the MaoC protein is found to share similarity with a wide variety of enzymes Back     alignment and domain information
>cd03446 MaoC_like MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain Back     alignment and domain information
>cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes Back     alignment and domain information
>PRK08190 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated Back     alignment and domain information
>cd03454 YdeM YdeM is a Bacillus subtilis protein that belongs to a family of prokaryotic proteins of unkown function Back     alignment and domain information
>cd03450 NodN NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit Back     alignment and domain information
>PRK13691 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional Back     alignment and domain information
>PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional Back     alignment and domain information
>TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PF13452 MaoC_dehydrat_N: N-terminal half of MaoC dehydratase; PDB: 3HMJ_H 2UV8_I 2VKZ_G 1S9C_K 3OML_A 3KHP_A Back     alignment and domain information
>PRK13691 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional Back     alignment and domain information
>PF13452 MaoC_dehydrat_N: N-terminal half of MaoC dehydratase; PDB: 3HMJ_H 2UV8_I 2VKZ_G 1S9C_K 3OML_A 3KHP_A Back     alignment and domain information
>PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional Back     alignment and domain information
>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional Back     alignment and domain information
>cd01288 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway Back     alignment and domain information
>PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed Back     alignment and domain information
>cd03452 MaoC_C MaoC_C The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein Back     alignment and domain information
>cd03454 YdeM YdeM is a Bacillus subtilis protein that belongs to a family of prokaryotic proteins of unkown function Back     alignment and domain information
>cd03446 MaoC_like MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain Back     alignment and domain information
>cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes Back     alignment and domain information
>PRK13188 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed Back     alignment and domain information
>cd03450 NodN NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit Back     alignment and domain information
>TIGR02286 PaaD phenylacetic acid degradation protein PaaD Back     alignment and domain information
>cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase] Back     alignment and domain information
>cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway Back     alignment and domain information
>TIGR01750 fabZ beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ Back     alignment and domain information
>cd03453 SAV4209_like SAV4209_like Back     alignment and domain information
>cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit Back     alignment and domain information
>cd03440 hot_dog The hotdog fold was initially identified in the E Back     alignment and domain information
>cd00493 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation Back     alignment and domain information
>PRK08190 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated Back     alignment and domain information
>PF03061 4HBT: Thioesterase superfamily; InterPro: IPR006683 This family contains a wide variety of enzymes, principally thioesterases Back     alignment and domain information
>COG2030 MaoC Acyl dehydratase [Lipid metabolism] Back     alignment and domain information
>PLN02864 enoyl-CoA hydratase Back     alignment and domain information
>cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria Back     alignment and domain information
>TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN Back     alignment and domain information
>cd03445 Thioesterase_II_repeat2 Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively Back     alignment and domain information
>TIGR00369 unchar_dom_1 uncharacterized domain 1 Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd00586 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT) Back     alignment and domain information
>cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit Back     alignment and domain information
>COG2050 PaaI HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd00586 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT) Back     alignment and domain information
>PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed Back     alignment and domain information
>cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT) Back     alignment and domain information
>cd03440 hot_dog The hotdog fold was initially identified in the E Back     alignment and domain information
>COG0764 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases [Lipid metabolism] Back     alignment and domain information
>TIGR02286 PaaD phenylacetic acid degradation protein PaaD Back     alignment and domain information
>cd01289 FabA_like Domain of unknown function, appears to be related to a diverse group of beta-hydroxydecanoyl ACP dehydratases (FabA) and beta-hydroxyacyl ACP dehydratases (FabZ) Back     alignment and domain information
>PRK11688 hypothetical protein; Provisional Back     alignment and domain information
>PF13622 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 3RQB_A 3CJY_A 3RD7_A 3BBJ_B Back     alignment and domain information
>PF07977 FabA: FabA-like domain; InterPro: IPR013114 Fatty acids biosynthesis occurs by two distinct pathways: in fungi, mammals and mycobacteria, type I or associative fatty-acid biosynthesis (type I FAS) is accomplished by multifunctional proteins in which distinct domains catalyse specific reactions; in plants and most bacteria, type II or dissociative fatty-acid biosynthesis (type II FAS) is accomplished by distinct enzymes [] Back     alignment and domain information
>PRK10800 acyl-CoA thioesterase YbgC; Provisional Back     alignment and domain information
>PLN02322 acyl-CoA thioesterase Back     alignment and domain information
>PF03061 4HBT: Thioesterase superfamily; InterPro: IPR006683 This family contains a wide variety of enzymes, principally thioesterases Back     alignment and domain information
>PLN02647 acyl-CoA thioesterase Back     alignment and domain information
>COG5496 Predicted thioesterase [General function prediction only] Back     alignment and domain information
>PRK10293 acyl-CoA esterase; Provisional Back     alignment and domain information
>cd00556 Thioesterase_II Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively Back     alignment and domain information
>PRK10800 acyl-CoA thioesterase YbgC; Provisional Back     alignment and domain information
>TIGR01749 fabA beta-hydroxyacyl-[acyl carrier protein] dehydratase FabA Back     alignment and domain information
>PRK10254 thioesterase; Provisional Back     alignment and domain information
>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional Back     alignment and domain information
>PF13279 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 3CK1_A 2GF6_C 2NUJ_A 2HLJ_A 2XFL_B 2XEM_B 2OIW_B 2HX5_A 2FUJ_A Back     alignment and domain information
>TIGR00369 unchar_dom_1 uncharacterized domain 1 Back     alignment and domain information
>COG0824 FcbC Predicted thioesterase [General function prediction only] Back     alignment and domain information
>TIGR00189 tesB acyl-CoA thioesterase II Back     alignment and domain information
>COG1607 Acyl-CoA hydrolase [Lipid metabolism] Back     alignment and domain information
>cd01288 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway Back     alignment and domain information
>PRK05174 3-hydroxydecanoyl-(acyl carrier protein) dehydratase; Validated Back     alignment and domain information
>TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase Back     alignment and domain information
>PLN02370 acyl-ACP thioesterase Back     alignment and domain information
>cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT) Back     alignment and domain information
>PRK11688 hypothetical protein; Provisional Back     alignment and domain information
>cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria Back     alignment and domain information
>PRK10694 acyl-CoA esterase; Provisional Back     alignment and domain information
>cd01287 FabA FabA, beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase: Bacterial protein of the type II, fatty acid synthase system that binds ACP and catalyzes both dehydration and isomerization reactions, apparently in the same active site Back     alignment and domain information
>TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase Back     alignment and domain information
>TIGR01750 fabZ beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ Back     alignment and domain information
>cd01287 FabA FabA, beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase: Bacterial protein of the type II, fatty acid synthase system that binds ACP and catalyzes both dehydration and isomerization reactions, apparently in the same active site Back     alignment and domain information
>PF07977 FabA: FabA-like domain; InterPro: IPR013114 Fatty acids biosynthesis occurs by two distinct pathways: in fungi, mammals and mycobacteria, type I or associative fatty-acid biosynthesis (type I FAS) is accomplished by multifunctional proteins in which distinct domains catalyse specific reactions; in plants and most bacteria, type II or dissociative fatty-acid biosynthesis (type II FAS) is accomplished by distinct enzymes [] Back     alignment and domain information
>PRK10526 acyl-CoA thioesterase II; Provisional Back     alignment and domain information
>COG0824 FcbC Predicted thioesterase [General function prediction only] Back     alignment and domain information
>PF01643 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR002864 This entry represents various acyl-acyl carrier protein (ACP) thioesterases (TE) which terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid [] Back     alignment and domain information
>PF12119 DUF3581: Protein of unknown function (DUF3581); InterPro: IPR021974 This family consists of uncharacterised bacterial proteins Back     alignment and domain information
>TIGR00051 acyl-CoA thioester hydrolase, YbgC/YbaW family Back     alignment and domain information
>KOG3328 consensus HGG motif-containing thioesterase [General function prediction only] Back     alignment and domain information
>COG2050 PaaI HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF13279 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 3CK1_A 2GF6_C 2NUJ_A 2HLJ_A 2XFL_B 2XEM_B 2OIW_B 2HX5_A 2FUJ_A Back     alignment and domain information
>COG1607 Acyl-CoA hydrolase [Lipid metabolism] Back     alignment and domain information
>cd00493 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation Back     alignment and domain information
>TIGR02447 yiiD_Cterm thioesterase domain, putative Back     alignment and domain information
>PRK10254 thioesterase; Provisional Back     alignment and domain information
>PRK13188 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PF01575 MaoC_dehydratas: MaoC like domain; InterPro: IPR002539 The C terminus of the MaoC protein is found to share similarity with a wide variety of enzymes Back     alignment and domain information
>cd00556 Thioesterase_II Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively Back     alignment and domain information
>TIGR00051 acyl-CoA thioester hydrolase, YbgC/YbaW family Back     alignment and domain information
>PRK10694 acyl-CoA esterase; Provisional Back     alignment and domain information
>PLN02322 acyl-CoA thioesterase Back     alignment and domain information
>PRK10293 acyl-CoA esterase; Provisional Back     alignment and domain information
>cd03448 HDE_HSD HDE_HSD The R-hydratase-like hot dog fold of the 17-beta-hydroxysteriod dehydrogenase (HSD), and Hydratase-Dehydrogenase-Epimerase (HDE) proteins Back     alignment and domain information
>TIGR02447 yiiD_Cterm thioesterase domain, putative Back     alignment and domain information
>COG1946 TesB Acyl-CoA thioesterase [Lipid metabolism] Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>PRK05174 3-hydroxydecanoyl-(acyl carrier protein) dehydratase; Validated Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>cd01289 FabA_like Domain of unknown function, appears to be related to a diverse group of beta-hydroxydecanoyl ACP dehydratases (FabA) and beta-hydroxyacyl ACP dehydratases (FabZ) Back     alignment and domain information
>TIGR00189 tesB acyl-CoA thioesterase II Back     alignment and domain information
>TIGR01749 fabA beta-hydroxyacyl-[acyl carrier protein] dehydratase FabA Back     alignment and domain information
>PF14539 DUF4442: Domain of unknown function (DUF4442); PDB: 1YOC_B 1SH8_B Back     alignment and domain information
>PRK10526 acyl-CoA thioesterase II; Provisional Back     alignment and domain information
>PLN02647 acyl-CoA thioesterase Back     alignment and domain information
>PRK13693 (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Provisional Back     alignment and domain information
>COG0764 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases [Lipid metabolism] Back     alignment and domain information
>cd03444 Thioesterase_II_repeat1 Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively Back     alignment and domain information
>KOG3328 consensus HGG motif-containing thioesterase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
1s9c_A298 Crystal Structure Analysis Of The 2-Enoyl-Coa Hydra 1e-44
3oml_A613 Structure Of Full-Length Peroxisomal Multifunctiona 1e-39
2cdh_S248 Architecture Of The Thermomyces Lanuginosus Fungal 2e-37
3kh8_A332 Crystal Structure Of Maoc-Like Dehydratase From Phy 3e-37
3khp_A311 Crystal Structure Of A Possible Dehydrogenase From 8e-28
1pn2_A280 Crystal Structure Analysis Of The Selenomethionine 7e-23
1pn4_A280 Crystal Structure Of 2-Enoyl-Coa Hydratase 2 Domain 1e-22
1iq6_A134 (R)-Hydratase From A. Caviae Involved In Pha Biosyn 5e-04
>pdb|1S9C|A Chain A, Crystal Structure Analysis Of The 2-Enoyl-Coa Hydratase 2 Domain Of Human Peroxisomal Multifunctional Enzyme Type 2 Length = 298 Back     alignment and structure 
Iteration: 1

 Score =  176 bits (445), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 130/212 (61%), Gaps = 12/212 (5%)
Query: 13  LLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTA 72
           +LHG+QY+ELYKP P +  ++ EA +A + DKG   ++ ++  SY+ +  EL+C N+ + 
Sbjct: 87  VLHGEQYLELYKPLPRAGKLKCEAVVADVLDKGSGVVIIMDVYSYSEK--ELICHNQFSL 144
Query: 73  FLRGAGGFSNSSQPFSYSKYQTIPVSV-VKIPKSQPFAVFEDYTQPSQALVYRLSGDYNP 131
           FL G+GGF          K  +  V V V IP   P AV  D T  +QA +YRLSGD+NP
Sbjct: 145 FLVGSGGFGG--------KRTSDKVKVAVAIPNRPPDAVLTDTTSLNQAALYRLSGDWNP 196
Query: 132 LHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVYPGETL 191
           LH DP  A  AGF +PILHGLCT GF+ R +++     D +  K + +RF   VYPG+TL
Sbjct: 197 LHIDPNFASLAGFDKPILHGLCTFGFSARRVLQQFADNDVSRFKAVKARFAKPVYPGQTL 256
Query: 192 VTEMWLQGLRVIYQVKVKERNRSALS-GFVDV 222
            TEMW +G R+ +Q KV+E     +S  +VD+
Sbjct: 257 QTEMWKEGNRIHFQTKVQETGDIVISNAYVDL 288
>pdb|3OML|A Chain A, Structure Of Full-Length Peroxisomal Multifunctional Enzyme Type 2 From Drosophila Melanogaster Length = 613 Back     alignment and structure
>pdb|2CDH|S Chain S, Architecture Of The Thermomyces Lanuginosus Fungal Fatty Acid Synthase At 5 Angstrom Resolution. Length = 248 Back     alignment and structure
>pdb|3KH8|A Chain A, Crystal Structure Of Maoc-Like Dehydratase From Phytophthora Capsici Length = 332 Back     alignment and structure
>pdb|3KHP|A Chain A, Crystal Structure Of A Possible Dehydrogenase From Mycobacterium Tuberculosis At 2.3a Resolution Length = 311 Back     alignment and structure
>pdb|1PN2|A Chain A, Crystal Structure Analysis Of The Selenomethionine Labelled 2-Enoyl-Coa Hydratase 2 Domain Of Candida Tropicalis Multifunctional Enzyme Type 2 Length = 280 Back     alignment and structure
>pdb|1PN4|A Chain A, Crystal Structure Of 2-Enoyl-Coa Hydratase 2 Domain Of Candida Tropicalis Multifunctional Enzyme Type 2 Complexed With (3r)-Hydroxydecanoyl-Coa. Length = 280 Back     alignment and structure
>pdb|1IQ6|A Chain A, (R)-Hydratase From A. Caviae Involved In Pha Biosynthesis Length = 134 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
3oml_A613 GH14720P, peroxisomal multifunctional enzyme type 2e-99
3kh8_A332 MAOC-like dehydratase; hot DOG domain, lyase; 2.00 4e-63
1s9c_A298 Peroxisomal multifunctional enzyme type 2; hot-DOG 3e-62
1pn2_A280 Peroxisomal hydratase-dehydrogenase-epimerase; hot 9e-61
3khp_A311 MAOC family protein; dehydrogenase, oxidoreductase 5e-55
3ir3_A148 HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc 5e-14
2b3n_A159 Hypothetical protein AF1124; structural genomics, 5e-14
1iq6_A134 (R)-hydratase, (R)-specific enoyl-COA hydratase; p 2e-13
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 2e-12
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 3e-11
1q6w_A161 Monoamine oxidase regulatory protein, putative; st 1e-09
4e3e_A 352 MAOC domain protein dehydratase; structural genomi 2e-08
4e3e_A352 MAOC domain protein dehydratase; structural genomi 2e-08
4ffu_A176 Oxidase; structural genomics, protein structure in 3e-08
3exz_A154 MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A 6e-08
2bi0_A 337 Hypothetical protein RV0216; conserved hypothetica 8e-08
2c2i_A151 RV0130; hotdog, hydratase, lyase, structural prote 2e-06
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Length = 613 Back     alignment and structure
 Score =  300 bits (770), Expect = 2e-99
 Identities = 83/222 (37%), Positives = 123/222 (55%), Gaps = 8/222 (3%)

Query: 9   DPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMN 68
           D   +LHG+QY+E+    P+S ++     +  + DKG  A++   ++S++ ESG LL  N
Sbjct: 391 DFSNILHGEQYLEIVDDLPTSGTLLTNGKVFDVMDKGSGAVVVTNSESFD-ESGRLLVRN 449

Query: 69  RMTAFLRGAGGFSNSSQPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLSGD 128
           + T F+ GAG F     P +        V +   P  QP A  +  T   QA +YRLSGD
Sbjct: 450 QSTTFIVGAGKFGGKKDPIAG------VVPLQPAPNRQPDATVQYTTSEDQAALYRLSGD 503

Query: 129 YNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVYPG 188
            NPLH DP +A  AGF  PILHGLCT+GF+VRA++      +P + K +  RF   V PG
Sbjct: 504 KNPLHIDPQMALLAGFKTPILHGLCTLGFSVRAVLAQFADNNPALFKAVKVRFSGPVIPG 563

Query: 189 ETLVTEMWLQGLRVIYQVKVKERNRSALS-GFVDVHRLASSL 229
           +TL  ++W QG R+ ++  V E  +  +S  +VD+    + L
Sbjct: 564 QTLRVDLWKQGTRINFRTVVVETGKEVISGAYVDLKSSQAKL 605
>3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} Length = 332 Back     alignment and structure
>1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S Length = 298 Back     alignment and structure
>1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A* Length = 280 Back     alignment and structure
>3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV} Length = 311 Back     alignment and structure
>3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} Length = 148 Back     alignment and structure
>2b3n_A Hypothetical protein AF1124; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.25A {Archaeoglobus fulgidus} SCOP: d.38.1.4 PDB: 2b3m_A 3k67_A Length = 159 Back     alignment and structure
>1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 Length = 134 Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Length = 2060 Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Length = 2051 Back     alignment and structure
>1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus} SCOP: d.38.1.4 Length = 161 Back     alignment and structure
>4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus} Length = 352 Back     alignment and structure
>4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus} Length = 352 Back     alignment and structure
>4ffu_A Oxidase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgrc, PS biology; HET: MSE; 1.80A {Sinorhizobium meliloti} Length = 176 Back     alignment and structure
>3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structur genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum} Length = 154 Back     alignment and structure
>2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 Length = 337 Back     alignment and structure
>2c2i_A RV0130; hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics; 1.8A {Mycobacterium tuberculosis} SCOP: d.38.1.4 Length = 151 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query229
3kh8_A332 MAOC-like dehydratase; hot DOG domain, lyase; 2.00 100.0
3khp_A311 MAOC family protein; dehydrogenase, oxidoreductase 100.0
1pn2_A280 Peroxisomal hydratase-dehydrogenase-epimerase; hot 100.0
1s9c_A298 Peroxisomal multifunctional enzyme type 2; hot-DOG 100.0
3oml_A613 GH14720P, peroxisomal multifunctional enzyme type 100.0
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 100.0
4e3e_A352 MAOC domain protein dehydratase; structural genomi 99.96
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 99.96
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 99.96
3k67_A159 Putative dehydratase AF1124; hypothetical protein 99.92
2b3n_A159 Hypothetical protein AF1124; structural genomics, 99.9
3ir3_A148 HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc 99.9
1iq6_A134 (R)-hydratase, (R)-specific enoyl-COA hydratase; p 99.89
3exz_A154 MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A 99.88
4ffu_A176 Oxidase; structural genomics, protein structure in 99.88
1q6w_A161 Monoamine oxidase regulatory protein, putative; st 99.87
2bi0_A337 Hypothetical protein RV0216; conserved hypothetica 99.87
2c2i_A151 RV0130; hotdog, hydratase, lyase, structural prote 99.86
4e3e_A 352 MAOC domain protein dehydratase; structural genomi 99.79
2bi0_A 337 Hypothetical protein RV0216; conserved hypothetica 99.78
2ov9_A216 Hypothetical protein; rhodococcus SP. RHA1, RHA085 98.82
2f41_A121 Transcription factor FAPR; 'HOT-DOG' fold, gene re 98.79
1z6b_A154 Pffabz, fatty acid synthesis protein; malaria, bet 98.78
2f3x_A157 Transcription factor FAPR; 'HOT-DOG' fold / malony 98.71
1u1z_A168 (3R)-hydroxymyristoyl-[acyl carrier protein] dehyd 98.57
3bnv_A152 CJ0977; virulence factor, hot-DOG fold, flagel unk 98.55
1ixl_A131 Hypothetical protein PH1136; alpha+beta, hot-DOG-f 98.53
3lw3_A145 HP0420 homologue; hotdog-fold, structural genomics 98.44
3d6x_A146 (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; 98.42
2cf2_C342 Fatty acid synthase, DH domain; transferase, fatty 98.41
4ffu_A176 Oxidase; structural genomics, protein structure in 98.31
1q6w_A161 Monoamine oxidase regulatory protein, putative; st 98.31
2fs2_A151 Phenylacetic acid degradation protein PAAI; operon 98.26
2gvh_A288 AGR_L_2016P; 15159470, acyl-COA hydrolase, structu 98.26
2c2i_A151 RV0130; hotdog, hydratase, lyase, structural prote 98.25
4gak_A250 Acyl-ACP thioesterase; MCSG, PSI-biology, structur 98.25
2gll_A171 FABZ, (3R)-hydroxymyristoyl-acyl carrier protein d 98.24
3exz_A154 MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A 98.18
3esi_A129 Uncharacterized protein; protein from erwinia caro 98.12
2h4u_A145 Thioesterase superfamily member 2; structural geno 98.1
2own_A262 Putative oleoyl-[acyl-carrier protein] thioestera; 98.09
1iq6_A134 (R)-hydratase, (R)-specific enoyl-COA hydratase; p 98.08
3b7k_A333 Acyl-coenzyme A thioesterase 12; hotdog fold, stru 98.07
3f5o_A148 Thioesterase superfamily member 2; hotdog fold, hy 98.03
2pim_A141 Phenylacetic acid degradation-related protein; thi 98.03
2ess_A248 Acyl-ACP thioesterase; NP_810988.1, structural gen 98.01
2hbo_A158 Hypothetical protein (NP_422103.1); thioesterase/t 97.99
2cwz_A141 Thioesterase family protein; structural genomics, 97.97
1wlu_A136 PAAI protein, phenylacetic acid degradation protei 97.95
4i82_A137 Putative uncharacterized protein; PAAI/YDII-like, 97.92
2prx_A160 Thioesterase superfamily protein; ZP_00837258.1, s 97.92
3ir3_A148 HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc 97.91
4i83_A152 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; 97.9
4a0z_A190 Transcription factor FAPR; lipid homeostasis; HET: 97.89
1zki_A133 Hypothetical protein PA5202; structural genomics, 97.86
1vh5_A148 Hypothetical protein YDII; PSI, protein structure 97.85
3lbe_A163 Putative uncharacterized protein SMU.793; hypothet 97.81
4ae7_A220 Thioesterase superfamily member 5; hydrolase, hotd 97.81
2qwz_A159 Phenylacetic acid degradation-related protein; put 97.81
1q4t_A151 Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A 97.79
1vh9_A149 P15, hypothetical protein YBDB; structural genomic 97.71
1s9c_A 298 Peroxisomal multifunctional enzyme type 2; hot-DOG 97.7
2b3n_A159 Hypothetical protein AF1124; structural genomics, 97.69
3nwz_A176 BH2602 protein; structural genomics, PSI-biology, 97.63
3qoo_A138 Uncharacterized protein; structural genomics, PSI- 97.62
3dkz_A142 Thioesterase superfamily protein; Q7W9W5, borpa, P 97.61
3e29_A144 Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, 97.57
1o0i_A138 Hypothetical protein HI1161; structural genomics, 97.54
3f1t_A148 Uncharacterized protein Q9I3C8_pseae; PAR319A, NES 97.5
4ae8_A211 Thioesterase superfamily member 4; hydrolase, hotd 97.5
4h4g_A160 (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; 97.48
3kuv_A139 Fluoroacetyl coenzyme A thioesterase; fluoroacetyl 97.47
3s4k_A144 Putative esterase RV1847/MT1895; seattle structura 97.4
3e1e_A141 Thioesterase family protein; structural genomics, 97.38
3khp_A 311 MAOC family protein; dehydrogenase, oxidoreductase 97.2
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 97.19
3d6l_A137 Putative hydrolase; hot DOG fold, thioesterase, ac 97.17
3bjk_A153 Acyl-COA thioester hydrolase HI0827; hotdog fold, 97.14
2f41_A121 Transcription factor FAPR; 'HOT-DOG' fold, gene re 97.05
3e8p_A164 Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG 97.05
2eis_A133 Hypothetical protein TTHB207; COA binding motif, N 97.04
2q78_A153 Uncharacterized protein; structural genomics, join 97.02
2cye_A133 TTHA1846, putative thioesterase; structural genomi 96.99
3gek_A146 Putative thioesterase YHDA; structure genomics, NE 96.99
3k67_A159 Putative dehydratase AF1124; hypothetical protein 96.95
1ixl_A131 Hypothetical protein PH1136; alpha+beta, hot-DOG-f 96.92
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 96.89
2f3x_A157 Transcription factor FAPR; 'HOT-DOG' fold / malony 96.88
1sh8_A154 Hypothetical protein PA5026; structural genomics, 96.85
3hdu_A157 Putative thioesterase; structural genomics, joint 96.85
2fuj_A137 Conserved hypothetical protein; structural genomic 96.83
2oiw_A136 Putative 4-hydroxybenzoyl-COA thioesterase; struct 96.78
4i82_A137 Putative uncharacterized protein; PAAI/YDII-like, 96.76
3bbj_A 272 Putative thioesterase II; structural genomics, joi 96.75
3f5o_A148 Thioesterase superfamily member 2; hotdog fold, hy 96.71
3lbe_A163 Putative uncharacterized protein SMU.793; hypothet 96.7
2fs2_A151 Phenylacetic acid degradation protein PAAI; operon 96.7
1z6b_A154 Pffabz, fatty acid synthesis protein; malaria, bet 96.62
2egj_A128 Hypothetical protein AQ_1494; structural genomics; 96.62
2cwz_A141 Thioesterase family protein; structural genomics, 96.58
1s5u_A138 Protein YBGC; structural genomics, hypothetical pr 96.58
2hlj_A157 Hypothetical protein; putative thioesterase, struc 96.58
2h4u_A145 Thioesterase superfamily member 2; structural geno 96.53
2fuj_A137 Conserved hypothetical protein; structural genomic 96.53
3cjy_A 259 Putative thioesterase; YP_496845.1, structural gen 96.52
2q2b_A179 Cytosolic acyl coenzyme A thioester hydrolase; ACO 96.52
1sc0_A138 Hypothetical protein HI1161; structural genomics, 96.47
3d6x_A146 (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; 96.46
1u1z_A168 (3R)-hydroxymyristoyl-[acyl carrier protein] dehyd 96.45
3nwz_A176 BH2602 protein; structural genomics, PSI-biology, 96.45
2hlj_A157 Hypothetical protein; putative thioesterase, struc 96.39
4ien_A163 Putative acyl-COA hydrolase; hot DOG fold; HET: CO 96.39
3dkz_A142 Thioesterase superfamily protein; Q7W9W5, borpa, P 96.38
3ck1_A150 Putative thioesterase; structural genomics, joint 96.38
1njk_A156 Hypothetical protein YBAW; structural genomics, th 96.37
2gf6_A135 Conserved hypothetical protein; putative thioester 96.36
1njk_A156 Hypothetical protein YBAW; structural genomics, th 96.35
1z54_A132 Probable thioesterase; hypothetical protein, struc 96.31
3rqb_A 275 Uncharacterized protein; structural genomics, PSI- 96.28
3q62_A175 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; 96.26
1tbu_A118 Peroxisomal acyl-coenzyme A thioester hydrolase 1; 96.23
1y7u_A174 Acyl-COA hydrolase; structural genomics, coenzyme 96.18
2oaf_A151 Thioesterase superfamily; YP_508616.1, structural 96.17
4b0b_A171 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; 96.15
1wlu_A136 PAAI protein, phenylacetic acid degradation protei 96.14
2o5u_A148 Thioesterase; putative thioesterese,, hydrolase; 1 96.13
1yoc_A147 Hypothetical protein PA1835; structural genomics, 96.12
2qq2_A193 Cytosolic acyl coenzyme A thioester hydrolase; ACO 96.1
1c8u_A 285 Acyl-COA thioesterase II; internal repeats, hydrol 96.08
1vh9_A149 P15, hypothetical protein YBDB; structural genomic 96.08
3hdu_A157 Putative thioesterase; structural genomics, joint 96.06
2hx5_A152 Hypothetical protein; thioesterase/thiol ester deh 96.05
3kh8_A 332 MAOC-like dehydratase; hot DOG domain, lyase; 2.00 96.05
2pzh_A135 Hypothetical protein HP_0496; lipid, acyl-COA, bac 96.04
2nuj_A163 Thioesterase superfamily; YP_509914.1, structural 96.04
1vh5_A148 Hypothetical protein YDII; PSI, protein structure 96.04
3r87_A135 Putative uncharacterized protein; unknown function 96.02
2ali_A158 Hypothetical protein PA2801; structural genomics, 95.99
3u0a_A 285 Acyl-COA thioesterase II TESB2; structural genomic 95.99
2egj_A128 Hypothetical protein AQ_1494; structural genomics; 95.98
2gll_A171 FABZ, (3R)-hydroxymyristoyl-acyl carrier protein d 95.98
3s4k_A144 Putative esterase RV1847/MT1895; seattle structura 95.95
1sh8_A154 Hypothetical protein PA5026; structural genomics, 95.92
4h4g_A160 (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; 95.91
1vpm_A169 Acyl-COA hydrolase; NP_241664.1, structural genomi 95.9
2v1o_A151 Cytosolic acyl coenzyme A thioester hydrolase; acy 95.9
2qwz_A159 Phenylacetic acid degradation-related protein; put 95.89
2w3x_A147 CALE7; hydrolase, hotdog fold, thioesterase, enedi 95.89
1o0i_A138 Hypothetical protein HI1161; structural genomics, 95.89
3f1t_A148 Uncharacterized protein Q9I3C8_pseae; PAR319A, NES 95.89
3e8p_A164 Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG 95.89
2ov9_A216 Hypothetical protein; rhodococcus SP. RHA1, RHA085 95.88
2xem_A150 DYNE7, TEBC; biosynthetic protein, polyketide bios 95.88
2eis_A133 Hypothetical protein TTHB207; COA binding motif, N 95.85
3gek_A146 Putative thioesterase YHDA; structure genomics, NE 95.85
1q4t_A151 Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A 95.83
1pn2_A 280 Peroxisomal hydratase-dehydrogenase-epimerase; hot 95.82
2xem_A150 DYNE7, TEBC; biosynthetic protein, polyketide bios 95.77
3bnv_A152 CJ0977; virulence factor, hot-DOG fold, flagel unk 95.77
2cye_A133 TTHA1846, putative thioesterase; structural genomi 95.76
2hbo_A158 Hypothetical protein (NP_422103.1); thioesterase/t 95.76
4i4j_A159 ACP-polyene thioesterase; structural genomics, PSI 95.76
3e29_A144 Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, 95.73
2w3x_A147 CALE7; hydrolase, hotdog fold, thioesterase, enedi 95.69
3d6l_A137 Putative hydrolase; hot DOG fold, thioesterase, ac 95.62
2o5u_A148 Thioesterase; putative thioesterese,, hydrolase; 1 95.61
1zki_A133 Hypothetical protein PA5202; structural genomics, 95.6
1lo7_A141 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, c 95.58
2oiw_A136 Putative 4-hydroxybenzoyl-COA thioesterase; struct 95.58
3ck1_A150 Putative thioesterase; structural genomics, joint 95.56
4i83_A152 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; 95.54
2pzh_A135 Hypothetical protein HP_0496; lipid, acyl-COA, bac 95.52
3rd7_A 286 Acyl-COA thioesterase; seattle structur genomics c 95.51
2prx_A160 Thioesterase superfamily protein; ZP_00837258.1, s 95.5
3r87_A135 Putative uncharacterized protein; unknown function 95.48
1lo7_A141 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, c 95.47
3lw3_A145 HP0420 homologue; hotdog-fold, structural genomics 95.46
2ali_A158 Hypothetical protein PA2801; structural genomics, 95.43
4ae7_A220 Thioesterase superfamily member 5; hydrolase, hotd 95.43
3bjk_A153 Acyl-COA thioester hydrolase HI0827; hotdog fold, 95.34
3hm0_A167 Probable thioesterase; niaid, ssgcid, decode, UW, 95.29
3e1e_A141 Thioesterase family protein; structural genomics, 95.28
1z54_A132 Probable thioesterase; hypothetical protein, struc 95.27
1s5u_A138 Protein YBGC; structural genomics, hypothetical pr 95.27
2nuj_A163 Thioesterase superfamily; YP_509914.1, structural 95.25
4ae8_A211 Thioesterase superfamily member 4; hydrolase, hotd 95.23
3hm0_A167 Probable thioesterase; niaid, ssgcid, decode, UW, 95.17
2hx5_A152 Hypothetical protein; thioesterase/thiol ester deh 95.13
2oaf_A151 Thioesterase superfamily; YP_508616.1, structural 95.12
2gf6_A135 Conserved hypothetical protein; putative thioester 95.06
2pim_A141 Phenylacetic acid degradation-related protein; thi 95.05
4b8u_A171 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; 94.71
4i4j_A159 ACP-polyene thioesterase; structural genomics, PSI 94.69
3qoo_A138 Uncharacterized protein; structural genomics, PSI- 94.69
1sc0_A138 Hypothetical protein HI1161; structural genomics, 94.61
4a0z_A190 Transcription factor FAPR; lipid homeostasis; HET: 94.16
2q2b_A179 Cytosolic acyl coenzyme A thioester hydrolase; ACO 93.78
3kuv_A139 Fluoroacetyl coenzyme A thioesterase; fluoroacetyl 93.62
2qq2_A193 Cytosolic acyl coenzyme A thioester hydrolase; ACO 93.57
4b0b_A171 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; 93.54
2gvh_A 288 AGR_L_2016P; 15159470, acyl-COA hydrolase, structu 93.26
2cf2_C 342 Fatty acid synthase, DH domain; transferase, fatty 93.1
3b7k_A 333 Acyl-coenzyme A thioesterase 12; hotdog fold, stru 92.92
1vpm_A169 Acyl-COA hydrolase; NP_241664.1, structural genomi 92.77
3q62_A175 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; 92.49
2v1o_A151 Cytosolic acyl coenzyme A thioester hydrolase; acy 92.48
4ien_A163 Putative acyl-COA hydrolase; hot DOG fold; HET: CO 92.44
1y7u_A174 Acyl-COA hydrolase; structural genomics, coenzyme 92.33
1yoc_A147 Hypothetical protein PA1835; structural genomics, 92.29
2ess_A 248 Acyl-ACP thioesterase; NP_810988.1, structural gen 91.73
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 91.55
1t82_A155 Hypothetical acetyltransferase; structural genomic 91.34
2own_A 262 Putative oleoyl-[acyl-carrier protein] thioestera; 91.19
1t82_A155 Hypothetical acetyltransferase; structural genomic 90.59
1c8u_A285 Acyl-COA thioesterase II; internal repeats, hydrol 89.96
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 88.98
2q78_A153 Uncharacterized protein; structural genomics, join 88.56
3u0a_A285 Acyl-COA thioesterase II TESB2; structural genomic 88.2
3rd7_A286 Acyl-COA thioesterase; seattle structur genomics c 87.01
4gak_A 250 Acyl-ACP thioesterase; MCSG, PSI-biology, structur 86.78
4b8u_A171 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; 85.93
3cjy_A259 Putative thioesterase; YP_496845.1, structural gen 85.28
>3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} Back     alignment and structure
Probab=100.00  E-value=7.7e-45  Score=310.62  Aligned_cols=210  Identities=40%  Similarity=0.681  Sum_probs=186.7

Q ss_pred             CCCCCCceeEeceEEEEEccC-CCCCEEEEEEEEeEEEEcCCeEEEEEEEEEEECCCCcEEEEEEEEEEEeCcCCCCCCC
Q 027032            6 NRHDPRLLLHGQQYMELYKPF-PSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSS   84 (229)
Q Consensus         6 ~~~~~~~~vH~~~~~~~~~Pl-~~g~~l~~~~~i~~v~~~g~g~~v~~~~~~~~~~~g~~v~~~~~t~~~r~~~~~~~~~   84 (229)
                      |+||+.++||++|+|+||+|| ++|++|+++++|.++++|++|.+++++++ .+ ++|++||++++++++|+.++++++.
T Consensus       116 p~~d~~~lVHgeq~i~~~rPl~~~g~~l~~~s~v~~v~dk~~G~lv~v~~~-~~-~~Gelv~~~~st~~~Rg~~g~g~~~  193 (332)
T 3kh8_A          116 PSFNPAMILHGEQSVEILRPLDPSGGTLTGKTKVISFYDKGKGTLMETQTQ-FE-DGNGPVAKLISGSFIRGLTGYEGKG  193 (332)
T ss_dssp             CCCCTTSEEEEEEEEEESSCCCTTCEEEEEEEEEEEEEECSSEEEEEEEEE-EE-ETTEEEEEEEEEEEEESCCSSCCEE
T ss_pred             CCCCccceEEeccEEEEecCCCCCCCEEEEEEEEEEEEEcCCceEEEEEEE-Ec-cCCeEEEEEEEEEEEEcCCCCCCCC
Confidence            456999999999999999999 99999999999999999999998888888 54 7999999999999999987766533


Q ss_pred             CCCCCCccCCCCccccCCCCCCCCEEEeecChhhHHHHHhhhCCCCCCCCCHHHHHhCCCCCceechhHHHHHHHHHHHH
Q 027032           85 QPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIK  164 (229)
Q Consensus        85 ~p~~~~~~~~~~~~~~~~p~~~p~~~~~~~~~~~~~~~~~~sgd~npiH~d~~~A~~~G~~~~i~hG~~~~~~~~~~~~~  164 (229)
                      .|.         .+..+.|++.|+..++..+.+|+.+||++|||+||||+|+++|+..||+++|+||||+++++.+++..
T Consensus       194 ~p~---------~~~~~~P~~~pd~~~~~~t~~d~~~fa~lsGD~nPiH~D~~~A~~~gf~~~IaHG~~t~al~~~~~~~  264 (332)
T 3kh8_A          194 RKL---------PARVQIPKRQPDFNDEFKTSPHQAQVYRLSGDYNSLHIDPEIAKSVGFKQPILHGLCSMGVASRALFK  264 (332)
T ss_dssp             SCC---------CCCCCCCSSCCSEEEEEECCTTHHHHHGGGSCCCGGGTCHHHHHHTTCSSCCCCHHHHHHHHHHHHHH
T ss_pred             CCC---------CCCCCCCCCCCCeEEecCcHHHHHHHHHHhCCCCCCccCHHHHHhcCCCCceECHHHHHHHHHHHHHH
Confidence            221         11234566678888888899999999999999999999999999999999999999999999999888


Q ss_pred             HHccCCCceeeEEEEEECcCCCCCCEEEEEEEEEC-cEEEEEEEEccCCeEEEE-EEEEEEecC
Q 027032          165 FICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQG-LRVIYQVKVKERNRSALS-GFVDVHRLA  226 (229)
Q Consensus       165 ~~~~~~~~~~~~~~~rf~~Pv~~gd~l~~~~~~~~-~~v~~~~~~~~~g~~v~~-g~~~~~~~~  226 (229)
                      ++.++++..+.++++||.+||++||+|++++++.+ +.+.|++.+||+|++|++ |++++.++.
T Consensus       265 ~~~~~~~~~~~~~~~rF~~PV~~Gdtl~~~~~~~~~g~v~~~~~~~q~g~~Vl~~g~a~~~~p~  328 (332)
T 3kh8_A          265 QFCGGDVARFKSIRVRFSSPCFPGETIQTRMWQEGSGKVLFQAVVKERGAVIVDGGEFVYTQDA  328 (332)
T ss_dssp             HHSTTCGGGEEEEEEEECSCCCTTCEEEEEEEECSTTEEEEEEEETTTTEEEEEEEEEEECCGG
T ss_pred             hhcCCCcceEEEEEEEEecccCCCCEEEEEEEEECCCEEEEEEEEccCCcEEEeCeEEEEecCC
Confidence            87677788889999999999999999999999965 578899888999999997 999999887
>3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A* Back     alignment and structure
>1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus} Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>3k67_A Putative dehydratase AF1124; hypothetical protein AF1124, structural genomics, PSI, protein structure initiative; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A Back     alignment and structure
>2b3n_A Hypothetical protein AF1124; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A 3k67_A Back     alignment and structure
>3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} Back     alignment and structure
>1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 Back     alignment and structure
>3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structur genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>4ffu_A Oxidase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgrc, PS biology; HET: MSE; 1.80A {Sinorhizobium meliloti} Back     alignment and structure
>1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus} SCOP: d.38.1.4 Back     alignment and structure
>2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 Back     alignment and structure
>2c2i_A RV0130; hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics; 1.8A {Mycobacterium tuberculosis} SCOP: d.38.1.4 Back     alignment and structure
>4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus} Back     alignment and structure
>2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 Back     alignment and structure
>2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 Back     alignment and structure
>2f41_A Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>1z6b_A Pffabz, fatty acid synthesis protein; malaria, beta-hydroxyacyl-ACP dehydra fatty acid biosynthesis, SAD phasing, lyase; 2.09A {Plasmodium falciparum} SCOP: d.38.1.6 PDB: 3az8_A* 3az9_A* 3aza_A* 3azb_A* 1zhg_A 2oki_A 2okh_A Back     alignment and structure
>2f3x_A Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>1u1z_A (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; fatty acid biosynthesis, hot DOG fold, lyase; 2.50A {Pseudomonas aeruginosa} SCOP: d.38.1.6 Back     alignment and structure
>3bnv_A CJ0977; virulence factor, hot-DOG fold, flagel unknown function; HET: MSE; 2.60A {Campylobacter jejuni} Back     alignment and structure
>1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown funct; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 Back     alignment and structure
>3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A Back     alignment and structure
>3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; FABZ, hot DOG fold, dehydratase, lipid biosynthesis, lipid synthesis, lyase; HET: MSE; 2.59A {Campylobacter jejuni subsp} Back     alignment and structure
>2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2 Back     alignment and structure
>4ffu_A Oxidase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgrc, PS biology; HET: MSE; 1.80A {Sinorhizobium meliloti} Back     alignment and structure
>1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus} SCOP: d.38.1.4 Back     alignment and structure
>2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A Back     alignment and structure
>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 Back     alignment and structure
>2c2i_A RV0130; hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics; 1.8A {Mycobacterium tuberculosis} SCOP: d.38.1.4 Back     alignment and structure
>4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale} Back     alignment and structure
>2gll_A FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydratase; lyase; 2.20A {Helicobacter pylori} PDB: 2glm_A* 2glp_A* 2glv_A 3dp1_A* 3cf8_A* 3cf9_A* 3d04_A* 3doy_A* 3doz_A* 3dp0_A* 3b7j_A* 3dp2_A* 3dp3_A* 3ed0_A* Back     alignment and structure
>3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structur genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>3esi_A Uncharacterized protein; protein from erwinia carotovora subsp. atroseptica (pectobacterium atrosepticum), structural genomics; 2.50A {Pectobacterium atrosepticum} Back     alignment and structure
>2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 Back     alignment and structure
>2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 Back     alignment and structure
>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} Back     alignment and structure
>3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} SCOP: d.38.1.5 PDB: 2f0x_A* 2cy9_A Back     alignment and structure
>2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} Back     alignment and structure
>2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 Back     alignment and structure
>2cwz_A Thioesterase family protein; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.85A {Thermus thermophilus} SCOP: d.38.1.7 Back     alignment and structure
>1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A Back     alignment and structure
>4i82_A Putative uncharacterized protein; PAAI/YDII-like, hot DOG fold, thioesterase, hydrolase; 2.50A {Streptococcus pneumoniae} Back     alignment and structure
>2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.50A {Shewanella loihica} Back     alignment and structure
>3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} Back     alignment and structure
>4i83_A 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; FABZ, hot DOG fold, thioesterase, lyase; 2.60A {Neisseria meningitidis} Back     alignment and structure
>4a0z_A Transcription factor FAPR; lipid homeostasis; HET: MLC; 1.90A {Staphylococcus aureus} PDB: 4a0y_A 4a0x_A* 4a12_A Back     alignment and structure
>1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A Back     alignment and structure
>3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A* Back     alignment and structure
>4ae7_A Thioesterase superfamily member 5; hydrolase, hotdog-fold; 1.45A {Homo sapiens} Back     alignment and structure
>2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A* Back     alignment and structure
>1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 Back     alignment and structure
>1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S Back     alignment and structure
>2b3n_A Hypothetical protein AF1124; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A 3k67_A Back     alignment and structure
>3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans} Back     alignment and structure
>3qoo_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, hot-DOG superfamily; 1.25A {Thermanaerovibrio acidaminovorans} Back     alignment and structure
>3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis} Back     alignment and structure
>3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} SCOP: d.38.1.0 Back     alignment and structure
>1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} PDB: 1sc0_A 2b6e_A 3lz7_A Back     alignment and structure
>3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} Back     alignment and structure
>4ae8_A Thioesterase superfamily member 4; hydrolase, hotdog-fold; 1.59A {Homo sapiens} PDB: 4gah_A* Back     alignment and structure
>4h4g_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.65A {Burkholderia thailandensis} Back     alignment and structure
>3kuv_A Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA thioesterase FLK, hot DOG folding, thioeste hydrolase; 1.50A {Streptomyces cattleya} PDB: 3kuw_A 3kvu_A* 3p2q_A 3p2r_A 3p2s_A 3kv7_A 3kv8_A 3kvz_A* 3kw1_A* 3kx7_A 3kx8_A 3kvi_A 3p3i_A 3p3f_A Back     alignment and structure
>3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} SCOP: d.38.1.0 Back     alignment and structure
>3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi} Back     alignment and structure
>3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} Back     alignment and structure
>3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* Back     alignment and structure
>2f41_A Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis} Back     alignment and structure
>2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus} Back     alignment and structure
>2q78_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE MLC; 2.20A {Thermotoga maritima MSB8} SCOP: d.38.1.7 Back     alignment and structure
>2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1 Back     alignment and structure
>3gek_A Putative thioesterase YHDA; structure genomics, NESG, KR113, Q9CHK5_lacla, lactococcus L YHDA, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} Back     alignment and structure
>3k67_A Putative dehydratase AF1124; hypothetical protein AF1124, structural genomics, PSI, protein structure initiative; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A Back     alignment and structure
>1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown funct; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>2f3x_A Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>3hdu_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.50A {Syntrophus aciditrophicus SB} Back     alignment and structure
>2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 Back     alignment and structure
>2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 Back     alignment and structure
>4i82_A Putative uncharacterized protein; PAAI/YDII-like, hot DOG fold, thioesterase, hydrolase; 2.50A {Streptococcus pneumoniae} Back     alignment and structure
>3bbj_A Putative thioesterase II; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.16A {Thermobifida fusca} Back     alignment and structure
>3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} SCOP: d.38.1.5 PDB: 2f0x_A* 2cy9_A Back     alignment and structure
>3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A* Back     alignment and structure
>2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A Back     alignment and structure
>1z6b_A Pffabz, fatty acid synthesis protein; malaria, beta-hydroxyacyl-ACP dehydra fatty acid biosynthesis, SAD phasing, lyase; 2.09A {Plasmodium falciparum} SCOP: d.38.1.6 PDB: 3az8_A* 3az9_A* 3aza_A* 3azb_A* 1zhg_A 2oki_A 2okh_A Back     alignment and structure
>2egj_A Hypothetical protein AQ_1494; structural genomics; 1.80A {Aquifex aeolicus} PDB: 2egi_A 2egr_A Back     alignment and structure
>2cwz_A Thioesterase family protein; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.85A {Thermus thermophilus} SCOP: d.38.1.7 Back     alignment and structure
>1s5u_A Protein YBGC; structural genomics, hypothetical protein, thioesterase fold, PSI, protein structure initiative; 1.70A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>2hlj_A Hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.00A {Pseudomonas putida} SCOP: d.38.1.1 Back     alignment and structure
>2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 Back     alignment and structure
>2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 Back     alignment and structure
>3cjy_A Putative thioesterase; YP_496845.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans} Back     alignment and structure
>2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} Back     alignment and structure
>1sc0_A Hypothetical protein HI1161; structural genomics, unknown function, PSI-2, protein structure initiative; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 2b6e_A 3lz7_A Back     alignment and structure
>3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; FABZ, hot DOG fold, dehydratase, lipid biosynthesis, lipid synthesis, lyase; HET: MSE; 2.59A {Campylobacter jejuni subsp} Back     alignment and structure
>1u1z_A (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; fatty acid biosynthesis, hot DOG fold, lyase; 2.50A {Pseudomonas aeruginosa} SCOP: d.38.1.6 Back     alignment and structure
>3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans} Back     alignment and structure
>2hlj_A Hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.00A {Pseudomonas putida} SCOP: d.38.1.1 Back     alignment and structure
>4ien_A Putative acyl-COA hydrolase; hot DOG fold; HET: COA GDP; 2.00A {Neisseria meningitidis} Back     alignment and structure
>3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis} Back     alignment and structure
>3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha} Back     alignment and structure
>1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1 Back     alignment and structure
>1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>1z54_A Probable thioesterase; hypothetical protein, structural genom NPPSFA, riken structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: d.38.1.1 Back     alignment and structure
>3rqb_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MSE; 2.80A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3q62_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; structural genomics, center for structural genomics of infec diseases, csgid; HET: MES; 1.40A {Yersinia pseudotuberculosis} SCOP: d.38.1.2 PDB: 1mka_A* 1mkb_A Back     alignment and structure
>1tbu_A Peroxisomal acyl-coenzyme A thioester hydrolase 1; yeast peroxisomal thioesterase, , domain swapping, iodine SOAK, siras; 2.20A {Saccharomyces cerevisiae} SCOP: d.38.1.3 Back     alignment and structure
>1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 Back     alignment and structure
>2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1 Back     alignment and structure
>4b0b_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; lyase, fatty acid biosynthesis, bacterial virulence, drug DI; HET: 54F; 1.90A {Pseudomonas aeruginosa} PDB: 4b0c_A* 4b0j_A* 4b8u_A* 4b0i_A* Back     alignment and structure
>1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A Back     alignment and structure
>2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A Back     alignment and structure
>1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiati midwest center for structural genomics, MCSG, sulfur SAD; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} Back     alignment and structure
>1c8u_A Acyl-COA thioesterase II; internal repeats, hydrolase; HET: LDA; 1.90A {Escherichia coli} SCOP: d.38.1.3 d.38.1.3 Back     alignment and structure
>1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 Back     alignment and structure
>3hdu_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.50A {Syntrophus aciditrophicus SB} Back     alignment and structure
>2hx5_A Hypothetical protein; thioesterase/thiol ester dehydrase-isomerase fold, structura genomics, joint center for structural genomics, JCSG; 1.50A {Prochlorococcus marinus} SCOP: d.38.1.1 Back     alignment and structure
>3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} Back     alignment and structure
>2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioest hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori} Back     alignment and structure
>2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1 Back     alignment and structure
>1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A Back     alignment and structure
>3r87_A Putative uncharacterized protein; unknown function; 1.05A {Photobacterium profundum} Back     alignment and structure
>2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A Back     alignment and structure
>3u0a_A Acyl-COA thioesterase II TESB2; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, hydrolase; 2.50A {Mycobacterium marinum} Back     alignment and structure
>2egj_A Hypothetical protein AQ_1494; structural genomics; 1.80A {Aquifex aeolicus} PDB: 2egi_A 2egr_A Back     alignment and structure
>2gll_A FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydratase; lyase; 2.20A {Helicobacter pylori} PDB: 2glm_A* 2glp_A* 2glv_A 3dp1_A* 3cf8_A* 3cf9_A* 3d04_A* 3doy_A* 3doz_A* 3dp0_A* 3b7j_A* 3dp2_A* 3dp3_A* 3ed0_A* Back     alignment and structure
>3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} SCOP: d.38.1.0 Back     alignment and structure
>1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>4h4g_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.65A {Burkholderia thailandensis} Back     alignment and structure
>1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative hydrolase; HET: COA; 1.66A {Bacillus halodurans} SCOP: d.38.1.1 PDB: 3sps_A Back     alignment and structure
>2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus} Back     alignment and structure
>2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>2w3x_A CALE7; hydrolase, hotdog fold, thioesterase, enediyne biosynthesis; HET: JEF; 1.75A {Micromonospora echinospora} Back     alignment and structure
>1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} PDB: 1sc0_A 2b6e_A 3lz7_A Back     alignment and structure
>3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} Back     alignment and structure
>3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis} Back     alignment and structure
>2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 Back     alignment and structure
>2xem_A DYNE7, TEBC; biosynthetic protein, polyketide biosynthesis, enediyne anti agent, thioesterase; HET: SSV; 2.10A {Micromonospora chersina} PDB: 2xfl_A Back     alignment and structure
>2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus} Back     alignment and structure
>3gek_A Putative thioesterase YHDA; structure genomics, NESG, KR113, Q9CHK5_lacla, lactococcus L YHDA, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} Back     alignment and structure
>1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A* Back     alignment and structure
>1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A* Back     alignment and structure
>2xem_A DYNE7, TEBC; biosynthetic protein, polyketide biosynthesis, enediyne anti agent, thioesterase; HET: SSV; 2.10A {Micromonospora chersina} PDB: 2xfl_A Back     alignment and structure
>3bnv_A CJ0977; virulence factor, hot-DOG fold, flagel unknown function; HET: MSE; 2.60A {Campylobacter jejuni} Back     alignment and structure
>2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1 Back     alignment and structure
>2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 Back     alignment and structure
>4i4j_A ACP-polyene thioesterase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: TAR; 2.78A {Streptomyces globisporus} Back     alignment and structure
>3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} SCOP: d.38.1.0 Back     alignment and structure
>2w3x_A CALE7; hydrolase, hotdog fold, thioesterase, enediyne biosynthesis; HET: JEF; 1.75A {Micromonospora echinospora} Back     alignment and structure
>3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} Back     alignment and structure
>2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A Back     alignment and structure
>1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A* Back     alignment and structure
>2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 Back     alignment and structure
>3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha} Back     alignment and structure
>4i83_A 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; FABZ, hot DOG fold, thioesterase, lyase; 2.60A {Neisseria meningitidis} Back     alignment and structure
>2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioest hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori} Back     alignment and structure
>3rd7_A Acyl-COA thioesterase; seattle structur genomics center for infectious disease, ssgcid, hydrolase; 1.95A {Mycobacterium avium} Back     alignment and structure
>2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.50A {Shewanella loihica} Back     alignment and structure
>3r87_A Putative uncharacterized protein; unknown function; 1.05A {Photobacterium profundum} Back     alignment and structure
>1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A* Back     alignment and structure
>3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A Back     alignment and structure
>2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A Back     alignment and structure
>4ae7_A Thioesterase superfamily member 5; hydrolase, hotdog-fold; 1.45A {Homo sapiens} Back     alignment and structure
>3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* Back     alignment and structure
>3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae} Back     alignment and structure
>3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi} Back     alignment and structure
>1z54_A Probable thioesterase; hypothetical protein, structural genom NPPSFA, riken structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: d.38.1.1 Back     alignment and structure
>1s5u_A Protein YBGC; structural genomics, hypothetical protein, thioesterase fold, PSI, protein structure initiative; 1.70A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1 Back     alignment and structure
>4ae8_A Thioesterase superfamily member 4; hydrolase, hotdog-fold; 1.59A {Homo sapiens} PDB: 4gah_A* Back     alignment and structure
>3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae} Back     alignment and structure
>2hx5_A Hypothetical protein; thioesterase/thiol ester dehydrase-isomerase fold, structura genomics, joint center for structural genomics, JCSG; 1.50A {Prochlorococcus marinus} SCOP: d.38.1.1 Back     alignment and structure
>2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1 Back     alignment and structure
>2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1 Back     alignment and structure
>2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} Back     alignment and structure
>4b8u_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; lyase, fatty acid biosynthesis, inhibitor, bacterial virulen discovery; HET: IBK; 2.76A {Pseudomonas aeruginosa} Back     alignment and structure
>4i4j_A ACP-polyene thioesterase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: TAR; 2.78A {Streptomyces globisporus} Back     alignment and structure
>3qoo_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, hot-DOG superfamily; 1.25A {Thermanaerovibrio acidaminovorans} Back     alignment and structure
>1sc0_A Hypothetical protein HI1161; structural genomics, unknown function, PSI-2, protein structure initiative; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 2b6e_A 3lz7_A Back     alignment and structure
>4a0z_A Transcription factor FAPR; lipid homeostasis; HET: MLC; 1.90A {Staphylococcus aureus} PDB: 4a0y_A 4a0x_A* 4a12_A Back     alignment and structure
>2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} Back     alignment and structure
>3kuv_A Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA thioesterase FLK, hot DOG folding, thioeste hydrolase; 1.50A {Streptomyces cattleya} PDB: 3kuw_A 3kvu_A* 3p2q_A 3p2r_A 3p2s_A 3kv7_A 3kv8_A 3kvz_A* 3kw1_A* 3kx7_A 3kx8_A 3kvi_A 3p3i_A 3p3f_A Back     alignment and structure
>2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} Back     alignment and structure
>4b0b_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; lyase, fatty acid biosynthesis, bacterial virulence, drug DI; HET: 54F; 1.90A {Pseudomonas aeruginosa} PDB: 4b0c_A* 4b0j_A* 4b8u_A* 4b0i_A* Back     alignment and structure
>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 Back     alignment and structure
>2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2 Back     alignment and structure
>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} Back     alignment and structure
>1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative hydrolase; HET: COA; 1.66A {Bacillus halodurans} SCOP: d.38.1.1 PDB: 3sps_A Back     alignment and structure
>3q62_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; structural genomics, center for structural genomics of infec diseases, csgid; HET: MES; 1.40A {Yersinia pseudotuberculosis} SCOP: d.38.1.2 PDB: 1mka_A* 1mkb_A Back     alignment and structure
>2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus} Back     alignment and structure
>4ien_A Putative acyl-COA hydrolase; hot DOG fold; HET: COA GDP; 2.00A {Neisseria meningitidis} Back     alignment and structure
>1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 Back     alignment and structure
>1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiati midwest center for structural genomics, MCSG, sulfur SAD; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>1t82_A Hypothetical acetyltransferase; structural genomics, alpha-beta dimeric protein with A fold resembling A hotdog, PSI; 1.70A {Shewanella oneidensis} SCOP: d.38.1.5 Back     alignment and structure
>2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>1t82_A Hypothetical acetyltransferase; structural genomics, alpha-beta dimeric protein with A fold resembling A hotdog, PSI; 1.70A {Shewanella oneidensis} SCOP: d.38.1.5 Back     alignment and structure
>1c8u_A Acyl-COA thioesterase II; internal repeats, hydrolase; HET: LDA; 1.90A {Escherichia coli} SCOP: d.38.1.3 d.38.1.3 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>2q78_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE MLC; 2.20A {Thermotoga maritima MSB8} SCOP: d.38.1.7 Back     alignment and structure
>3u0a_A Acyl-COA thioesterase II TESB2; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, hydrolase; 2.50A {Mycobacterium marinum} Back     alignment and structure
>3rd7_A Acyl-COA thioesterase; seattle structur genomics center for infectious disease, ssgcid, hydrolase; 1.95A {Mycobacterium avium} Back     alignment and structure
>4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale} Back     alignment and structure
>4b8u_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; lyase, fatty acid biosynthesis, inhibitor, bacterial virulen discovery; HET: IBK; 2.76A {Pseudomonas aeruginosa} Back     alignment and structure
>3cjy_A Putative thioesterase; YP_496845.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 229
d1s9ca1126 d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain 3e-35
d1pn2a2124 d.38.1.4 (A:152-275) 2-enoyl-coa hydratase domain 3e-27
d1pn2a1148 d.38.1.4 (A:4-151) 2-enoyl-coa hydratase domain of 2e-23
d2b3na1154 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Ar 2e-15
d1s9ca2154 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain o 4e-14
d1iq6a_132 d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Ae 1e-13
d1q6wa_151 d.38.1.4 (A:) Monoamine oxidase regulatory protein 3e-08
d2bi0a1178 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0 2e-06
d2c2ia1149 d.38.1.4 (A:2-150) Hypothetical protein Rv0130 {My 4e-06
d2bi0a2152 d.38.1.4 (A:186-337) Hypothetical protein Rv0216/M 2e-04
>d1s9ca1 d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: MaoC-like
domain: 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  119 bits (299), Expect = 3e-35
 Identities = 58/119 (48%), Positives = 75/119 (63%)

Query: 100 VKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAV 159
           V IP   P AV  D T  +QA +YRLSGD+NPLH DP  A  AGF +PILHGLCT GF+ 
Sbjct: 2   VAIPNRPPDAVLTDTTSLNQAALYRLSGDWNPLHIDPNFASLAGFDKPILHGLCTFGFSA 61

Query: 160 RAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSG 218
           R +++     D +  K + +RF   VYPG+TL TEMW +G R+ +Q KV+E     +S 
Sbjct: 62  RRVLQQFADNDVSRFKAVKARFAKPVYPGQTLQTEMWKEGNRIHFQTKVQETGDIVISN 120
>d1pn2a2 d.38.1.4 (A:152-275) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 124 Back     information, alignment and structure
>d1pn2a1 d.38.1.4 (A:4-151) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 148 Back     information, alignment and structure
>d2b3na1 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 154 Back     information, alignment and structure
>d1s9ca2 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]} Length = 132 Back     information, alignment and structure
>d1q6wa_ d.38.1.4 (A:) Monoamine oxidase regulatory protein {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 151 Back     information, alignment and structure
>d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 178 Back     information, alignment and structure
>d2c2ia1 d.38.1.4 (A:2-150) Hypothetical protein Rv0130 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 149 Back     information, alignment and structure
>d2bi0a2 d.38.1.4 (A:186-337) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 152 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query229
d1s9ca1126 2-enoyl-coa hydratase domain of multifunctional pe 99.97
d1pn2a2124 2-enoyl-coa hydratase domain of multifunctional pe 99.96
d1iq6a_132 (R)-specific enoyl-CoA hydratase {Aeromonas caviae 99.92
d2b3na1154 Hypothetical protein AF1124 {Archaeon Archaeoglobu 99.89
d2c2ia1149 Hypothetical protein Rv0130 {Mycobacterium tubercu 99.83
d1q6wa_151 Monoamine oxidase regulatory protein {Archaeon Arc 99.83
d2bi0a1178 Hypothetical protein Rv0216/MT0226 {Mycobacterium 99.78
d1pn2a1148 2-enoyl-coa hydratase domain of multifunctional pe 99.72
d2bi0a2152 Hypothetical protein Rv0216/MT0226 {Mycobacterium 99.67
d1s9ca2154 2-enoyl-coa hydratase domain of multifunctional pe 99.61
d2cwza1138 Hypothetical protein TTHA0967 {Thermus thermophilu 98.78
d1s9ca2154 2-enoyl-coa hydratase domain of multifunctional pe 98.55
d1q6wa_151 Monoamine oxidase regulatory protein {Archaeon Arc 98.54
d2f41a1111 Transcription factor FapR, C-terminal domain {Baci 98.43
d2bi0a1178 Hypothetical protein Rv0216/MT0226 {Mycobacterium 98.37
d1ixla_130 Hypothetical protein PH1136 {Archaeon Pyrococcus h 98.18
d1iq6a_132 (R)-specific enoyl-CoA hydratase {Aeromonas caviae 98.17
d1wlua1116 Phenylacetic acid degradation protein PaaI {Thermu 97.97
d2c2ia1149 Hypothetical protein Rv0130 {Mycobacterium tubercu 97.91
d2ov9a1203 Hypothetical protein RHA1_ro05818 {Rhodococcus sp. 97.87
d2hboa1142 Hypothetical protein CC3309 {Caulobacter crescentu 97.71
d2fs2a1131 Phenylacetic acid degradation protein PaaI {Escher 97.53
d2bi0a2152 Hypothetical protein Rv0216/MT0226 {Mycobacterium 97.38
d1u1za_145 (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomo 97.37
d2f0xa1136 Hypothetical protein Them2 {Human (Homo sapiens) [ 97.37
d1z6ba1146 (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria 97.17
d1zkia1126 Hypothetical protein PA5202 {Pseudomonas aeruginos 97.02
d2cwza1138 Hypothetical protein TTHA0967 {Thermus thermophilu 96.85
d2b3na1154 Hypothetical protein AF1124 {Archaeon Archaeoglobu 96.73
d1sc0a_137 Hypothetical protein HI1161 {Haemophilus influenza 96.64
d2owna2109 Putative oleoyl-ACP thioesterase LP0708 {Lactobaci 96.59
d1vh9a_138 Hypothetical protein YbdB {Escherichia coli [TaxId 96.58
d2q78a1130 Uncharacterized protein TM0581 {Thermotoga maritim 96.56
d1njka_133 Hypothetical protein YbaW {Escherichia coli [TaxId 96.53
d1tbua1104 Peroxisomal long-chain acyl-CoA thioesterase 1, TE 96.44
d2f0xa1136 Hypothetical protein Them2 {Human (Homo sapiens) [ 96.35
d1s5ua_129 Hypothetical protein YbgC {Escherichia coli [TaxId 96.34
d1s5ua_129 Hypothetical protein YbgC {Escherichia coli [TaxId 96.34
d2fs2a1131 Phenylacetic acid degradation protein PaaI {Escher 96.29
d2oafa1143 Hypothetical protein Jann0674 {Jannaschia sp. ccs1 96.27
d1ixla_130 Hypothetical protein PH1136 {Archaeon Pyrococcus h 96.24
d2cyea1132 Probable thioesterase TTHA1846 {Thermus thermophil 96.23
d1vh5a_138 Hypothetical protein YdiI {Escherichia coli [TaxId 96.22
d2fuja1118 Hypothetical protein XCC1147 {Xanthomonas campestr 96.01
d2essa1149 Acyl-ACP thioesterase {Bacteroides thetaiotaomicro 96.01
d1wlua1116 Phenylacetic acid degradation protein PaaI {Thermu 95.99
d2oiwa1131 GK1870 orthologue {Bacillus stearothermophilus [Ta 95.95
d2owna1147 Putative oleoyl-ACP thioesterase LP0708 {Lactobaci 95.94
d2hx5a1144 Hypothetical protein PMT2055 {Prochlorococcus mari 95.93
d1z54a1132 Probable thioesterase TTHA0908 {Thermus thermophil 95.92
d2gvha2116 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter 95.89
d1u1za_145 (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomo 95.88
d2gvha1135 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter 95.86
d1q4ua_140 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp 95.84
d2f41a1111 Transcription factor FapR, C-terminal domain {Baci 95.84
d1njka_133 Hypothetical protein YbaW {Escherichia coli [TaxId 95.83
d1lo7a_140 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp. 95.71
d2oafa1143 Hypothetical protein Jann0674 {Jannaschia sp. ccs1 95.68
d1z6ba1146 (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria 95.68
d1z54a1132 Probable thioesterase TTHA0908 {Thermus thermophil 95.64
d2hx5a1144 Hypothetical protein PMT2055 {Prochlorococcus mari 95.63
d2hlja1156 Hypothetical protein PP0301 {Pseudomonas putida [T 95.61
d1c8ua1114 Thioesterase II (TesB) {Escherichia coli [TaxId: 5 95.53
d2hboa1142 Hypothetical protein CC3309 {Caulobacter crescentu 95.52
d2nuja1159 Hypothetical protein Jann_1972 {Jannaschia sp. CCS 95.51
d2essa298 Acyl-ACP thioesterase {Bacteroides thetaiotaomicro 95.39
d1vh9a_138 Hypothetical protein YbdB {Escherichia coli [TaxId 95.37
d2gvha2116 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter 95.37
d2o5ua1139 Hypothetical thioesterase PA5185 {Pseudomonas aeru 95.33
d2oiwa1131 GK1870 orthologue {Bacillus stearothermophilus [Ta 95.3
d2cyea1132 Probable thioesterase TTHA1846 {Thermus thermophil 95.29
d2ov9a1203 Hypothetical protein RHA1_ro05818 {Rhodococcus sp. 95.2
d2o5ua1139 Hypothetical thioesterase PA5185 {Pseudomonas aeru 95.17
d2essa1149 Acyl-ACP thioesterase {Bacteroides thetaiotaomicro 95.14
d1lo7a_140 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp. 94.94
d2owna1147 Putative oleoyl-ACP thioesterase LP0708 {Lactobaci 94.87
d2nuja1159 Hypothetical protein Jann_1972 {Jannaschia sp. CCS 94.83
d2fuja1118 Hypothetical protein XCC1147 {Xanthomonas campestr 94.78
d1ylia1142 Putative acyl-coa thioester hydrolase HI0827 {Haem 94.76
d1pn2a1148 2-enoyl-coa hydratase domain of multifunctional pe 94.75
d1sc0a_137 Hypothetical protein HI1161 {Haemophilus influenza 94.72
d1vh5a_138 Hypothetical protein YdiI {Escherichia coli [TaxId 94.58
d1c8ua2171 Thioesterase II (TesB) {Escherichia coli [TaxId: 5 94.52
d2gvha1135 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter 94.52
d2hlja1156 Hypothetical protein PP0301 {Pseudomonas putida [T 94.04
d1y7ua1164 Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 94.01
d2gf6a1134 Hypothetical protein SSO2295 {Archaeon Sulfolobus 94.01
d2gf6a1134 Hypothetical protein SSO2295 {Archaeon Sulfolobus 93.92
d1q4ua_140 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp 93.78
d1t82a_143 Putative thioesterase SO4397 {Shewanella oneidensi 93.76
d1vpma_155 Acyl-CoA hydrolase BH0798 {Bacillus halodurans [Ta 93.66
d2alia1130 Hypothetical protein PA2801 {Pseudomonas aeruginos 93.61
d1zkia1126 Hypothetical protein PA5202 {Pseudomonas aeruginos 93.46
d2alia1130 Hypothetical protein PA2801 {Pseudomonas aeruginos 92.77
d1vpma_155 Acyl-CoA hydrolase BH0798 {Bacillus halodurans [Ta 91.96
d1ylia1142 Putative acyl-coa thioester hydrolase HI0827 {Haem 91.88
d1y7ua1164 Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 91.87
d1yoca1145 Hypothetical protein PA1835 {Pseudomonas aeruginos 91.75
d1mkaa_171 beta-Hydroxydecanol thiol ester dehydrase {Escheri 91.61
d2owna2109 Putative oleoyl-ACP thioesterase LP0708 {Lactobaci 90.9
d1sh8a_153 Hypothetical protein PA5026 {Pseudomonas aeruginos 90.56
d1s9ca1126 2-enoyl-coa hydratase domain of multifunctional pe 89.86
d1pn2a2124 2-enoyl-coa hydratase domain of multifunctional pe 89.22
d1mkaa_171 beta-Hydroxydecanol thiol ester dehydrase {Escheri 88.41
d1t82a_143 Putative thioesterase SO4397 {Shewanella oneidensi 87.92
d1sh8a_153 Hypothetical protein PA5026 {Pseudomonas aeruginos 86.84
d2q78a1130 Uncharacterized protein TM0581 {Thermotoga maritim 85.68
>d1s9ca1 d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: MaoC-like
domain: 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=9.9e-31  Score=192.63  Aligned_cols=122  Identities=48%  Similarity=0.838  Sum_probs=111.8

Q ss_pred             CCCCCCCCEEEeecChhhHHHHHhhhCCCCCCCCCHHHHHhCCCCCceechhHHHHHHHHHHHHHHccCCCceeeEEEEE
Q 027032          101 KIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSR  180 (229)
Q Consensus       101 ~~p~~~p~~~~~~~~~~~~~~~~~~sgd~npiH~d~~~A~~~G~~~~i~hG~~~~~~~~~~~~~~~~~~~~~~~~~~~~r  180 (229)
                      ++|.+.|+++....++.|+.+||++|||+||||+|+++|+..||+++|+|||++++++.+++..++.++.+..+..+++|
T Consensus         3 ~~p~~~pd~~~~~~~~~~~~~~~~lSGD~NPIH~D~~~Ak~~g~~~~IahG~l~~a~~~~~~~~~~~~~~~~~~~~~~~r   82 (126)
T d1s9ca1           3 AIPNRPPDAVLTDTTSLNQAALYRLSGDWNPLHIDPNFASLAGFDKPILHGLCTFGFSARRVLQQFADNDVSRFKAVKAR   82 (126)
T ss_dssp             CCCSSCCSEEEEEECCTTHHHHHGGGSCCCGGGTCHHHHHTTTCSSCCCCHHHHHHHHHHHHHHHHSTTCGGGEEEEEEE
T ss_pred             CCCCCCCCeEEeeecChhHHHHHHHHCCCceeEeCHHHHhhcCCCCccchHHHHHHHHHHHHHHHhcccCceeEEEEEeE
Confidence            56777889998889999999999999999999999999999999999999999999999999988866677888899999


Q ss_pred             ECcCCCCCCEEEEEEEEECcEEEEEEEEccCCeEEEE-EEEEE
Q 027032          181 FLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALS-GFVDV  222 (229)
Q Consensus       181 f~~Pv~~gd~l~~~~~~~~~~v~~~~~~~~~g~~v~~-g~~~~  222 (229)
                      |.+|||+||+|+++.+.+++++.+++++|++|++|+. |.+++
T Consensus        83 F~~Pv~~gdtl~v~~~~~~~~v~~~~~~~~~g~~Vl~ga~~~l  125 (126)
T d1s9ca1          83 FAKPVYPGQTLQTEMWKEGNRIHFQTKVQETGDIVISNAYVDL  125 (126)
T ss_dssp             ECSCCCTTCEEEEEEEEETTEEEEEEEETTTTEEEEEEEEEEE
T ss_pred             ECCCCCCCCEEEEEEEEcCCEEEEEEEEecCCeEEEeCeEEEe
Confidence            9999999999999999999999999989999999995 45554
>d1pn2a2 d.38.1.4 (A:152-275) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]} Back     information, alignment and structure
>d2b3na1 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2c2ia1 d.38.1.4 (A:2-150) Hypothetical protein Rv0130 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q6wa_ d.38.1.4 (A:) Monoamine oxidase regulatory protein {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pn2a1 d.38.1.4 (A:4-151) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d2bi0a2 d.38.1.4 (A:186-337) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s9ca2 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cwza1 d.38.1.7 (A:1-138) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s9ca2 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q6wa_ d.38.1.4 (A:) Monoamine oxidase regulatory protein {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]} Back     information, alignment and structure
>d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c2ia1 d.38.1.4 (A:2-150) Hypothetical protein Rv0130 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi0a2 d.38.1.4 (A:186-337) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u1za_ d.38.1.6 (A:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z6ba1 d.38.1.6 (A:84-229) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cwza1 d.38.1.7 (A:1-138) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b3na1 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q78a1 d.38.1.7 (A:1-130) Uncharacterized protein TM0581 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1njka_ d.38.1.1 (A:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tbua1 d.38.1.3 (A:13-116) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]} Back     information, alignment and structure
>d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]} Back     information, alignment and structure
>d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gvha2 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1u1za_ d.38.1.6 (A:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1q4ua_ d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., strain su [TaxId: 1667]} Back     information, alignment and structure
>d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1njka_ d.38.1.1 (A:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]} Back     information, alignment and structure
>d1z6ba1 d.38.1.6 (A:84-229) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]} Back     information, alignment and structure
>d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1c8ua1 d.38.1.3 (A:2-115) Thioesterase II (TesB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]} Back     information, alignment and structure
>d2essa2 d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gvha2 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2o5ua1 d.38.1.1 (A:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d2o5ua1 d.38.1.1 (A:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]} Back     information, alignment and structure
>d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pn2a1 d.38.1.4 (A:4-151) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c8ua2 d.38.1.3 (A:116-286) Thioesterase II (TesB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1q4ua_ d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., strain su [TaxId: 1667]} Back     information, alignment and structure
>d1t82a_ d.38.1.5 (A:) Putative thioesterase SO4397 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1yoca1 d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mkaa_ d.38.1.2 (A:) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1sh8a_ d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1s9ca1 d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pn2a2 d.38.1.4 (A:152-275) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1mkaa_ d.38.1.2 (A:) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t82a_ d.38.1.5 (A:) Putative thioesterase SO4397 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d1sh8a_ d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2q78a1 d.38.1.7 (A:1-130) Uncharacterized protein TM0581 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure