Citrus Sinensis ID: 027035

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MLNVIRIFLTLITLIGTASSQEDPQLGSARVVFQTNYGDIEFGFYPSVAPQTVDHIFKLVRLGCYNTNHFFRVDKGFVAQVADVVGGRSAPMNEVQRVEAEKTVVGEFSDVKHVRGILSMGRYSDPNSAASSFSILLGDAPHLDGQYAVFGKVTKGDETLRKLEGLPTRKEGIFVMPTERITIHSSYYYDTEMEICEKERSVLKRRLTASVIEIERQVIRSSIALKLIP
cHHHHHHHHHHHHHHHHccccccccccccEEEEEEccccEEEEEcccccHHHHHHHHHHHHccccccccEEEcccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccEEEEEEccHHHHHHHHccccccccccccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
ccHHHHHHHHHHHHHHHHcHcccccccccEEEEEEccEEEEEEEcccccHHHHHHHHHHHHccccccEEccEEEcccEEEccccccccccccccccccccccccccccccccccccEEEEcccccccccccEEEEEEcccccccccEEEEEEEEccHHHHHHHHccccccccccccccccEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHccccccccccccc
MLNVIRIFLTLITLIgtassqedpqlgsARVVFQtnygdiefgfypsvapqtvDHIFKLVrlgcyntnhffrvdkGFVAQVADvvggrsapmnevqRVEAektvvgefsdvkhVRGILsmgrysdpnsaasSFSIllgdaphldgqyavfgkvtkgdetlrkleglptrkegifvmpteritihssyyydteMEICEKERSVLKRRLTASVIEIERQVIRSSIALKLIP
MLNVIRIFLTLITLIGtassqedpqlGSARVVFQTNYGDIEFGFYPSVAPQTVDHIFKLVRLGCYNTNHFFRVDKGFVAQVADVVGgrsapmnevqrveaektvvgefsdvkhVRGILSMGRYSDPNSAASSFSILLGDAPHLDGQYAVFGkvtkgdetlrkleglptrkegifvmpteritIHSSYYYDTEMEICEKERSVLKRRltasvieierqvirssialklip
MLNVIRIFLTLITLIGTASSQEDPQLGSARVVFQTNYGDIEFGFYPSVAPQTVDHIFKLVRLGCYNTNHFFRVDKGFVAQVADVVGGRSAPMNEVQRVEAEKTVVGEFSDVKHVRGILSMGRYSDPNSAASSFSILLGDAPHLDGQYAVFGKVTKGDETLRKLEGLPTRKEGIFVMPTERITIHSSYYYDTEMEICEKERSVLKRRLTASVIEIERQVIRSSIALKLIP
**NVIRIFLTLITLIGTA*******LGSARVVFQTNYGDIEFGFYPSVAPQTVDHIFKLVRLGCYNTNHFFRVDKGFVAQVADVVGGRSAPM*EVQRVEAEKTVVGEFSDVKHVRGILSMGRY*******SSFSILLGDAPHLDGQYAVFGKVTKGDETLRKLEGLPTRKEGIFVMPTERITIHSSYYYDTEMEICEKERSVLKRRLTASVIEIERQVIRSSIAL****
*LNVIRIFLTLITLIGTAS******LGSARVVFQTNYGDIEFGFYPSVAPQTVDHIFKLVRLGCYNTNHFFRVDKGFVAQVADVVGG******************GEFSDVKHVRGILSMGRYSDPNSAASSFSILLGDAPHLDGQYAVFGKVTKGDETLRKLEGLPTR**GIFVMPTERITIHSSYYYDTEMEIC**************************IALKLIP
MLNVIRIFLTLITLIGTASSQEDPQLGSARVVFQTNYGDIEFGFYPSVAPQTVDHIFKLVRLGCYNTNHFFRVDKGFVAQVADVVGGRSAPMNEVQRVEAEKTVVGEFSDVKHVRGILSMGRYSDPNSAASSFSILLGDAPHLDGQYAVFGKVTKGDETLRKLEGLPTRKEGIFVMPTERITIHSSYYYDTEMEICEKERSVLKRRLTASVIEIERQVIRSSIALKLIP
MLNVIRIFLTLITLIGTASSQEDPQLGSARVVFQTNYGDIEFGFYPSVAPQTVDHIFKLVRLGCYNTNHFFRVDKGFVAQVADVVGG****MNEVQRVEAEKTVVGEFSDVKHVRGILSMGRYSDPNSAASSFSILLGDAPHLDGQYAVFGKVTKGDETLRKLEGLPTRKEGIFVMPTERITIHSSYYYDTEMEICEKERSVLKRRLTAS*******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNVIRIFLTLITLIGTASSQEDPQLGSARVVFQTNYGDIEFGFYPSVAPQTVDHIFKLVRLGCYNTNHFFRVDKGFVAQVADVVGGRSAPMNEVQRVEAEKTVVGEFSDVKHVRGILSMGRYSDPNSAASSFSILLGDAPHLDGQYAVFGKVTKGDETLRKLEGLPTRKEGIFVMPTERITIHSSYYYDTEMEICEKERSVLKRRLTASVIEIERQVIRSSIALKLIP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query229 2.2.26 [Sep-21-2011]
Q8G0J9196 Probable peptidyl-prolyl yes no 0.650 0.760 0.382 8e-18
Q8YHB5196 Probable peptidyl-prolyl yes no 0.650 0.760 0.382 8e-18
Q57D43196 Probable peptidyl-prolyl yes no 0.650 0.760 0.382 9e-18
Q2YPY5196 Probable peptidyl-prolyl yes no 0.650 0.760 0.382 9e-18
Q9D6L8161 Peptidyl-prolyl cis-trans yes no 0.655 0.931 0.360 6e-15
Q5ZLV2161 Peptidyl-prolyl cis-trans yes no 0.650 0.925 0.358 9e-15
Q812D3161 Peptidyl-prolyl cis-trans yes no 0.655 0.931 0.360 1e-14
Q9H2H8161 Peptidyl-prolyl cis-trans yes no 0.655 0.931 0.360 2e-14
P0CP90573 Peptidyl-prolyl cis-trans yes no 0.825 0.329 0.312 6e-13
P0CP91573 Peptidyl-prolyl cis-trans N/A no 0.825 0.329 0.312 6e-13
>sp|Q8G0J9|PPI1_BRUSU Probable peptidyl-prolyl cis-trans isomerase OS=Brucella suis biovar 1 (strain 1330) GN=ppi PE=3 SV=1 Back     alignment and function desciption
 Score = 90.5 bits (223), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 80/157 (50%), Gaps = 8/157 (5%)

Query: 12  ITLIGTASSQEDPQLGSARVVFQTNYGDIEFGFYPSVAPQTVDHIFKLVRLGCYNTNHFF 71
           I  + TAS+  DP+     V+ +   GD+     P +AP+ V  I KLVR G YN   F 
Sbjct: 18  IGAVQTASAA-DPE---NTVILKLKDGDVALELRPDLAPKHVAQIKKLVREGAYNGVAFH 73

Query: 72  RVDKGFVAQVADVVGGRSAPMNEVQRVEAEKT----VVGEFSDVKHVRGILSMGRYSDPN 127
           RV  GF+AQ  DV  G      +  RV    +    +  EFS    VRG + M R  +PN
Sbjct: 74  RVIPGFMAQTGDVKFGNMDKGFDAARVGTGGSNYPDLPAEFSKEPFVRGTVGMARSQNPN 133

Query: 128 SAASSFSILLGDAPHLDGQYAVFGKVTKGDETLRKLE 164
           SA S F I+  D P L+GQY V GKV  G + + K++
Sbjct: 134 SANSQFFIMFDDGPFLNGQYTVVGKVVSGMDAVDKIK 170
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Brucella suis biovar 1 (strain 1330) (taxid: 204722)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q8YHB5|PPI1_BRUME Probable peptidyl-prolyl cis-trans isomerase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ppi PE=3 SV=2 Back     alignment and function description
>sp|Q57D43|PPI1_BRUAB Probable peptidyl-prolyl cis-trans isomerase OS=Brucella abortus biovar 1 (strain 9-941) GN=ppi PE=3 SV=1 Back     alignment and function description
>sp|Q2YPY5|PPI1_BRUA2 Probable peptidyl-prolyl cis-trans isomerase OS=Brucella abortus (strain 2308) GN=ppi PE=3 SV=1 Back     alignment and function description
>sp|Q9D6L8|PPIL3_MOUSE Peptidyl-prolyl cis-trans isomerase-like 3 OS=Mus musculus GN=Ppil3 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZLV2|PPIL3_CHICK Peptidyl-prolyl cis-trans isomerase-like 3 OS=Gallus gallus GN=PPIL3 PE=2 SV=1 Back     alignment and function description
>sp|Q812D3|PPIL3_RAT Peptidyl-prolyl cis-trans isomerase-like 3 OS=Rattus norvegicus GN=Ppil3 PE=2 SV=1 Back     alignment and function description
>sp|Q9H2H8|PPIL3_HUMAN Peptidyl-prolyl cis-trans isomerase-like 3 OS=Homo sapiens GN=PPIL3 PE=1 SV=1 Back     alignment and function description
>sp|P0CP90|PPIL2_CRYNJ Peptidyl-prolyl cis-trans isomerase-like 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP8 PE=3 SV=1 Back     alignment and function description
>sp|P0CP91|PPIL2_CRYNB Peptidyl-prolyl cis-trans isomerase-like 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP8 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query229
225425744226 PREDICTED: probable peptidyl-prolyl cis- 0.925 0.938 0.822 3e-99
224110430223 predicted protein [Populus trichocarpa] 0.890 0.914 0.852 6e-99
255558158222 peptidyl-prolyl cis-trans isomerase, put 0.868 0.896 0.849 3e-97
449442287226 PREDICTED: probable peptidyl-prolyl cis- 0.890 0.902 0.823 4e-96
56407691248 putative cyclophilin type peptidyl-proly 0.847 0.782 0.871 8e-95
363814306230 uncharacterized protein LOC100819238 pre 0.921 0.917 0.792 9e-94
357486745220 Peptidyl-prolyl cis-trans isomerase-like 0.925 0.963 0.784 1e-93
18396122226 Cyclophilin-like peptidyl-prolyl cis-tra 0.864 0.876 0.828 3e-93
297850978226 peptidyl-prolyl cis-trans isomerase cycl 0.917 0.929 0.778 4e-93
357156222231 PREDICTED: probable peptidyl-prolyl cis- 0.847 0.839 0.804 3e-90
>gi|225425744|ref|XP_002276441.1| PREDICTED: probable peptidyl-prolyl cis-trans isomerase isoform 1 [Vitis vinifera] gi|359473259|ref|XP_003631278.1| PREDICTED: probable peptidyl-prolyl cis-trans isomerase isoform 2 [Vitis vinifera] gi|296086396|emb|CBI31985.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  367 bits (941), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 176/214 (82%), Positives = 198/214 (92%), Gaps = 2/214 (0%)

Query: 7   IFLTLITLIGTASSQEDPQLGSARVVFQTNYGDIEFGFYPSVAPQTVDHIFKLVRLGCYN 66
           + L L  ++G ASSQE PQLGSARVVFQTNYGDIEFGF+P VAP+TVDHIFKLVRLGC+N
Sbjct: 12  LCLALAFVVG-ASSQE-PQLGSARVVFQTNYGDIEFGFFPGVAPKTVDHIFKLVRLGCFN 69

Query: 67  TNHFFRVDKGFVAQVADVVGGRSAPMNEVQRVEAEKTVVGEFSDVKHVRGILSMGRYSDP 126
           TNHFFRVD+GFVAQVADVVGGRSAPMNE QR EA KTVVGEFSDVKHVRGILSMGRY+DP
Sbjct: 70  TNHFFRVDRGFVAQVADVVGGRSAPMNEEQREEAVKTVVGEFSDVKHVRGILSMGRYADP 129

Query: 127 NSAASSFSILLGDAPHLDGQYAVFGKVTKGDETLRKLEGLPTRKEGIFVMPTERITIHSS 186
           +SA+SSFS+LLGDAPHLDGQYA+FG+VTKGDETL+KLE LPTR+EGIFVMPTERITI SS
Sbjct: 130 DSASSSFSMLLGDAPHLDGQYAIFGRVTKGDETLKKLEQLPTRREGIFVMPTERITILSS 189

Query: 187 YYYDTEMEICEKERSVLKRRLTASVIEIERQVIR 220
           Y+YDT+ME CE+E+S LKRRL ASV+EIERQ ++
Sbjct: 190 YFYDTKMETCEQEKSTLKRRLAASVVEIERQRMK 223

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224110430|ref|XP_002315517.1| predicted protein [Populus trichocarpa] gi|222864557|gb|EEF01688.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255558158|ref|XP_002520106.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis] gi|223540598|gb|EEF42161.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449442287|ref|XP_004138913.1| PREDICTED: probable peptidyl-prolyl cis-trans isomerase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|56407691|gb|AAV88079.1| putative cyclophilin type peptidyl-prolyl cis-trans isomerase [Ipomoea batatas] Back     alignment and taxonomy information
>gi|363814306|ref|NP_001242025.1| uncharacterized protein LOC100819238 precursor [Glycine max] gi|255640687|gb|ACU20628.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357486745|ref|XP_003613660.1| Peptidyl-prolyl cis-trans isomerase-like protein [Medicago truncatula] gi|217075436|gb|ACJ86078.1| unknown [Medicago truncatula] gi|355514995|gb|AES96618.1| Peptidyl-prolyl cis-trans isomerase-like protein [Medicago truncatula] gi|388515327|gb|AFK45725.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|18396122|ref|NP_564267.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein [Arabidopsis thaliana] gi|21553981|gb|AAM63062.1| unknown [Arabidopsis thaliana] gi|26451588|dbj|BAC42891.1| unknown protein [Arabidopsis thaliana] gi|28973273|gb|AAO63961.1| unknown protein [Arabidopsis thaliana] gi|332192641|gb|AEE30762.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297850978|ref|XP_002893370.1| peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein [Arabidopsis lyrata subsp. lyrata] gi|297339212|gb|EFH69629.1| peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357156222|ref|XP_003577382.1| PREDICTED: probable peptidyl-prolyl cis-trans isomerase-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query229
TAIR|locus:2202775226 AT1G26940 [Arabidopsis thalian 0.934 0.946 0.777 1.1e-85
TIGR_CMR|SPO_2233181 SPO_2233 "peptidyl-prolyl cis- 0.519 0.657 0.413 5.3e-17
UNIPROTKB|J9P7M4161 J9P7M4 "Peptidyl-prolyl cis-tr 0.650 0.925 0.364 2.9e-16
UNIPROTKB|H7BZ14180 PPIL3 "Peptidyl-prolyl cis-tra 0.668 0.85 0.365 2.9e-16
UNIPROTKB|J9NZK4160 PPIL3 "Peptidyl-prolyl cis-tra 0.650 0.931 0.364 4.7e-16
UNIPROTKB|Q9H2H8161 PPIL3 "Peptidyl-prolyl cis-tra 0.650 0.925 0.364 4.7e-16
UNIPROTKB|F2Z5T7161 PPIL3 "Peptidyl-prolyl cis-tra 0.650 0.925 0.364 4.7e-16
MGI|MGI:1917475161 Ppil3 "peptidylprolyl isomeras 0.655 0.931 0.360 4.7e-16
UNIPROTKB|Q5ZLV2161 PPIL3 "Peptidyl-prolyl cis-tra 0.650 0.925 0.358 7.7e-16
RGD|631415161 Ppil3 "peptidylprolyl isomeras 0.655 0.931 0.360 9.8e-16
TAIR|locus:2202775 AT1G26940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 857 (306.7 bits), Expect = 1.1e-85, P = 1.1e-85
 Identities = 168/216 (77%), Positives = 188/216 (87%)

Query:     3 NVIRIFLTLITLIGTASS-QEDPQLGSARVVFQTNYGDIEFGFYPSVAPQTVDHIFKLVR 61
             N+I + L  +  +  A +   +P+LGSARVVFQT+YGDIEFGFYP+VAP+TVDHIFKLVR
Sbjct:     6 NLI-LGLACLAFVSIAKALPHEPELGSARVVFQTSYGDIEFGFYPTVAPKTVDHIFKLVR 64

Query:    62 LGCYNTNHFFRVDKGFVAQVADVVGGRSAPMNEVQRVEAEKTVVGEFSDVKHVRGILSMG 121
             LG YNTNHFFRVDKGFVAQVADV  GRSAPMNE QR EAEK +VGEFSDVKHVRG LSMG
Sbjct:    65 LGGYNTNHFFRVDKGFVAQVADVASGRSAPMNEEQRKEAEKKIVGEFSDVKHVRGTLSMG 124

Query:   122 RYSDPNSAASSFSILLGDAPHLDGQYAVFGKVTKGDETLRKLEGLPTRKEGIFVMPTERI 181
             RY DPNSA SSFS+LLG+APHLD QYAVFGKVTKGDETL KLE +PTR+EGIFVMPTERI
Sbjct:   125 RYDDPNSAQSSFSMLLGNAPHLDRQYAVFGKVTKGDETLSKLEEVPTRREGIFVMPTERI 184

Query:   182 TIHSSYYYDTEMEICEKERSVLKRRLTASVIEIERQ 217
             TI S+YYYDT+ME CE+ERSVLKRRL AS +E+ERQ
Sbjct:   185 TILSTYYYDTKMESCEEERSVLKRRLQASFVEVERQ 220
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0005768 "endosome" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
TIGR_CMR|SPO_2233 SPO_2233 "peptidyl-prolyl cis-trans isomerase, cyclophilin-type" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|J9P7M4 J9P7M4 "Peptidyl-prolyl cis-trans isomerase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|H7BZ14 PPIL3 "Peptidyl-prolyl cis-trans isomerase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZK4 PPIL3 "Peptidyl-prolyl cis-trans isomerase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H2H8 PPIL3 "Peptidyl-prolyl cis-trans isomerase-like 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5T7 PPIL3 "Peptidyl-prolyl cis-trans isomerase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1917475 Ppil3 "peptidylprolyl isomerase (cyclophilin)-like 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZLV2 PPIL3 "Peptidyl-prolyl cis-trans isomerase-like 3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|631415 Ppil3 "peptidylprolyl isomerase (cyclophilin)-like 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.1LOW CONFIDENCE prediction!
4th Layer5.2.1.8LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
cd00317146 cd00317, cyclophilin, cyclophilin: cyclophilin-typ 3e-42
pfam00160144 pfam00160, Pro_isomerase, Cyclophilin type peptidy 4e-39
COG0652158 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase 5e-35
cd01920155 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP 1e-25
cd01928153 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 3e-21
cd01923159 cd01923, cyclophilin_RING, cyclophilin_RING: cyclo 3e-20
PRK10903190 PRK10903, PRK10903, peptidyl-prolyl cis-trans isom 6e-20
cd01927148 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo 3e-17
PRK10791164 PRK10791, PRK10791, peptidyl-prolyl cis-trans isom 5e-17
cd01922146 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY 2e-16
cd01921166 cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph 2e-14
cd01926164 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik 8e-14
cd01924176 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40 4e-13
cd01925171 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC 2e-10
PTZ00221249 PTZ00221, PTZ00221, cyclophilin; Provisional 6e-08
PTZ00060183 PTZ00060, PTZ00060, cyclophilin; Provisional 2e-07
PLN03149186 PLN03149, PLN03149, peptidyl-prolyl isomerase H (c 2e-04
>gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information 
 Score =  140 bits (354), Expect = 3e-42
 Identities = 50/154 (32%), Positives = 68/154 (44%), Gaps = 8/154 (5%)

Query: 32  VFQTNYGDIEFGFYPSVAPQTVDHIFKLVRLGCYNTNHFFRVDKGFVAQVADVVGGRSAP 91
              T  G I    Y   AP+TV++   L R G Y+   F RV  GF+ Q  D  G     
Sbjct: 1   TLDTTKGRIVIELYGDEAPKTVENFLSLARGGFYDGTTFHRVIPGFMIQGGDPTGTGGGG 60

Query: 92  MNEVQRVEAEKTVVGEFSDVKHVRGILSMGRYSDPNSAASSFSILLGDAPHLDGQYAVFG 151
                +   E   +       H RG LSM   + PN+  S F I     PHLDG++ VFG
Sbjct: 61  SGPGYKFPDENFPLKYH----HRRGTLSMAN-AGPNTNGSQFFITTAPTPHLDGKHTVFG 115

Query: 152 KVTKGDETLRKLEGLPTRKEGIFVMPTERITIHS 185
           KV +G + + K+E   T + G    P + +TI  
Sbjct: 116 KVVEGMDVVDKIERGDTDENG---RPIKPVTISD 146

This family contains eukaryotic, bacterial and archeal proteins which exhibit a peptidylprolyl cis- trans isomerases activity (PPIase, Rotamase) and in addition bind the immunosuppressive drug cyclosporin (CsA). Immunosuppression in vertebrates is believed to be the result of the cyclophilin A-cyclosporin protein drug complex binding to and inhibiting the protein-phosphatase calcineurin. PPIase is an enzyme which accelerates protein folding by catalyzing the cis-trans isomerization of the peptide bonds preceding proline residues. Cyclophilins are a diverse family in terms of function and have been implicated in protein folding processes which depend on catalytic /chaperone-like activities. This group contains human cyclophilin 40, a co-chaperone of the hsp90 chaperone system; human cyclophilin A, a chaperone in the HIV-1 infectious process and; human cyclophilin H, a component of the U4/U6 snRNP, whose isomerization or chaperoning activities may play a role in RNA splicing. . Length = 146
>gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD Back     alignment and domain information
>gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like Back     alignment and domain information
>gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>gnl|CDD|182824 PRK10903, PRK10903, peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>gnl|CDD|182734 PRK10791, PRK10791, peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>gnl|CDD|238905 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>gnl|CDD|140248 PTZ00221, PTZ00221, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 229
PRK10903190 peptidyl-prolyl cis-trans isomerase A (rotamase A) 100.0
KOG0880217 consensus Peptidyl-prolyl cis-trans isomerase [Pos 100.0
cd01923159 cyclophilin_RING cyclophilin_RING: cyclophilin-typ 100.0
cd01921166 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type 100.0
KOG0546 372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 100.0
KOG0881164 consensus Cyclophilin type peptidyl-prolyl cis-tra 100.0
COG0652158 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase 100.0
cd01928153 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro 100.0
KOG0883518 consensus Cyclophilin type, U box-containing pepti 100.0
cd01927148 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ 100.0
cd01925171 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: 100.0
PRK10791164 peptidyl-prolyl cis-trans isomerase B (rotamase B) 100.0
cd01922146 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c 100.0
PTZ00221249 cyclophilin; Provisional 100.0
PLN03149186 peptidyl-prolyl isomerase H (cyclophilin H); Provi 100.0
PTZ00060183 cyclophilin; Provisional 100.0
cd01920155 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc 100.0
cd01926164 cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph 100.0
KOG0879177 consensus U-snRNP-associated cyclophilin type pept 100.0
KOG0884161 consensus Similar to cyclophilin-type peptidyl-pro 100.0
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 100.0
KOG0415 479 consensus Predicted peptidyl prolyl cis-trans isom 100.0
KOG0885 439 consensus Peptidyl-prolyl cis-trans isomerase [Pos 100.0
PF00160155 Pro_isomerase: Cyclophilin type peptidyl-prolyl ci 100.0
cd00317146 cyclophilin cyclophilin: cyclophilin-type peptidyl 100.0
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 100.0
cd01924176 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc 100.0
KOG0865167 consensus Cyclophilin type peptidyl-prolyl cis-tra 99.96
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.3
TIGR03268503 methan_mark_3 putative methanogenesis marker prote 96.94
PRK00969508 hypothetical protein; Provisional 96.58
PRK00969 508 hypothetical protein; Provisional 96.04
COG4070512 Predicted peptidyl-prolyl cis-trans isomerase (rot 95.64
TIGR03268 503 methan_mark_3 putative methanogenesis marker prote 95.62
PF12903147 DUF3830: Protein of unknown function (DUF3830); In 95.48
COG4070 512 Predicted peptidyl-prolyl cis-trans isomerase (rot 95.48
COG5633123 Predicted periplasmic lipoprotein [General functio 93.0
PF04126120 Cyclophil_like: Cyclophilin-like; InterPro: IPR007 88.8
PF0813925 LPAM_1: Prokaryotic membrane lipoprotein lipid att 85.02
>PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.2e-45  Score=302.78  Aligned_cols=182  Identities=27%  Similarity=0.430  Sum_probs=146.0

Q ss_pred             ChhHHHHHHHHHHHHhccCCCCCCCCCCcEEEEEEeCceEEEEEcCCCCchhHHHHHHhhcCCCcCCceEeEEecCCEEE
Q 027035            1 MLNVIRIFLTLITLIGTASSQEDPQLGSARVVFQTNYGDIEFGFYPSVAPQTVDHIFKLVRLGCYNTNHFFRVDKGFVAQ   80 (229)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~v~~~T~~G~I~ieL~~d~aP~t~~nF~~l~~~g~Y~g~~f~ri~~~~~iq   80 (229)
                      |++...++++++.+.++.++...+ .++++|.|+|+.|+|+||||++.||++|+||++||+.|||+|+.||||+|+|++|
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~v~l~T~~G~i~ieL~~~~aP~t~~NF~~L~~~g~Ydg~~FhRvi~~f~iQ   80 (190)
T PRK10903          2 FKSTLAAMAAVFALSALSPAALAA-KGDPHVLLTTSAGNIELELNSQKAPVSVKNFVDYVNSGFYNNTTFHRVIPGFMIQ   80 (190)
T ss_pred             hHHHHHHHHHHHHHhhcccccccc-CCCcEEEEEeccccEEEEEeCCCCcHHHHHHHHHHhcCCcCCcEEEEEeCCceEE
Confidence            445544444333333332222233 4567899999999999999999999999999999999999999999999999999


Q ss_pred             eecCCCCCCCCCccccccccCccccCC-cCCCCCCccEEEEecCCCCCCCcccEEEEcCCCCCCCC-----CCcEEEEEE
Q 027035           81 VADVVGGRSAPMNEVQRVEAEKTVVGE-FSDVKHVRGILSMGRYSDPNSAASSFSILLGDAPHLDG-----QYAVFGKVT  154 (229)
Q Consensus        81 ~Gd~~~~~~~~~~~~~~~~~~~~~~~e-~~~l~h~~G~lsma~~~~~~~~~sqFfI~l~~~~~ld~-----~~~vFG~Vi  154 (229)
                      |||+....+..       ..+..+++| ...++|.+|+|||++.+++++++|||||++++.++||+     +|+|||+|+
T Consensus        81 gG~~~~~~~~~-------~~~~~~~~e~~~~l~~~~G~lama~~~~~~sn~SQFfIt~~~~~~ld~~~~dg~ytvFG~V~  153 (190)
T PRK10903         81 GGGFTEQMQQK-------KPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVV  153 (190)
T ss_pred             eCCcCCCCCCC-------CCCCcccCcccccCcCCCcEEEeCCCCCCCCcccEEEEECcCcccccCCccCCCccEEEEEe
Confidence            99987643211       124566777 45677799999999977799999999999999999984     899999999


Q ss_pred             cCHHHHHHHhcCCCCCCCC-CCCCCcceEEEEeeeec
Q 027035          155 KGDETLRKLEGLPTRKEGI-FVMPTERITIHSSYYYD  190 (229)
Q Consensus       155 ~G~~vl~~I~~~~~~~~~~-~~~P~~~i~I~~~~vl~  190 (229)
                      +|||||++|+++++++++. .++|.++|.|.+|+|++
T Consensus       154 eG~dvl~~I~~~~~~~~~~~~~~P~~~v~I~~~~v~~  190 (190)
T PRK10903        154 KGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP  190 (190)
T ss_pred             cCHHHHHHHHcCCCCCCCCCCCcccCCeEEEEEEEeC
Confidence            9999999999999976321 13999999999999873

>KOG0880 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0881 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like Back     alignment and domain information
>KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>PTZ00221 cyclophilin; Provisional Back     alignment and domain information
>PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>PTZ00060 cyclophilin; Provisional Back     alignment and domain information
>cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>KOG0879 consensus U-snRNP-associated cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0884 consensus Similar to cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0885 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms Back     alignment and domain information
>cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>KOG0865 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>PF12903 DUF3830: Protein of unknown function (DUF3830); InterPro: IPR024532 This is a family of bacterial and archaeal proteins Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5633 Predicted periplasmic lipoprotein [General function prediction only] Back     alignment and domain information
>PF04126 Cyclophil_like: Cyclophilin-like; InterPro: IPR007256 Proteins of this family have no known function Back     alignment and domain information
>PF08139 LPAM_1: Prokaryotic membrane lipoprotein lipid attachment site; InterPro: IPR012640 In prokaryotes, membrane lipoproteins are synthesized with a precursor signal peptide, which is cleaved by a specific lipoprotein signal peptidase (signal peptidase II) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
2oju_A167 X-Ray Structure Of Complex Of Human Cyclophilin J W 5e-16
1xyh_A161 Crystal Structure Of Recombinant Human Cyclophilin 1e-15
2poe_A185 Crystal Structure Of Cryptosporidium Parvum Cycloph 1e-14
2a2n_A176 Crystal Structure Of The Peptidylprolyl Isomerase D 1e-12
1j2a_A166 Structure Of E. Coli Cyclophilin B K163t Mutant Len 3e-12
1clh_A166 Three-Dimensional Solution Structure Of Escherichia 3e-12
2nul_A164 Peptidylprolyl Isomerase From E. Coli Length = 164 5e-12
1lop_A164 Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P 6e-12
2b71_A196 Plasmodium Yoelii Cyclophilin-Like Protein Length = 7e-12
3s6m_A167 The Structure Of A Peptidyl-Prolyl Cis-Trans Isomer 8e-09
1xwn_A174 Solution Structure Of Cyclophilin Like 1(Ppil1) And 2e-08
1zkc_A197 Crystal Structure Of The Cyclophiln_ring Domain Of 2e-08
2k7n_A203 Solution Structure Of The Ppil1 Bound To A Fragment 2e-08
2x7k_A166 The Crystal Structure Of Ppil1 In Complex With Cycl 3e-08
1qnh_A170 Plasmodium Falciparum Cyclophilin (Double Mutant) C 3e-08
1qng_A170 Plasmodium Falciparum Cyclophilin Complexed With Cy 3e-08
3t1u_A163 Crystal Structure Of The Complex Of Cyclophilin-a E 1e-07
2he9_A192 Structure Of The Peptidylprolyl Isomerase Domain Of 8e-07
1qoi_A177 U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 9e-07
2fu0_A160 Plasmodium Falciparum Cyclophilin Pfe0505w Putative 9e-07
3ich_A188 Crystal Structure Of Cyclophilin B At 1.2 A Resolut 1e-06
1xo7_A166 Crystal Structure Of Cyclophilin From Trypanosoma C 1e-06
2haq_A172 Crystal Structure Of Cyclophilin A From Leishmania 2e-06
3bt8_A172 Crystal Structure Of Mutant Cyclophilin (R147a) Fro 4e-06
2hq6_A185 Structure Of The Cyclophilin_cecyp16-like Domain Of 4e-06
1cyn_A178 Cyclophilin B Complexed With [d-(Cholinylester)ser8 5e-06
1c5f_A177 Crystal Structure Of The Cyclophilin-Like Domain Fr 1e-05
3bo7_A201 Crystal Structure Of Toxoplasma Gondii Peptidyl-Pro 1e-05
3rdd_A184 Human Cyclophilin A Complexed With An Inhibitor Len 2e-05
1m9e_A164 X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- 2e-05
4dgd_A165 Trimcyp Cyclophilin Domain From Macaca Mulatta: H70 2e-05
2rma_A165 Crystal Structures Of Cyclophilin A Complexed With 2e-05
4i9y_A167 Structure Of The C-terminal Domain Of Nup358 Length 2e-05
1bck_A165 Human Cyclophilin A Complexed With 2-Thr Cyclospori 2e-05
5cyh_A164 Cyclophilin A Complexed With Dipeptide Gly-Pro Leng 2e-05
1ist_A162 Crystal Structure Of Yeast Cyclophilin A, Cpr1 Leng 3e-05
2xgy_B173 Complex Of Rabbit Endogenous Lentivirus (Relik)caps 3e-05
2wlw_A165 Structure Of The N-Terminal Capsid Domain Of Hiv-2 3e-05
2esl_A190 Human Cyclophilin C In Complex With Cyclosporin A L 3e-05
2x2a_A165 Free Acetyl-Cypa Trigonal Form Length = 165 3e-05
2x2c_K165 Acetyl-Cypa:cyclosporine Complex Length = 165 4e-05
3k0o_A165 Room Temperature Structure Of Cypa Mutant Ser99thr 4e-05
2wfi_A179 Atomic Resolution Crystal Structure Of The Ppiase D 4e-05
2wfj_A179 Atomic Resolution Crystal Structure Of The Ppiase D 5e-05
2ck1_A172 The Structure Of Oxidised Cyclophilin A From S. Man 5e-05
3k0r_A165 Cryogenic Structure Of Cypa Mutant Arg55lys Length 5e-05
4frv_A185 Crystal Structure Of Mutated Cyclophilin B That Cau 5e-05
2x25_B169 Free Acetyl-Cypa Orthorhombic Form Length = 169 6e-05
4fru_A185 Crystal Structure Of Horse Wild-Type Cyclophilin B 6e-05
2cfe_A162 The 1.5 A Crystal Structure Of The Malassezia Sympo 7e-05
2gw2_A198 Crystal Structure Of The Peptidyl-Prolyl Isomerase 7e-05
2x83_B163 Evolutionary Basis Of Hiv Restriction By The Antire 8e-05
2alf_A164 Crystal Structure Of Human Cypa Mutant K131a Length 1e-04
1h0p_A182 Cyclophilin_5 From C. Elegans Length = 182 1e-04
1z81_A229 Crystal Structure Of Cyclophilin From Plasmodium Yo 1e-04
2plu_A186 Crystal Structure Of Cryptosporidium Parvum Cycloph 2e-04
3pmp_A164 Crystal Structure Of Cyclophilin A From Moniliophth 3e-04
3o7t_A164 Crystal Structure Of Cyclophilin A From Moniliophth 3e-04
2c3b_A172 The Crystal Structure Of Aspergillus Fumigatus Cycl 3e-04
1aws_A164 Secypa Complexed With Hagpia (Pseudo-Symmetric Mono 4e-04
1zmf_A165 C Domain Of Human Cyclophilin-33(Hcyp33) Length = 1 4e-04
2r99_A173 Crystal Structure Of Cyclophilin Abh-Like Domain Of 5e-04
3bkp_A232 Crystal Structure Of The Toxoplasma Gondii Cyclophi 6e-04
2hqj_A183 Cyclophilin From Leishmania Major Length = 183 7e-04
2z6w_A165 Crystal Structure Of Human Cyclophilin D In Complex 8e-04
3r49_A166 Human Cyclophilin D Complexed With Quinolin-8-Amine 9e-04
2bit_X165 Crystal Structure Of Human Cyclophilin D At 1.7 A R 9e-04
3qyu_A164 Crystal Structure Of Human Cyclophilin D At 1.54 A 9e-04
>pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 Back     alignment and structure 
Iteration: 1

 Score = 80.9 bits (198), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 84/165 (50%), Gaps = 11/165 (6%)
Query: 27  GSARVVFQTNYGDIEFGFYPSVAPQTVDHIFKLVRLGCYNTNHFFRVDKGFVAQVADVVG 86
           G   V   T+ GDI+   +    P+T ++   L     YN   F R  KGF+ Q  D  G
Sbjct: 5   GGMSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTG 64
Query: 87  -GRSAPMNEVQRVEAEKTVVGEFSDVKH-VRGILSMGRYSDPNSAASSFSILLGDAPHLD 144
            GR       ++ E E +   E+  +KH VRG++SM   + PN+  S F I  G  PHLD
Sbjct: 65  TGRGGNSIWGKKFEDEYS---EY--LKHNVRGVVSMAN-NGPNTNGSQFFITYGKQPHLD 118
Query: 145 GQYAVFGKVTKGDETLRKLEGLPTRKEG---IFVMPTERITIHSS 186
            +Y VFGKV  G ETL +LE LP  ++    +  +  + ITIH++
Sbjct: 119 MKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHAN 163
>pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 Back     alignment and structure
>pdb|2POE|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_1660 Length = 185 Back     alignment and structure
>pdb|2A2N|A Chain A, Crystal Structure Of The Peptidylprolyl Isomerase Domain Of Human Ppwd1 Length = 176 Back     alignment and structure
>pdb|1J2A|A Chain A, Structure Of E. Coli Cyclophilin B K163t Mutant Length = 166 Back     alignment and structure
>pdb|1CLH|A Chain A, Three-Dimensional Solution Structure Of Escherichia Coli Periplasmic Cyclophilin Length = 166 Back     alignment and structure
>pdb|2NUL|A Chain A, Peptidylprolyl Isomerase From E. Coli Length = 164 Back     alignment and structure
>pdb|1LOP|A Chain A, Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P-Nitroanilide Length = 164 Back     alignment and structure
>pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 Back     alignment and structure
>pdb|3S6M|A Chain A, The Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 167 Back     alignment and structure
>pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 Back     alignment and structure
>pdb|1ZKC|A Chain A, Crystal Structure Of The Cyclophiln_ring Domain Of Human Peptidylprolyl Isomerase (Cyclophilin)-Like 2 Isoform B Length = 197 Back     alignment and structure
>pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 Back     alignment and structure
>pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 Back     alignment and structure
>pdb|1QNH|A Chain A, Plasmodium Falciparum Cyclophilin (Double Mutant) Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|1QNG|A Chain A, Plasmodium Falciparum Cyclophilin Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|3T1U|A Chain A, Crystal Structure Of The Complex Of Cyclophilin-a Enzyme From Azotobacter Vinelandii With Sucafpfpna Peptide Length = 163 Back     alignment and structure
>pdb|2HE9|A Chain A, Structure Of The Peptidylprolyl Isomerase Domain Of The Human Nk-Tumour Recognition Protein Length = 192 Back     alignment and structure
>pdb|1QOI|A Chain A, U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 177 Back     alignment and structure
>pdb|2FU0|A Chain A, Plasmodium Falciparum Cyclophilin Pfe0505w Putative Cyclosporin- Binding Domain Length = 160 Back     alignment and structure
>pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 Back     alignment and structure
>pdb|1XO7|A Chain A, Crystal Structure Of Cyclophilin From Trypanosoma Cruzi Length = 166 Back     alignment and structure
>pdb|2HAQ|A Chain A, Crystal Structure Of Cyclophilin A From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|3BT8|A Chain A, Crystal Structure Of Mutant Cyclophilin (R147a) From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|2HQ6|A Chain A, Structure Of The Cyclophilin_cecyp16-like Domain Of The Serologically Defined Colon Cancer Antigen 10 From Homo Sapiens Length = 185 Back     alignment and structure
>pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 Back     alignment and structure
>pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 Back     alignment and structure
>pdb|3BO7|A Chain A, Crystal Structure Of Toxoplasma Gondii Peptidyl-Prolyl Cis-Trans Isomerase, 541.M00136 Length = 201 Back     alignment and structure
>pdb|3RDD|A Chain A, Human Cyclophilin A Complexed With An Inhibitor Length = 184 Back     alignment and structure
>pdb|1M9E|A Chain A, X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- Terminal Domain (1-146) M-Type H87a Complex. Length = 164 Back     alignment and structure
>pdb|4DGD|A Chain A, Trimcyp Cyclophilin Domain From Macaca Mulatta: H70c Mutant Length = 165 Back     alignment and structure
>pdb|2RMA|A Chain A, Crystal Structures Of Cyclophilin A Complexed With Cyclosporin A And N-Methyl-4-[(E)-2-Butenyl]-4,4-Dimethylthreonine Cyclosporin A Length = 165 Back     alignment and structure
>pdb|4I9Y|A Chain A, Structure Of The C-terminal Domain Of Nup358 Length = 167 Back     alignment and structure
>pdb|1BCK|A Chain A, Human Cyclophilin A Complexed With 2-Thr Cyclosporin Length = 165 Back     alignment and structure
>pdb|5CYH|A Chain A, Cyclophilin A Complexed With Dipeptide Gly-Pro Length = 164 Back     alignment and structure
>pdb|1IST|A Chain A, Crystal Structure Of Yeast Cyclophilin A, Cpr1 Length = 162 Back     alignment and structure
>pdb|2XGY|B Chain B, Complex Of Rabbit Endogenous Lentivirus (Relik)capsid With Cyclophilin A Length = 173 Back     alignment and structure
>pdb|2WLW|A Chain A, Structure Of The N-Terminal Capsid Domain Of Hiv-2 Length = 165 Back     alignment and structure
>pdb|2ESL|A Chain A, Human Cyclophilin C In Complex With Cyclosporin A Length = 190 Back     alignment and structure
>pdb|2X2A|A Chain A, Free Acetyl-Cypa Trigonal Form Length = 165 Back     alignment and structure
>pdb|2X2C|K Chain K, Acetyl-Cypa:cyclosporine Complex Length = 165 Back     alignment and structure
>pdb|3K0O|A Chain A, Room Temperature Structure Of Cypa Mutant Ser99thr Length = 165 Back     alignment and structure
>pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 Back     alignment and structure
>pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 Back     alignment and structure
>pdb|2CK1|A Chain A, The Structure Of Oxidised Cyclophilin A From S. Mansoni Length = 172 Back     alignment and structure
>pdb|3K0R|A Chain A, Cryogenic Structure Of Cypa Mutant Arg55lys Length = 165 Back     alignment and structure
>pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 Back     alignment and structure
>pdb|2X25|B Chain B, Free Acetyl-Cypa Orthorhombic Form Length = 169 Back     alignment and structure
>pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 Back     alignment and structure
>pdb|2CFE|A Chain A, The 1.5 A Crystal Structure Of The Malassezia Sympodialis Mala S 6 Allergen, A Member Of The Cyclophilin Pan- Allergen Family Length = 162 Back     alignment and structure
>pdb|2GW2|A Chain A, Crystal Structure Of The Peptidyl-Prolyl Isomerase Domain Of Human Cyclophilin G Length = 198 Back     alignment and structure
>pdb|2X83|B Chain B, Evolutionary Basis Of Hiv Restriction By The Antiretroviral Trimcyp Length = 163 Back     alignment and structure
>pdb|2ALF|A Chain A, Crystal Structure Of Human Cypa Mutant K131a Length = 164 Back     alignment and structure
>pdb|1H0P|A Chain A, Cyclophilin_5 From C. Elegans Length = 182 Back     alignment and structure
>pdb|1Z81|A Chain A, Crystal Structure Of Cyclophilin From Plasmodium Yoelii Length = 229 Back     alignment and structure
>pdb|2PLU|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 Length = 186 Back     alignment and structure
>pdb|3PMP|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa In Complex With Cyclosporin A Length = 164 Back     alignment and structure
>pdb|3O7T|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa Length = 164 Back     alignment and structure
>pdb|2C3B|A Chain A, The Crystal Structure Of Aspergillus Fumigatus Cyclophilin Reveals 3d Domain Swapping Of A Central Element Length = 172 Back     alignment and structure
>pdb|1AWS|A Chain A, Secypa Complexed With Hagpia (Pseudo-Symmetric Monomer) Length = 164 Back     alignment and structure
>pdb|1ZMF|A Chain A, C Domain Of Human Cyclophilin-33(Hcyp33) Length = 165 Back     alignment and structure
>pdb|2R99|A Chain A, Crystal Structure Of Cyclophilin Abh-Like Domain Of Human Peptidylprolyl Isomerase E Isoform 1 Length = 173 Back     alignment and structure
>pdb|3BKP|A Chain A, Crystal Structure Of The Toxoplasma Gondii Cyclophilin, 49.m03261 Length = 232 Back     alignment and structure
>pdb|2HQJ|A Chain A, Cyclophilin From Leishmania Major Length = 183 Back     alignment and structure
>pdb|2Z6W|A Chain A, Crystal Structure Of Human Cyclophilin D In Complex With Cyclosporin A Length = 165 Back     alignment and structure
>pdb|3R49|A Chain A, Human Cyclophilin D Complexed With Quinolin-8-Amine Length = 166 Back     alignment and structure
>pdb|2BIT|X Chain X, Crystal Structure Of Human Cyclophilin D At 1.7 A Resolution Length = 165 Back     alignment and structure
>pdb|3QYU|A Chain A, Crystal Structure Of Human Cyclophilin D At 1.54 A Resolution At Room Temperature Length = 164 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 2e-36
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 8e-32
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 1e-31
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 6e-29
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 4e-28
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 5e-28
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 1e-27
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 2e-27
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 2e-27
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 3e-27
2b71_A196 Cyclophilin-like protein; structural genomics, str 4e-27
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 4e-27
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 4e-26
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 2e-25
2hq6_A185 Serologically defined colon cancer antigen 10; pro 5e-25
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 4e-21
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 5e-17
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 1e-16
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 1e-15
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 2e-15
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 3e-15
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 1e-14
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 1e-14
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 2e-14
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 2e-14
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 4e-14
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 5e-14
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 7e-14
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 7e-14
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 1e-13
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 2e-13
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 3e-13
1z81_A229 Cyclophilin; structural genomics, structural genom 7e-13
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 3e-12
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 3e-12
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 Back     alignment and structure
 Score =  124 bits (315), Expect = 2e-36
 Identities = 51/163 (31%), Positives = 78/163 (47%), Gaps = 14/163 (8%)

Query: 30  RVVFQTNYGDIEFGFYPSVAPQTVDHIFKLVRLGCYNTNHFFRVDKGFVAQVADVVGGRS 89
            V+  T+ G+IE       AP +V +    V  G YN   F RV  GF+ Q     GG  
Sbjct: 6   HVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQ-----GG-- 58

Query: 90  APMNEVQRVEAEKTVVGEFS-DVKHVRGILSMGRYSDPNSAASSFSILLGDAPHLDG--- 145
               ++Q+ +    +  E    +++ RG ++M R +D +SA S F I + D   LD    
Sbjct: 59  GFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQR 118

Query: 146 --QYAVFGKVTKGDETLRKLEGLPTRKEGIFV-MPTERITIHS 185
              YAVFGKV KG +   K+  +PT   G +  +P++ + I S
Sbjct: 119 DFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILS 161
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query229
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 100.0
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 100.0
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 100.0
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 100.0
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 100.0
2b71_A196 Cyclophilin-like protein; structural genomics, str 100.0
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 100.0
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 100.0
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 100.0
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 100.0
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 100.0
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 100.0
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 100.0
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 100.0
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 100.0
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 100.0
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 100.0
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 100.0
2hq6_A185 Serologically defined colon cancer antigen 10; pro 100.0
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 100.0
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 100.0
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 100.0
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 100.0
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 100.0
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 100.0
4fru_A185 Cyclophilin B, peptidyl-prolyl CIS-trans isomerase 100.0
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 100.0
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 100.0
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
1z81_A229 Cyclophilin; structural genomics, structural genom 100.0
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 100.0
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 100.0
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 100.0
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 100.0
3kop_A188 Uncharacterized protein; protein with A cyclophili 95.43
2nnz_A153 Hypothetical protein; beta-barrel, structural geno 95.36
1zx8_A136 Hypothetical protein TM1367; structural genomics, 87.47
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
Probab=100.00  E-value=2.6e-49  Score=324.00  Aligned_cols=169  Identities=29%  Similarity=0.436  Sum_probs=150.2

Q ss_pred             CCCCCCCcEEEEEEeCceEEEEEcCCCCchhHHHHHHhhcCCCcCCceEeEEecCCEEEeecCCC-CCCCCCcccccccc
Q 027035           22 EDPQLGSARVVFQTNYGDIEFGFYPSVAPQTVDHIFKLVRLGCYNTNHFFRVDKGFVAQVADVVG-GRSAPMNEVQRVEA  100 (229)
Q Consensus        22 ~~p~~~~~~v~~~T~~G~I~ieL~~d~aP~t~~nF~~l~~~g~Y~g~~f~ri~~~~~iq~Gd~~~-~~~~~~~~~~~~~~  100 (229)
                      ..| ....+|.|+|+.|+|+||||++.||+||+||++||+.|||+|+.||||+|+|++||||+.+ +.+.+      ...
T Consensus        14 ~~~-~~~~~v~l~T~~G~I~ieL~~~~aP~tv~NF~~L~~~g~Ydg~~FhRVi~~f~iQgGd~~~~g~Gg~------si~   86 (197)
T 1zkc_A           14 LVP-RGSGYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGE------SYW   86 (197)
T ss_dssp             CCC-CSCEEEEEEETTEEEEEEECTTTSHHHHHHHHHHHHTTTTTTEEEEEEETTTEEEECCTTSSSSCCC------BTT
T ss_pred             CCC-CCCcEEEEEeCCccEEEEEcCCCCcHHHHHHHHHHhcCCCCCCEEEEEeCCCEEEcCCCCCCCCCCC------ccC
Confidence            344 3457999999999999999999999999999999999999999999999999999999875 22221      114


Q ss_pred             CccccCC-cCCCCC-CccEEEEecCCCCCCCcccEEEEcCCCCCCCCCCcEEEEEEcCHHHHHHHhcCCCCCC-CCCCCC
Q 027035          101 EKTVVGE-FSDVKH-VRGILSMGRYSDPNSAASSFSILLGDAPHLDGQYAVFGKVTKGDETLRKLEGLPTRKE-GIFVMP  177 (229)
Q Consensus       101 ~~~~~~e-~~~l~h-~~G~lsma~~~~~~~~~sqFfI~l~~~~~ld~~~~vFG~Vi~G~~vl~~I~~~~~~~~-~~~~~P  177 (229)
                      |..+++| .+.++| .+|+||||+ .+|++++|||||+++++++||++|+|||+|++|||||++|++++++.+ +   +|
T Consensus        87 g~~f~dE~~~~l~h~~~G~lsMAn-~gp~sngSQFFIt~~~~~~LDg~~tVFG~Vv~Gmdvv~~I~~~~t~~~~~---~P  162 (197)
T 1zkc_A           87 GKPFKDEFRPNLSHTGRGILSMAN-SGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTD---RP  162 (197)
T ss_dssp             BSCBCCCCCTTCCSCSTTEEEECC-SSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHHSCBCTTTC---CB
T ss_pred             CCccccccCcCcCCCCceEEEEec-CCCCCcccEEEEEcCCCCccCCCccEEEEEEcCHHHHHHHHcCCCCCCCC---Cc
Confidence            6778888 578999 899999999 689999999999999999999999999999999999999999999886 6   99


Q ss_pred             CcceEEEEeeeecCCcchhHHHHH
Q 027035          178 TERITIHSSYYYDTEMEICEKERS  201 (229)
Q Consensus       178 ~~~i~I~~~~vl~~~~~~~~~~~~  201 (229)
                      .++|+|.+|+++.+||++++.+..
T Consensus       163 ~~~i~I~~~~v~~dPf~d~~~~~~  186 (197)
T 1zkc_A          163 KEEIRIDATTVFVDPYEEADAQIA  186 (197)
T ss_dssp             SSCCEEEEEEEEECTTHHHHHHHH
T ss_pred             CCCeEEEEEEEEcCCcccHHHHHH
Confidence            999999999999999988775333
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A Back     alignment and structure
>4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Back     alignment and structure
>3kop_A Uncharacterized protein; protein with A cyclophilin-like fold, structural genomics, J center for structural genomics, JCSG; 1.90A {Arthrobacter SP} Back     alignment and structure
>2nnz_A Hypothetical protein; beta-barrel, structural genomics, ontario centre for structu proteomics, OCSP, unknown function; NMR {Archaeoglobus fulgidus} Back     alignment and structure
>1zx8_A Hypothetical protein TM1367; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: 1PE; 1.90A {Thermotoga maritima} SCOP: b.62.1.3 PDB: 2ka0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 229
d1zkca1178 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso 1e-31
d1xwna1166 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome 2e-29
d1lopa_164 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 4e-25
d2ok3a1159 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B 2e-24
d2fu0a1155 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { 1e-23
d2b71a1169 b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 9e-23
d1w74a_171 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 4e-22
d1v9ta_166 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 8e-22
d2a2na1164 b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma 8e-22
d2c3ba1171 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper 1e-21
d2cfea1162 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 2e-21
d1a33a_174 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( 2e-20
d1qnga_170 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium 2e-19
d1ihga2195 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain 1e-18
d1qoia_173 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom 3e-18
d2igva1172 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno 4e-18
d1xo7a_166 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom 4e-18
d2r99a1161 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl 6e-18
d2rmca_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus 2e-17
d2z6wa1164 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c 2e-17
d1z81a1186 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas 4e-16
d1h0pa_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd 9e-15
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure

class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  112 bits (280), Expect = 1e-31
 Identities = 48/181 (26%), Positives = 80/181 (44%), Gaps = 15/181 (8%)

Query: 31  VVFQTNYGDIEFGFYPSVAPQTVDHIFKLVRLGCYNTNHFFRVDKGFVAQVADVVG-GRS 89
           V   TN GD+    +  + P+T ++  +L +   Y+   F R  + FV Q  D  G G  
Sbjct: 3   VRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTG 62

Query: 90  APMNEVQRVEAEKTVVGEFSDVKHV-RGILSMGRYSDPNSAASSFSILLGDAPHLDGQYA 148
                 +  + E        ++ H  RGILSM   S PNS  S F I      +LD ++ 
Sbjct: 63  GESYWGKPFKDEF-----RPNLSHTGRGILSMAN-SGPNSNRSQFFITFRSCAYLDKKHT 116

Query: 149 VFGKVTKGDETLRKLEGLPTRKEGIFVMPTERI-----TIHSSYYYDTEMEICEKERSVL 203
           +FG+V  G + L  +E + +  +     P E I     T+    Y + + +I ++ ++ L
Sbjct: 117 IFGRVVGGFDVLTAMENVESDPKTD--RPKEEIRIDATTVFVDPYEEADAQIAQERKTQL 174

Query: 204 K 204
           K
Sbjct: 175 K 175
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query229
d1zkca1178 Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop 100.0
d2ok3a1159 Cyclophilin-like protein PPIL3B {Human (Homo sapie 100.0
d1v9ta_166 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d2fu0a1155 Putative cyclophilin PFE0505w {Plasmodium falcipar 100.0
d2b71a1169 Cyclophilin-like protein PY00693 {Plasmodium yoeli 100.0
d1xwna1166 Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 100.0
d2igva1172 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d2a2na1164 Peptidylprolyl isomerase domain and WD repeat-cont 100.0
d1qoia_173 Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 100.0
d2z6wa1164 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d1w74a_171 Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob 100.0
d2r99a1161 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d1xo7a_166 Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId 100.0
d1lopa_164 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d1qnga_170 Cyclophilin (eukaryotic) {Plasmodium falciparum [T 100.0
d1a33a_174 Cyclophilin (eukaryotic) {Nematode (Brugia malayi) 100.0
d1ihga2195 Cyclophilin 40 isomerase domain {Cow (Bos taurus) 100.0
d2rmca_182 Cyclophilin (eukaryotic) {Mouse (Mus musculus), va 100.0
d2cfea1162 Cyclophilin-like allergen Mal s 6 {Malassezia symp 100.0
d1h0pa_182 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d1z81a1186 Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId 100.0
d2c3ba1171 Cyclophilin (eukaryotic) {Aspergillus fumigatus [T 100.0
d1zx8a1124 Hypothetical protein TM1367 {Thermotoga maritima [ 87.74
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.9e-45  Score=296.36  Aligned_cols=163  Identities=28%  Similarity=0.414  Sum_probs=144.4

Q ss_pred             EEEEEEeCceEEEEEcCCCCchhHHHHHHhhcCCCcCCceEeEEecCCEEEeecCCCC-CCCCCccccccccCccccCC-
Q 027035           30 RVVFQTNYGDIEFGFYPSVAPQTVDHIFKLVRLGCYNTNHFFRVDKGFVAQVADVVGG-RSAPMNEVQRVEAEKTVVGE-  107 (229)
Q Consensus        30 ~v~~~T~~G~I~ieL~~d~aP~t~~nF~~l~~~g~Y~g~~f~ri~~~~~iq~Gd~~~~-~~~~~~~~~~~~~~~~~~~e-  107 (229)
                      +|.|+|++|+|+||||.+.||++|+||++||+.++|+|+.|||+++++++|+||+... .+.      ....+..+++| 
T Consensus         2 ~v~l~T~~G~i~IeL~~~~aP~tv~nF~~L~~~~~Y~g~~f~rv~~~~~iq~Gd~~~~~~~~------~~~~~~~~~~E~   75 (178)
T d1zkca1           2 YVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGG------ESYWGKPFKDEF   75 (178)
T ss_dssp             EEEEEETTEEEEEEECTTTSHHHHHHHHHHHHTTTTTTEEEEEEETTTEEEECCTTSSSSCC------CBTTBSCBCCCC
T ss_pred             EEEEEeCCEEEEEEEcCCCChHHHHHHHHHHhcCCcCceEeeeccceeEEecCCccCCCCCC------cccCCCCcCCcc
Confidence            7999999999999999999999999999999999999999999999999999998762 221      11245667777 


Q ss_pred             cCCCCC-CccEEEEecCCCCCCCcccEEEEcCCCCCCCCCCcEEEEEEcCHHHHHHHhcCCCCC-CCCCCCCCcceEEEE
Q 027035          108 FSDVKH-VRGILSMGRYSDPNSAASSFSILLGDAPHLDGQYAVFGKVTKGDETLRKLEGLPTRK-EGIFVMPTERITIHS  185 (229)
Q Consensus       108 ~~~l~h-~~G~lsma~~~~~~~~~sqFfI~l~~~~~ld~~~~vFG~Vi~G~~vl~~I~~~~~~~-~~~~~~P~~~i~I~~  185 (229)
                      ...++| .+|+|||++ .++++++|||||+++++++||++|+|||+|++|||+|++|++++++. ++   +|.++|+|.+
T Consensus        76 ~~~l~~~~~G~lsma~-~~~~s~~sqF~It~~~~~~ld~~~~vFG~Vv~G~dvl~~I~~~~t~~~~~---~P~~~v~I~~  151 (178)
T d1zkca1          76 RPNLSHTGRGILSMAN-SGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTD---RPKEEIRIDA  151 (178)
T ss_dssp             CTTCCSCSTTEEEECC-SSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHHSCBCTTTC---CBSSCCEEEE
T ss_pred             ccccCCCCCeEEEEee-cCCCCccceeeccccCCcccCCcceEEEEeeCcHHHHHHHHcCCCCCCCC---ccCCCeEEEE
Confidence            567888 899999999 67999999999999999999999999999999999999999999874 45   9999999999


Q ss_pred             eeeecCCcchhHHHHHH
Q 027035          186 SYYYDTEMEICEKERSV  202 (229)
Q Consensus       186 ~~vl~~~~~~~~~~~~~  202 (229)
                      |.|+.+||++++.+...
T Consensus       152 ~~Il~~pf~~~~~~~~~  168 (178)
T d1zkca1         152 TTVFVDPYEEADAQIAQ  168 (178)
T ss_dssp             EEEEECTTHHHHHHHHH
T ss_pred             EEEEcCCcchhhHHHhh
Confidence            99999999877644433
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1zx8a1 b.62.1.3 (A:1-124) Hypothetical protein TM1367 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure