Citrus Sinensis ID: 027054
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 229 | 2.2.26 [Sep-21-2011] | |||||||
| Q4R5M2 | 339 | Cathepsin B OS=Macaca fas | N/A | no | 0.908 | 0.613 | 0.436 | 3e-50 | |
| P07858 | 339 | Cathepsin B OS=Homo sapie | yes | no | 0.908 | 0.613 | 0.436 | 5e-50 | |
| P43509 | 344 | Cathepsin B-like cysteine | yes | no | 0.820 | 0.546 | 0.490 | 5e-50 | |
| Q5R6D1 | 339 | Cathepsin B OS=Pongo abel | yes | no | 0.908 | 0.613 | 0.436 | 6e-50 | |
| P00787 | 339 | Cathepsin B OS=Rattus nor | yes | no | 0.838 | 0.566 | 0.466 | 4e-49 | |
| A1E295 | 335 | Cathepsin B OS=Sus scrofa | yes | no | 0.838 | 0.573 | 0.451 | 1e-48 | |
| P25793 | 342 | Cathepsin B-like cysteine | N/A | no | 0.842 | 0.564 | 0.447 | 1e-47 | |
| P10605 | 339 | Cathepsin B OS=Mus muscul | yes | no | 0.829 | 0.560 | 0.455 | 1e-47 | |
| P19092 | 342 | Cathepsin B-like cysteine | N/A | no | 0.842 | 0.564 | 0.438 | 3e-47 | |
| P43233 | 340 | Cathepsin B OS=Gallus gal | yes | no | 0.812 | 0.547 | 0.458 | 6e-47 |
| >sp|Q4R5M2|CATB_MACFA Cathepsin B OS=Macaca fascicularis GN=CTSB PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 197 bits (502), Expect = 3e-50, Method: Compositional matrix adjust.
Identities = 99/227 (43%), Positives = 146/227 (64%), Gaps = 19/227 (8%)
Query: 6 TNRDALSSSPYVSLQNLSLSVNDLLACCGFLCGDGCDGGYPISAWRYFVHHGVVTEE--- 62
++R + ++ +VS++ +S DLL CCG +CGDGC+GGYP AW ++ G+V+
Sbjct: 118 SDRICIHTNAHVSVE---VSAEDLLTCCGIMCGDGCNGGYPAGAWNFWTRKGLVSGGLYD 174
Query: 63 ----CDPYFDSTGCSH------PGCEPAYPTPKCVRKCVKK-NQLWRNSKHYSISAYRIN 111
C PY C H P C TPKC + C + ++ KHY ++Y ++
Sbjct: 175 SHVGCRPY-SIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVS 233
Query: 112 SDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAVKLIGWGTSDDGED 171
+ +DIMAEIYKNGPVE +F+VY DF YKSGVY+H+TG++MGGHA++++GWG ++G
Sbjct: 234 NSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGV-ENGTP 292
Query: 172 YWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLPSSKNLVKEI 218
YW++AN WN WG +G+FKI RG + CGIE +VVAG+P + ++I
Sbjct: 293 YWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI 339
|
Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis. Macaca fascicularis (taxid: 9541) EC: 3EC: .EC: 4EC: .EC: 2EC: 2EC: .EC: 1 |
| >sp|P07858|CATB_HUMAN Cathepsin B OS=Homo sapiens GN=CTSB PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|P43509|CPR5_CAEEL Cathepsin B-like cysteine proteinase 5 OS=Caenorhabditis elegans GN=cpr-5 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q5R6D1|CATB_PONAB Cathepsin B OS=Pongo abelii GN=CTSB PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P00787|CATB_RAT Cathepsin B OS=Rattus norvegicus GN=Ctsb PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|A1E295|CATB_PIG Cathepsin B OS=Sus scrofa GN=CTSB PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P25793|CYSP2_HAECO Cathepsin B-like cysteine proteinase 2 OS=Haemonchus contortus GN=AC-2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P10605|CATB_MOUSE Cathepsin B OS=Mus musculus GN=Ctsb PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P19092|CYSP1_HAECO Cathepsin B-like cysteine proteinase 1 OS=Haemonchus contortus GN=AC-1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P43233|CATB_CHICK Cathepsin B OS=Gallus gallus GN=CTSB PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 229 | ||||||
| 255548165 | 376 | cathepsin B, putative [Ricinus communis] | 0.917 | 0.558 | 0.825 | 1e-106 | |
| 224064400 | 357 | predicted protein [Populus trichocarpa] | 0.917 | 0.588 | 0.828 | 1e-104 | |
| 449489527 | 349 | PREDICTED: cathepsin B-like [Cucumis sat | 0.860 | 0.564 | 0.852 | 1e-104 | |
| 449446774 | 348 | PREDICTED: cathepsin B-like [Cucumis sat | 0.860 | 0.566 | 0.852 | 1e-103 | |
| 356505709 | 357 | PREDICTED: cathepsin B-like [Glycine max | 0.899 | 0.577 | 0.812 | 1e-101 | |
| 18378947 | 362 | putative cathepsin B-like cysteine prote | 0.886 | 0.560 | 0.827 | 1e-101 | |
| 297843028 | 360 | hypothetical protein ARALYDRAFT_887368 [ | 0.886 | 0.563 | 0.822 | 1e-101 | |
| 224064398 | 325 | predicted protein [Populus trichocarpa] | 0.917 | 0.646 | 0.804 | 1e-101 | |
| 357511629 | 357 | Cathepsin B [Medicago truncatula] gi|872 | 0.886 | 0.568 | 0.807 | 1e-101 | |
| 217072748 | 359 | unknown [Medicago truncatula] gi|3885054 | 0.886 | 0.565 | 0.807 | 1e-101 |
| >gi|255548165|ref|XP_002515139.1| cathepsin B, putative [Ricinus communis] gi|223545619|gb|EEF47123.1| cathepsin B, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 388 bits (997), Expect = e-106, Method: Compositional matrix adjust.
Identities = 175/212 (82%), Positives = 195/212 (91%), Gaps = 2/212 (0%)
Query: 20 QNLSLSVNDLLACCGFLCGDGCDGGYPISAWRYFVHHGVVTEECDPYFDSTGCSHPGCEP 79
N+SLSVNDLLACCGFLCGDGCDGGYP+ AWRYFVHHGVVTEECDPYFD+ GCSHPGCEP
Sbjct: 165 MNISLSVNDLLACCGFLCGDGCDGGYPMYAWRYFVHHGVVTEECDPYFDNIGCSHPGCEP 224
Query: 80 AYPTPKCVRKCVKKNQLWRNSKHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAH 139
+PTPKCVRKC+ KNQLWR SKHYS++AYRI+SDP D+MAE+YKNGPVEVSFTVYEDFAH
Sbjct: 225 GFPTPKCVRKCIDKNQLWRQSKHYSVNAYRISSDPHDVMAEVYKNGPVEVSFTVYEDFAH 284
Query: 140 YKSGVYKHITGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECG 199
YKSGVYKHITG+VMGGHAVKLIGWGTSD+GEDYW+LANQWNR WG DGYFKI+RG+NECG
Sbjct: 285 YKSGVYKHITGEVMGGHAVKLIGWGTSDNGEDYWLLANQWNRGWGDDGYFKIRRGTNECG 344
Query: 200 IEEDVVAGLPSSKN--LVKEITSADMFEDASA 229
IE+D VAGLPS++N LV+E+ S D EDA A
Sbjct: 345 IEDDAVAGLPSARNLDLVREVASMDALEDAFA 376
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224064400|ref|XP_002301457.1| predicted protein [Populus trichocarpa] gi|222843183|gb|EEE80730.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449489527|ref|XP_004158338.1| PREDICTED: cathepsin B-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449446774|ref|XP_004141146.1| PREDICTED: cathepsin B-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356505709|ref|XP_003521632.1| PREDICTED: cathepsin B-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|18378947|ref|NP_563648.1| putative cathepsin B-like cysteine protease [Arabidopsis thaliana] gi|16226808|gb|AAL16267.1|AF428337_1 At1g02300/T6A9_10 [Arabidopsis thaliana] gi|14532526|gb|AAK63991.1| At1g02300/T6A9_10 [Arabidopsis thaliana] gi|25090140|gb|AAN72238.1| At1g02300/T6A9_10 [Arabidopsis thaliana] gi|332189292|gb|AEE27413.1| putative cathepsin B-like cysteine protease [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297843028|ref|XP_002889395.1| hypothetical protein ARALYDRAFT_887368 [Arabidopsis lyrata subsp. lyrata] gi|297335237|gb|EFH65654.1| hypothetical protein ARALYDRAFT_887368 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|224064398|ref|XP_002301456.1| predicted protein [Populus trichocarpa] gi|222843182|gb|EEE80729.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357511629|ref|XP_003626103.1| Cathepsin B [Medicago truncatula] gi|87240982|gb|ABD32840.1| Peptidase C1A, papain; Somatotropin hormone; Peptidase C1, propeptide [Medicago truncatula] gi|355501118|gb|AES82321.1| Cathepsin B [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|217072748|gb|ACJ84734.1| unknown [Medicago truncatula] gi|388505480|gb|AFK40806.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 229 | ||||||
| TAIR|locus:505006093 | 362 | AT1G02305 [Arabidopsis thalian | 0.882 | 0.558 | 0.757 | 6.7e-88 | |
| TAIR|locus:2204873 | 379 | AT1G02300 [Arabidopsis thalian | 0.882 | 0.532 | 0.722 | 2.1e-84 | |
| TAIR|locus:2133402 | 359 | AT4G01610 [Arabidopsis thalian | 0.908 | 0.579 | 0.687 | 2.5e-81 | |
| ZFIN|ZDB-GENE-070323-1 | 326 | ctsbb "capthepsin B, b" [Danio | 0.711 | 0.5 | 0.469 | 1.2e-42 | |
| UNIPROTKB|E2R6Q7 | 339 | CTSB "Uncharacterized protein" | 0.751 | 0.507 | 0.441 | 2.5e-42 | |
| UNIPROTKB|P07858 | 339 | CTSB "Cathepsin B" [Homo sapie | 0.751 | 0.507 | 0.441 | 5.2e-42 | |
| WB|WBGene00000784 | 335 | cpr-4 [Caenorhabditis elegans | 0.716 | 0.489 | 0.475 | 1.1e-41 | |
| RGD|621509 | 339 | Ctsb "cathepsin B" [Rattus nor | 0.724 | 0.489 | 0.450 | 4.6e-41 | |
| UNIPROTKB|Q6IN22 | 339 | Ctsb "Cathepsin B" [Rattus nor | 0.724 | 0.489 | 0.450 | 4.6e-41 | |
| UNIPROTKB|A1E295 | 335 | CTSB "Cathepsin B" [Sus scrofa | 0.711 | 0.486 | 0.446 | 5.9e-41 |
| TAIR|locus:505006093 AT1G02305 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 878 (314.1 bits), Expect = 6.7e-88, P = 6.7e-88
Identities = 153/202 (75%), Positives = 170/202 (84%)
Query: 21 NLSLSVNXXXXXXXXXXXXXXXXXYPISAWRYFVHHGVVTEECDPYFDSTGCSHPGCEPA 80
N+SLSVN YPI+AWRYF HHGVVTEECDPYFD+TGCSHPGCEPA
Sbjct: 154 NVSLSVNDLLACCGFLCGQGCNGGYPIAAWRYFKHHGVVTEECDPYFDNTGCSHPGCEPA 213
Query: 81 YPTPKCVRKCVKKNQLWRNSKHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHY 140
YPTPKC RKCV NQLWR SKHY +SAY++ S P+DIMAE+YKNGPVEV+FTVYEDFAHY
Sbjct: 214 YPTPKCARKCVSGNQLWRESKHYGVSAYKVRSHPDDIMAEVYKNGPVEVAFTVYEDFAHY 273
Query: 141 KSGVYKHITGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGI 200
KSGVYKHITG +GGHAVKLIGWGTSDDGEDYW+LANQWNRSWG DGYFKI+RG+NECGI
Sbjct: 274 KSGVYKHITGTNIGGHAVKLIGWGTSDDGEDYWLLANQWNRSWGDDGYFKIRRGTNECGI 333
Query: 201 EEDVVAGLPSSKNLVKEITSAD 222
E VVAGLPS +N+VK IT++D
Sbjct: 334 EHGVVAGLPSDRNVVKGITTSD 355
|
|
| TAIR|locus:2204873 AT1G02300 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2133402 AT4G01610 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070323-1 ctsbb "capthepsin B, b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R6Q7 CTSB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P07858 CTSB "Cathepsin B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00000784 cpr-4 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| RGD|621509 Ctsb "cathepsin B" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6IN22 Ctsb "Cathepsin B" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A1E295 CTSB "Cathepsin B" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.4.22 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 229 | |||
| cd02620 | 236 | cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro | 3e-98 | |
| pfam00112 | 213 | pfam00112, Peptidase_C1, Papain family cysteine pr | 3e-64 | |
| cd02248 | 210 | cd02248, Peptidase_C1A, Peptidase C1A subfamily (M | 1e-41 | |
| cd02621 | 243 | cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al | 1e-37 | |
| smart00645 | 175 | smart00645, Pept_C1, Papain family cysteine protea | 3e-34 | |
| cd02698 | 239 | cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th | 2e-32 | |
| cd02619 | 223 | cd02619, Peptidase_C1, C1 Peptidase family (MEROPS | 8e-25 | |
| PTZ00200 | 448 | PTZ00200, PTZ00200, cysteine proteinase; Provision | 2e-22 | |
| PTZ00049 | 693 | PTZ00049, PTZ00049, cathepsin C-like protein; Prov | 2e-21 | |
| PTZ00364 | 548 | PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs | 1e-18 | |
| PTZ00203 | 348 | PTZ00203, PTZ00203, cathepsin L protease; Provisio | 3e-13 | |
| PTZ00021 | 489 | PTZ00021, PTZ00021, falcipain-2; Provisional | 3e-11 | |
| PTZ00462 | 1004 | PTZ00462, PTZ00462, Serine-repeat antigen protein; | 8e-07 | |
| COG4870 | 372 | COG4870, COG4870, Cysteine protease [Posttranslati | 8e-05 |
| >gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
Score = 285 bits (732), Expect = 3e-98
Identities = 102/193 (52%), Positives = 124/193 (64%), Gaps = 10/193 (5%)
Query: 20 QNLSLSVNDLLACCGFLCGDGCDGGYPISAWRYFVHHGVVTEECDPYFDSTGCSHPG--- 76
+N+ LS DLL+CC CGDGC+GGYP +AW+Y GVVT C PY HP
Sbjct: 49 ENVLLSAQDLLSCCSG-CGDGCNGGYPDAAWKYLTTTGVVTGGCQPYTIPPCGHHPEGPP 107
Query: 77 --CEPAYPTPKCVRKCVKKNQLWRNSKHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVY 134
C Y TPKC C + + KH SAY + SD DIM EI NGPV+ +FTVY
Sbjct: 108 PCCGTPYCTPKCQDGC---EKTYEEDKHKGKSAYSVPSDETDIMKEIMTNGPVQAAFTVY 164
Query: 135 EDFAHYKSGVYKHITGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRG 194
EDF +YKSGVY+H +G +GGHAVK+IGWG ++G YW+ AN W WG +GYF+I RG
Sbjct: 165 EDFLYYKSGVYQHTSGKQLGGHAVKIIGWGV-ENGVPYWLAANSWGTDWGENGYFRILRG 223
Query: 195 SNECGIEEDVVAG 207
SNECGIE +VVAG
Sbjct: 224 SNECGIESEVVAG 236
|
Cathepsin B is a lysosomal papain-like cysteine peptidase which is expressed in all tissues and functions primarily as an exopeptidase through its carboxydipeptidyl activity. Together with other cathepsins, it is involved in the degradation of proteins, proenzyme activation, Ag processing, metabolism and apoptosis. Cathepsin B has been implicated in a number of human diseases such as cancer, rheumatoid arthritis, osteoporosis and Alzheimer's disease. The unique carboxydipeptidyl activity of cathepsin B is attributed to the presence of an occluding loop in its active site which favors the binding of the C-termini of substrate proteins. Some members of this group do not possess the occluding loop. TIN-Ag is an extracellular matrix basement protein which was originally identified as a target Ag involved in anti-tubular basement membrane antibody-mediated interstitial nephritis. It plays a role in renal tubulogenesis and is defective in hereditary tubulointerstitial disorders. TIN-Ag is exclusively expressed in kidney tissues. . Length = 236 |
| >gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 229 | |||
| cd02698 | 239 | Peptidase_C1A_CathepsinX Cathepsin X; the only pap | 100.0 | |
| cd02620 | 236 | Peptidase_C1A_CathepsinB Cathepsin B group; compos | 100.0 | |
| KOG1542 | 372 | consensus Cysteine proteinase Cathepsin F [Posttra | 100.0 | |
| cd02621 | 243 | Peptidase_C1A_CathepsinC Cathepsin C; also known a | 100.0 | |
| cd02248 | 210 | Peptidase_C1A Peptidase C1A subfamily (MEROPS data | 100.0 | |
| PTZ00203 | 348 | cathepsin L protease; Provisional | 100.0 | |
| KOG1543 | 325 | consensus Cysteine proteinase Cathepsin L [Posttra | 100.0 | |
| PTZ00200 | 448 | cysteine proteinase; Provisional | 100.0 | |
| PTZ00364 | 548 | dipeptidyl-peptidase I precursor; Provisional | 100.0 | |
| PTZ00049 | 693 | cathepsin C-like protein; Provisional | 100.0 | |
| PTZ00021 | 489 | falcipain-2; Provisional | 100.0 | |
| PF00112 | 219 | Peptidase_C1: Papain family cysteine protease This | 100.0 | |
| PTZ00462 | 1004 | Serine-repeat antigen protein; Provisional | 100.0 | |
| cd02619 | 223 | Peptidase_C1 C1 Peptidase family (MEROPS database | 100.0 | |
| KOG1544 | 470 | consensus Predicted cysteine proteinase TIN-ag [Ge | 100.0 | |
| smart00645 | 174 | Pept_C1 Papain family cysteine protease. | 100.0 | |
| COG4870 | 372 | Cysteine protease [Posttranslational modification, | 99.78 | |
| cd00585 | 437 | Peptidase_C1B Peptidase C1B subfamily (MEROPS data | 99.68 | |
| PF03051 | 438 | Peptidase_C1_2: Peptidase C1-like family This fami | 98.97 | |
| COG3579 | 444 | PepC Aminopeptidase C [Amino acid transport and me | 97.34 | |
| PF13529 | 144 | Peptidase_C39_2: Peptidase_C39 like family; PDB: 3 | 96.05 | |
| PF09778 | 212 | Guanylate_cyc_2: Guanylylate cyclase; InterPro: IP | 93.62 | |
| PF05543 | 175 | Peptidase_C47: Staphopain peptidase C47; InterPro: | 93.14 | |
| COG4990 | 195 | Uncharacterized protein conserved in bacteria [Fun | 91.65 | |
| PF14399 | 317 | Transpep_BrtH: NlpC/p60-like transpeptidase | 88.88 | |
| KOG4128 | 457 | consensus Bleomycin hydrolases and aminopeptidases | 86.22 | |
| cd02549 | 141 | Peptidase_C39A A sub-family of peptidase family C3 | 82.24 | |
| PF01640 | 192 | Peptidase_C10: Peptidase C10 family classification | 81.88 |
| >cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.7e-48 Score=325.78 Aligned_cols=195 Identities=32% Similarity=0.682 Sum_probs=153.6
Q ss_pred hchHHHHhcccc-ccC---CCCCCCHHHHhhcCCCCCCCCCCCCChHHHHHHHHHcCccCCCCccCCCCCCCCCCCCCCC
Q 027054 5 RTNRDALSSSPY-VSL---QNLSLSVNDLLACCGFLCGDGCDGGYPISAWRYFVHHGVVTEECDPYFDSTGCSHPGCEPA 80 (229)
Q Consensus 5 ~~~~~a~~s~~~-~~~---~~~~lS~Q~l~dC~~~~~~~gC~Gg~~~~Al~~~~~~Gi~~e~~~PY~~~~~~~~~~c~~~ 80 (229)
-|++.+||+... +++ +.++||+|||+||+. ++||+||++..||+|++++|+++|++|||.... ..|.+.
T Consensus 34 fa~~~aies~~~i~~~~~~~~~~lS~Q~lldC~~---~~gC~GG~~~~a~~~~~~~Gl~~e~~yPY~~~~----~~C~~~ 106 (239)
T cd02698 34 HGSTSALADRINIARKGAWPSVYLSVQVVIDCAG---GGSCHGGDPGGVYEYAHKHGIPDETCNPYQAKD----GECNPF 106 (239)
T ss_pred HHhHHHHHHHHHHHHCCCCCCcccCHHHHHhCCC---CCCccCcCHHHHHHHHHHcCcCCCCeeCCcCCC----CCCcCC
Confidence 356666665442 222 468999999999996 689999999999999999999999999997642 123222
Q ss_pred CCCccccc--ccccccccccccceeEeeeEEeCCcHHHHHHHHHhCCCEEEEEEecCcccccCCceEEccCCCccCCcEE
Q 027054 81 YPTPKCVR--KCVKKNQLWRNSKHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAV 158 (229)
Q Consensus 81 ~~~~~~~~--~c~~~~~~~~~~~~~~i~~y~~~~~~~~ik~~L~~~gPV~v~~~~~~~f~~y~~Giy~~~~~~~~~~Hav 158 (229)
..+..|.. .|.... ....+.+..|....+.++||++|+++|||+++|.+.++|+.|++|||+..++...++|+|
T Consensus 107 ~~~~~c~~~~~c~~~~----~~~~~~i~~~~~~~~~~~i~~~l~~~GPV~v~i~~~~~f~~Y~~GIy~~~~~~~~~~HaV 182 (239)
T cd02698 107 NRCGTCNPFGECFAIK----NYTLYFVSDYGSVSGRDKMMAEIYARGPISCGIMATEALENYTGGVYKEYVQDPLINHII 182 (239)
T ss_pred CCCCCcccCccccccc----ccceEEeeeceecCCHHHHHHHHHHcCCEEEEEEecccccccCCeEEccCCCCCcCCeEE
Confidence 22222321 333221 133466777772245688999999999999999998899999999998876666689999
Q ss_pred EEEEecccCCCceEEEEEcCCCCCCCCCCeEEEEeCC-----CccCcCcceeEEeec
Q 027054 159 KLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGS-----NECGIEEDVVAGLPS 210 (229)
Q Consensus 159 ~iVGyg~~~~~~~ywivkNSWG~~WG~~Gy~~i~~~~-----n~cgi~~~~~~~~p~ 210 (229)
+|||||++.++++|||||||||++||++|||||+|+. |+||||+.++++.|.
T Consensus 183 ~IVGyG~~~~g~~YWiikNSWG~~WGe~Gy~~i~rg~~~~~~~~~~i~~~~~~~~~~ 239 (239)
T cd02698 183 SVAGWGVDENGVEYWIVRNSWGEPWGERGWFRIVTSSYKGARYNLAIEEDCAWADPI 239 (239)
T ss_pred EEEEEEecCCCCEEEEEEcCCCcccCcCceEEEEccCCcccccccccccceEEEeeC
Confidence 9999994434899999999999999999999999999 999999999999884
|
It can also act as a carboxydipeptidase, like cathepsin B, but has been shown to preferentially cleave substrates through a monopeptidyl carboxypeptidase pathway. The propeptide region of cathepsin X, the shortest among papain-like peptidases, is covalently attached to the active site cysteine in the inactive form of the enzyme. Little is known about the biological function of cathepsin X. Some studies point to a role in early tumorigenesis. A more recent study indicates that cathepsin X expression is restricted to immune cells suggesting a role in phagocytosis and the regulation of the immune response. |
| >cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >KOG1542 consensus Cysteine proteinase Cathepsin F [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >PTZ00203 cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >KOG1543 consensus Cysteine proteinase Cathepsin L [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00200 cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00364 dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >PTZ00049 cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00021 falcipain-2; Provisional | Back alignment and domain information |
|---|
| >PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification | Back alignment and domain information |
|---|
| >PTZ00462 Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >KOG1544 consensus Predicted cysteine proteinase TIN-ag [General function prediction only] | Back alignment and domain information |
|---|
| >smart00645 Pept_C1 Papain family cysteine protease | Back alignment and domain information |
|---|
| >COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) | Back alignment and domain information |
|---|
| >PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13529 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3ERV_A | Back alignment and domain information |
|---|
| >PF09778 Guanylate_cyc_2: Guanylylate cyclase; InterPro: IPR018616 Members of this family of proteins catalyse the conversion of guanosine triphosphate (GTP) to 3',5'-cyclic guanosine monophosphate (cGMP) and pyrophosphate | Back alignment and domain information |
|---|
| >PF05543 Peptidase_C47: Staphopain peptidase C47; InterPro: IPR008750 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG4990 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF14399 Transpep_BrtH: NlpC/p60-like transpeptidase | Back alignment and domain information |
|---|
| >KOG4128 consensus Bleomycin hydrolases and aminopeptidases of cysteine protease family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd02549 Peptidase_C39A A sub-family of peptidase family C39 | Back alignment and domain information |
|---|
| >PF01640 Peptidase_C10: Peptidase C10 family classification | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 229 | ||||
| 1pbh_A | 317 | Crystal Structure Of Human Recombinant Procathepsin | 1e-40 | ||
| 1gmy_A | 261 | Cathepsin B Complexed With Dipeptidyl Nitrile Inhib | 1e-40 | ||
| 3cbj_A | 266 | Chagasin-cathepsin B Complex Length = 266 | 1e-40 | ||
| 3k9m_A | 254 | Cathepsin B In Complex With Stefin A Length = 254 | 2e-40 | ||
| 3ai8_B | 256 | Cathepsin B In Complex With The Nitroxoline Length | 2e-40 | ||
| 1huc_B | 205 | The Refined 2.15 Angstroms X-Ray Crystal Structure | 2e-40 | ||
| 1cpj_A | 260 | Crystal Structures Of Recombinant Rat Cathepsin B A | 4e-40 | ||
| 1mir_A | 322 | Rat Procathepsin B Length = 322 | 4e-40 | ||
| 1cte_A | 254 | Crystal Structures Of Recombinant Rat Cathepsin B A | 4e-40 | ||
| 1qdq_A | 253 | X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 | 6e-39 | ||
| 1ito_A | 256 | Crystal Structure Analysis Of Bovine Spleen Catheps | 7e-39 | ||
| 1sp4_B | 205 | Crystal Structure Of Ns-134 In Complex With Bovine | 7e-39 | ||
| 3qsd_A | 254 | Structure Of Cathepsin B1 From Schistosoma Mansoni | 2e-37 | ||
| 3mor_A | 317 | Crystal Structure Of Cathepsin B From Trypanosoma B | 6e-35 | ||
| 3hhi_A | 325 | Crystal Structure Of Cathepsin B From T. Brucei In | 7e-35 | ||
| 4hwy_A | 340 | Trypanosoma Brucei Procathepsin B Solved From 40 Fs | 7e-35 | ||
| 3pdf_A | 441 | Discovery Of Novel Cyanamide-Based Inhibitors Of Ca | 3e-22 | ||
| 1jqp_A | 438 | Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric | 7e-21 | ||
| 1ef7_A | 242 | Crystal Structure Of Human Cathepsin X Length = 242 | 5e-15 | ||
| 1deu_A | 277 | Crystal Structure Of Human Procathepsin X: A Cystei | 5e-15 | ||
| 3qj3_A | 331 | Structure Of Digestive Procathepsin L2 Proteinase F | 2e-13 | ||
| 8pch_A | 220 | Crystal Structure Of Porcine Cathepsin H Determined | 2e-12 | ||
| 1k3b_C | 69 | Crystal Structure Of Human Dipeptidyl Peptidase I ( | 5e-12 | ||
| 2o6x_A | 310 | Crystal Structure Of Procathepsin L1 From Fasciola | 4e-11 | ||
| 3p5w_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 9e-10 | ||
| 3p5u_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 9e-10 | ||
| 1aec_A | 218 | Crystal Structure Of Actinidin-E-64 Complex+ Length | 1e-09 | ||
| 3qt4_A | 329 | Structure Of Digestive Procathepsin L 3 Of Tenebrio | 2e-09 | ||
| 1cqd_A | 221 | The 2.1 Angstrom Structure Of A Cysteine Protease W | 2e-09 | ||
| 1s4v_A | 229 | The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst | 3e-09 | ||
| 2p7u_A | 215 | The Crystal Structure Of Rhodesain, The Major Cyste | 3e-09 | ||
| 2act_A | 220 | Crystallographic Refinement Of The Structure Of Act | 5e-09 | ||
| 2fo5_A | 262 | Crystal Structure Of Recombinant Barley Cysteine En | 6e-09 | ||
| 3d6s_A | 223 | Crystal Structure Of Mite Allergen Der F 1 Length = | 7e-09 | ||
| 1yvb_A | 241 | The Plasmodium Falciparum Cysteine Protease Falcipa | 8e-09 | ||
| 3pnr_A | 240 | Structure Of Pbicp-C In Complex With Falcipain-2 Le | 9e-09 | ||
| 1aim_A | 215 | Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor | 1e-08 | ||
| 3iut_A | 221 | The Crystal Structure Of Cruzain In Complex With A | 2e-08 | ||
| 3hd3_A | 215 | High Resolution Crystal Structure Of Cruzain Bound | 2e-08 | ||
| 1ewp_A | 215 | Cruzain Bound To Mor-Leu-Hpq Length = 215 | 2e-08 | ||
| 1iwd_A | 215 | Proposed Amino Acid Sequence And The 1.63 Angstrom | 4e-08 | ||
| 1yal_A | 218 | Carica Papaya Chymopapain At 1.7 Angstroms Resoluti | 5e-08 | ||
| 3bcn_A | 209 | Crystal Structure Of A Papain-Like Cysteine Proteas | 6e-08 | ||
| 2f1g_A | 220 | Cathepsin S In Complex With Non-Covalent 2-(Benzoxa | 9e-08 | ||
| 3iej_A | 222 | Pyrazole-Based Cathepsin S Inhibitors With Arylalky | 1e-07 | ||
| 3mpe_A | 220 | Crystal Structure Of Human Cathepsin-S C25s Mutant | 1e-07 | ||
| 3kwn_A | 219 | Cathepsin S In Complex With Thioether Acetamide P3 | 1e-07 | ||
| 1m6d_A | 214 | Crystal Structure Of Human Cathepsin F Length = 214 | 1e-07 | ||
| 3ovx_A | 218 | Cathepsin S In Complex With A Covalent Inhibitor Wi | 1e-07 | ||
| 1ms6_A | 222 | Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L | 1e-07 | ||
| 3n3g_A | 217 | 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri | 1e-07 | ||
| 1glo_A | 217 | Crystal Structure Of Cys25ser Mutant Of Human Cathe | 1e-07 | ||
| 2c0y_A | 315 | The Crystal Structure Of A Cys25ala Mutant Of Human | 1e-07 | ||
| 1npz_A | 217 | Crystal Structures Of Cathepsin S Inhibitor Complex | 1e-07 | ||
| 3bpm_A | 243 | Crystal Structure Of Falcipain-3 With Its Inhibitor | 1e-07 | ||
| 2fq9_A | 225 | Cathepsin S With Nitrile Inhibitor Length = 225 | 1e-07 | ||
| 2vhs_A | 217 | Cathsilicatein, A Chimera Length = 217 | 2e-07 | ||
| 2fye_A | 217 | Mutant Human Cathepsin S With Irreversible Inhibito | 2e-07 | ||
| 1cjl_A | 312 | Crystal Structure Of A Cysteine Protease Proform Le | 2e-07 | ||
| 2g6d_A | 217 | Human Cathepsin S Mutant With Vinyl Sulfone Inhibit | 2e-07 | ||
| 2pns_A | 208 | 1.9 Angstrom Resolution Crystal Structure Of A Plan | 2e-07 | ||
| 2b1m_A | 246 | Crystal Structure Of A Papain-Fold Protein Without | 6e-07 | ||
| 3hwn_A | 258 | Cathepsin L With Az13010160 Length = 258 | 7e-07 | ||
| 3h6s_A | 221 | Strucure Of Clitocypin - Cathepsin V Complex Length | 7e-07 | ||
| 1fh0_A | 221 | Crystal Structure Of Human Cathepsin V Complexed Wi | 8e-07 | ||
| 3of8_A | 221 | Structural Basis For Reversible And Irreversible In | 8e-07 | ||
| 3iv2_A | 220 | Crystal Structure Of Mature Apo-Cathepsin L C25a Mu | 8e-07 | ||
| 2nqd_B | 221 | Crystal Structure Of Cysteine Protease Inhibitor, C | 8e-07 | ||
| 3h89_A | 220 | A Combined Crystallographic And Molecular Dynamics | 8e-07 | ||
| 3hha_A | 220 | Crystal Structure Of Cathepsin L In Complex With Az | 9e-07 | ||
| 3bc3_A | 220 | Exploring Inhibitor Binding At The S Subsites Of Ca | 9e-07 | ||
| 3kse_A | 220 | Unreduced Cathepsin L In Complex With Stefin A Leng | 1e-06 | ||
| 1cs8_A | 316 | Crystal Structure Of Procathepsin L Length = 316 | 1e-06 | ||
| 2bdz_A | 214 | Mexicain From Jacaratia Mexicana Length = 214 | 1e-06 | ||
| 3h7d_A | 215 | The Crystal Structure Of The Cathepsin K Variant M5 | 2e-06 | ||
| 1vsn_A | 215 | Crystal Structure Of A Potent Small Molecule Inhibi | 2e-06 | ||
| 3ioq_A | 213 | Crystal Structure Of The Carica Candamarcensis Cyst | 4e-06 | ||
| 3u8e_A | 222 | Crystal Structure Of Cysteine Protease From Bulbs O | 4e-06 | ||
| 2f7d_A | 215 | A Mutant Rabbit Cathepsin K With A Nitrile Inhibito | 5e-06 | ||
| 3f75_A | 224 | Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In | 7e-06 | ||
| 1k3b_B | 164 | Crystal Structure Of Human Dipeptidyl Peptidase I ( | 1e-05 | ||
| 1mem_A | 215 | Crystal Structure Of Cathepsin K Complexed With A P | 3e-05 | ||
| 7pck_A | 314 | Crystal Structure Of Wild Type Human Procathepsin K | 3e-05 | ||
| 1snk_A | 214 | Cathepsin K Complexed With Carbamate Derivatized No | 3e-05 | ||
| 3ovz_A | 213 | Cathepsin K In Complex With A Covalent Inhibitor Wi | 3e-05 | ||
| 1u9v_A | 217 | Crystal Structure Of The Cysteine Protease Human Ca | 3e-05 | ||
| 1pip_A | 212 | Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al | 3e-05 | ||
| 1ppp_A | 212 | Crystal Structure Of Papain-E64-C Complex. Binding | 3e-05 | ||
| 1stf_E | 212 | The Refined 2.4 Angstroms X-Ray Crystal Structure O | 3e-05 | ||
| 3tnx_A | 363 | Structure Of The Precursor Of A Thermostable Varian | 3e-05 | ||
| 1khp_A | 212 | Monoclinic Form Of Papain/zlfg-dam Covalent Complex | 4e-05 | ||
| 2cio_A | 212 | The High Resolution X-Ray Structure Of Papain Compl | 4e-05 | ||
| 3ima_A | 212 | Complex Strcuture Of Tarocystatin And Papain Length | 4e-05 | ||
| 2wbf_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 5e-05 | ||
| 1o0e_A | 208 | 1.9 Angstrom Crystal Structure Of A Plant Cysteine | 5e-05 | ||
| 3ch2_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 1e-04 | ||
| 3ois_A | 291 | Crystal Structure Xylellain, A Cysteine Protease Fr | 8e-04 |
| >pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 | Back alignment and structure |
|
| >pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 | Back alignment and structure |
| >pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 | Back alignment and structure |
| >pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 | Back alignment and structure |
| >pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 | Back alignment and structure |
| >pdb|1HUC|B Chain B, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 205 | Back alignment and structure |
| >pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 | Back alignment and structure |
| >pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 | Back alignment and structure |
| >pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 | Back alignment and structure |
| >pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 Complex Length = 253 | Back alignment and structure |
| >pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bovine Spleen Cathepsin B- E64c Complex Length = 256 | Back alignment and structure |
| >pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 | Back alignment and structure |
| >pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 | Back alignment and structure |
| >pdb|3MOR|A Chain A, Crystal Structure Of Cathepsin B From Trypanosoma Brucei Length = 317 | Back alignment and structure |
| >pdb|3HHI|A Chain A, Crystal Structure Of Cathepsin B From T. Brucei In Complex With Ca074 Length = 325 | Back alignment and structure |
| >pdb|4HWY|A Chain A, Trypanosoma Brucei Procathepsin B Solved From 40 Fs Free-electron Laser Pulse Data By Serial Femtosecond X-ray Crystallography Length = 340 | Back alignment and structure |
| >pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 | Back alignment and structure |
| >pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 | Back alignment and structure |
| >pdb|1EF7|A Chain A, Crystal Structure Of Human Cathepsin X Length = 242 | Back alignment and structure |
| >pdb|1DEU|A Chain A, Crystal Structure Of Human Procathepsin X: A Cysteine Protease With The Proregion Covalently Linked To The Active Site Cysteine Length = 277 | Back alignment and structure |
| >pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 | Back alignment and structure |
| >pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 | Back alignment and structure |
| >pdb|1K3B|C Chain C, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 69 | Back alignment and structure |
| >pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 | Back alignment and structure |
| >pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 | Back alignment and structure |
| >pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 | Back alignment and structure |
| >pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 | Back alignment and structure |
| >pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 | Back alignment and structure |
| >pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 | Back alignment and structure |
| >pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 | Back alignment and structure |
| >pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 | Back alignment and structure |
| >pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 | Back alignment and structure |
| >pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 | Back alignment and structure |
| >pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 | Back alignment and structure |
| >pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 | Back alignment and structure |
| >pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 | Back alignment and structure |
| >pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 | Back alignment and structure |
| >pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 | Back alignment and structure |
| >pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 | Back alignment and structure |
| >pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 | Back alignment and structure |
| >pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 | Back alignment and structure |
| >pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 | Back alignment and structure |
| >pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 | Back alignment and structure |
| >pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 | Back alignment and structure |
| >pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 | Back alignment and structure |
| >pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 | Back alignment and structure |
| >pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 | Back alignment and structure |
| >pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 | Back alignment and structure |
| >pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 | Back alignment and structure |
| >pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 | Back alignment and structure |
| >pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 | Back alignment and structure |
| >pdb|3BPM|A Chain A, Crystal Structure Of Falcipain-3 With Its Inhibitor, Leupeptin Length = 243 | Back alignment and structure |
| >pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 | Back alignment and structure |
| >pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 | Back alignment and structure |
| >pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 | Back alignment and structure |
| >pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 | Back alignment and structure |
| >pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 | Back alignment and structure |
| >pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 | Back alignment and structure |
| >pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 | Back alignment and structure |
| >pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 | Back alignment and structure |
| >pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 | Back alignment and structure |
| >pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 | Back alignment and structure |
| >pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 | Back alignment and structure |
| >pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 | Back alignment and structure |
| >pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 | Back alignment and structure |
| >pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 | Back alignment and structure |
| >pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 | Back alignment and structure |
| >pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 | Back alignment and structure |
| >pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 | Back alignment and structure |
| >pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 | Back alignment and structure |
| >pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 | Back alignment and structure |
| >pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 | Back alignment and structure |
| >pdb|3IOQ|A Chain A, Crystal Structure Of The Carica Candamarcensis Cysteine Protease Cms1ms2 In Complex With E-64 Length = 213 | Back alignment and structure |
| >pdb|3U8E|A Chain A, Crystal Structure Of Cysteine Protease From Bulbs Of Crocus Sativus At 1.3 A Resolution Length = 222 | Back alignment and structure |
| >pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 | Back alignment and structure |
| >pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 | Back alignment and structure |
| >pdb|1K3B|B Chain B, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 164 | Back alignment and structure |
| >pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 | Back alignment and structure |
| >pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 | Back alignment and structure |
| >pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 | Back alignment and structure |
| >pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 | Back alignment and structure |
| >pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 | Back alignment and structure |
| >pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 | Back alignment and structure |
| >pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 | Back alignment and structure |
| >pdb|1STF|E Chain E, The Refined 2.4 Angstroms X-Ray Crystal Structure Of Recombinant Human Stefin B In Complex With The Cysteine Proteinase Papain: A Novel Type Of Proteinase Inhibitor Interaction Length = 212 | Back alignment and structure |
| >pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 | Back alignment and structure |
| >pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 | Back alignment and structure |
| >pdb|2CIO|A Chain A, The High Resolution X-Ray Structure Of Papain Complexed With Fragments Of The Trypanosoma Brucei Cysteine Protease Inhibitor Icp Length = 212 | Back alignment and structure |
| >pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 | Back alignment and structure |
| >pdb|2WBF|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum With Loop 690-700 Ordered Length = 265 | Back alignment and structure |
| >pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 | Back alignment and structure |
| >pdb|3CH2|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum Length = 265 | Back alignment and structure |
| >pdb|3OIS|A Chain A, Crystal Structure Xylellain, A Cysteine Protease From Xylella Fastidiosa Length = 291 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 | Back alignment and structure |
|---|
Score = 281 bits (721), Expect = 2e-96
Identities = 95/213 (44%), Positives = 137/213 (64%), Gaps = 14/213 (6%)
Query: 19 LQNLSLSVNDLLACCGFLCGDGCDGGYPISAWRYFVHHGVVTEE-------CDPYFDSTG 71
++ +S DLL CCG +CGDGC+GGYP AW ++ G+V+ C PY
Sbjct: 55 HVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPC 114
Query: 72 CSH-----PGCEPAYPTPKCVRKCVKK-NQLWRNSKHYSISAYRINSDPEDIMAEIYKNG 125
+H P C TPKC + C + ++ KHY ++Y +++ +DIMAEIYKNG
Sbjct: 115 EAHVNGARPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNG 174
Query: 126 PVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGA 185
PVE +F+VY DF YKSGVY+H+TG++MGGHA++++GWG ++G YW++AN WN WG
Sbjct: 175 PVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGV-ENGTPYWLVANSWNTDWGD 233
Query: 186 DGYFKIKRGSNECGIEEDVVAGLPSSKNLVKEI 218
+G+FKI RG + CGIE +VVAG+P + ++I
Sbjct: 234 NGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI 266
|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 | Back alignment and structure |
|---|
| >3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* Length = 222 | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 | Back alignment and structure |
|---|
| >3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A Length = 220 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 229 | |||
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 100.0 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 100.0 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 100.0 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 100.0 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 100.0 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 100.0 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 100.0 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 100.0 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 100.0 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 100.0 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 100.0 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 100.0 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 100.0 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 100.0 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 100.0 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 100.0 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 100.0 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 100.0 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 100.0 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 100.0 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 100.0 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 100.0 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 100.0 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 100.0 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 100.0 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 100.0 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 100.0 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 100.0 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 100.0 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 100.0 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 100.0 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 100.0 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 100.0 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 100.0 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 100.0 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 100.0 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 100.0 | |
| 3tnx_A | 363 | Papain; hydrolase, cytoplasm for recombinant expre | 100.0 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 100.0 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 100.0 | |
| 2cb5_A | 453 | Protein (bleomycin hydrolase); aminopeptidase, cys | 99.96 | |
| 2e01_A | 457 | Cysteine proteinase 1; bleomycin hydrolase, thiol | 99.96 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 99.9 | |
| 1pxv_A | 183 | Cysteine protease; hydrolase; 1.80A {Staphylococcu | 96.59 | |
| 1cv8_A | 174 | Staphopain; cysteine protease, thiol protease, pap | 96.36 | |
| 1x9y_A | 367 | Cysteine proteinase; half-barrel, barrel-sandwich- | 95.75 | |
| 3erv_A | 236 | Putative C39-like peptidase; structural genomics, | 93.45 | |
| 1dki_A | 371 | Pyrogenic exotoxin B zymogen; cysteine protease, p | 86.04 | |
| 3bb7_A | 321 | Interpain A; cysteine protease, zymogen activation | 85.26 | |
| 4d8b_A | 261 | Streptopain; papain fold, cysteine protease, secre | 82.69 |
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=7.4e-52 Score=362.52 Aligned_cols=204 Identities=46% Similarity=0.955 Sum_probs=169.1
Q ss_pred hchHHHHhccc-cccCC-CCCCCHHHHhhcCCCCCCCCCCCCChHHHHHHHHHcCccCCCCccCC-CCCCCCC-------
Q 027054 5 RTNRDALSSSP-YVSLQ-NLSLSVNDLLACCGFLCGDGCDGGYPISAWRYFVHHGVVTEECDPYF-DSTGCSH------- 74 (229)
Q Consensus 5 ~~~~~a~~s~~-~~~~~-~~~lS~Q~l~dC~~~~~~~gC~Gg~~~~Al~~~~~~Gi~~e~~~PY~-~~~~~~~------- 74 (229)
-|+..|||+.. ++++. .++||||+|+||+. ..+.||+||++..||+|++++|+++|++|||. +. |.+
T Consensus 103 Fsa~~alE~~~~i~~~~~~~~LSeQ~LvdC~~-~~~~GC~GG~~~~A~~yi~~~Gi~~e~~yPY~~~~--c~~~~~~~~~ 179 (325)
T 3hhi_A 103 VAAASAMSDRFCTMGGVQDVHISAGDLLACCS-DCGDGCNGGDPDRAWAYFSSTGLVSDYCQPYPFPH--CSHHSKSKNG 179 (325)
T ss_dssp HHHHHHHHHHHHHTSSCSSCCBCHHHHHHHCG-GGBCTTBCBCHHHHHHHHHHTCBCBTTTSCCSSCC--CBSSSCCTTC
T ss_pred HHHHHHHHHHHHHHhCCCccccCHHHHHHhcc-CCCCCCCCCCHHHHHHHHHHhCCCcccccCCcccc--cccccccccc
Confidence 35667777755 44665 89999999999997 24689999999999999999999999999996 33 332
Q ss_pred -CCCC-CCCCCcccccccccccccccccceeEeeeEEeCCcHHHHHHHHHhCCCEEEEEEecCcccccCCceEEccCCCc
Q 027054 75 -PGCE-PAYPTPKCVRKCVKKNQLWRNSKHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDV 152 (229)
Q Consensus 75 -~~c~-~~~~~~~~~~~c~~~~~~~~~~~~~~i~~y~~~~~~~~ik~~L~~~gPV~v~~~~~~~f~~y~~Giy~~~~~~~ 152 (229)
..|. +...++.|...|... .+...+.+.+..|.+ .++++||++|+++|||+|+|.++++|++|++|||..+++..
T Consensus 180 ~~~C~~~~~~~~~c~~~c~~~--~~~~~~~~~~~~y~v-~~~~~i~~~i~~~GPV~v~i~~~~~f~~Y~~GVy~~~~~~~ 256 (325)
T 3hhi_A 180 YPPCSQFNFDTPKCDYTCDDP--TIPVVNYRSWTSYAL-QGEDDYMRELFFRGPFEVAFDVYEDFIAYNSGVYHHVSGQY 256 (325)
T ss_dssp CCBGGGCCCCCCCCCSSCSST--TSCCCCBCEEEEEEE-CSHHHHHHHHHHHCCEEEEEEEEHHHHTCCSSEECCCSCCE
T ss_pred CCCCCCcccCCcchhhccccc--ccccceEEeecceEe-CCHHHHHHHHHHCCCEEEEEEeccccccccCceecCCCCCC
Confidence 4455 345566777777632 234455667788888 88899999999999999999999999999999998887776
Q ss_pred cCCcEEEEEEecccCCCceEEEEEcCCCCCCCCCCeEEEEeCCCccCcCcceeEEeecCCchh
Q 027054 153 MGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLPSSKNLV 215 (229)
Q Consensus 153 ~~~Hav~iVGyg~~~~~~~ywivkNSWG~~WG~~Gy~~i~~~~n~cgi~~~~~~~~p~~~~~~ 215 (229)
.++|||+||||| ++++++|||||||||++||++|||||+|+.|.|||++.+++++|.+++..
T Consensus 257 ~~~HaV~iVGyG-~~~g~~YWivkNSWG~~WGe~GY~~i~rg~n~CGI~~~~~~g~p~~~~~~ 318 (325)
T 3hhi_A 257 LGGHAVRLVGWG-TSNGVPYWKIANSWNTEWGMDGYFLIRRGSSECGIEDGGSAGIPLAPNTA 318 (325)
T ss_dssp EEEEEEEEEEEE-EETTEEEEEEECSBCTTSTBTTEEEEECSSCGGGTTSCEEEEEEC-----
T ss_pred CCCEEEEEEEEE-ecCCceEEEEEeCCCCCcccCCEEEEEcCCCeecCccceEEeecCCCCcc
Confidence 679999999999 78899999999999999999999999999999999999999999998753
|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A | Back alignment and structure |
|---|
| >3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} SCOP: d.3.1.1 PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A | Back alignment and structure |
|---|
| >3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* | Back alignment and structure |
|---|
| >3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A | Back alignment and structure |
|---|
| >2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >1pxv_A Cysteine protease; hydrolase; 1.80A {Staphylococcus aureus} SCOP: d.3.1.1 PDB: 1y4h_A | Back alignment and structure |
|---|
| >1cv8_A Staphopain; cysteine protease, thiol protease, papain family; HET: E64; 1.75A {Staphylococcus aureus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1x9y_A Cysteine proteinase; half-barrel, barrel-sandwich-hybrid, hydrolase; 2.50A {Staphylococcus aureus} SCOP: d.3.1.1 d.17.1.4 | Back alignment and structure |
|---|
| >3erv_A Putative C39-like peptidase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.10A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1dki_A Pyrogenic exotoxin B zymogen; cysteine protease, papain-like; 1.60A {Streptococcus pyogenes} SCOP: d.3.1.1 PDB: 1pvj_A* | Back alignment and structure |
|---|
| >3bb7_A Interpain A; cysteine protease, zymogen activation, bacterial odontopatho hydrolase; 1.50A {Prevotella intermedia} PDB: 3bba_A | Back alignment and structure |
|---|
| >4d8b_A Streptopain; papain fold, cysteine protease, secreted, hydrolase; 1.06A {Streptococcus pyogenes} PDB: 4d8e_A* 4d8i_A* 2uzj_A* 2jtc_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 229 | ||||
| d1gmya_ | 254 | d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens | 6e-47 | |
| d1deua_ | 275 | d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens | 3e-31 | |
| d1cs8a_ | 316 | d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens | 4e-29 | |
| g1k3b.1 | 233 | d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase | 3e-28 | |
| g8pch.1 | 228 | d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax | 1e-26 | |
| d1m6da_ | 214 | d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta | 8e-25 | |
| d1s4va_ | 224 | d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor | 1e-24 | |
| d1xkga1 | 302 | d.3.1.1 (A:4-305) Major mite fecal allergen der p | 7e-24 | |
| d1aeca_ | 218 | d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi | 8e-24 | |
| d1fh0a_ | 221 | d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens | 7e-22 | |
| d1yala_ | 218 | d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ | 8e-22 | |
| d1me4a_ | 215 | d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 | 1e-21 | |
| d2oula1 | 241 | d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip | 1e-21 | |
| d2h7ja1 | 217 | d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa | 3e-21 | |
| d1iwda_ | 215 | d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia | 2e-20 | |
| d1cqda_ | 216 | d.3.1.1 (A:) Proline-specific cysteine protease {G | 2e-20 | |
| d2r6na1 | 215 | d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa | 5e-19 | |
| d1o0ea_ | 208 | d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv | 1e-18 | |
| d1ppoa_ | 216 | d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca | 1e-18 | |
| d1khqa_ | 212 | d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId | 2e-15 |
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: (Pro)cathepsin B species: Human (Homo sapiens) [TaxId: 9606]
Score = 153 bits (388), Expect = 6e-47
Identities = 94/206 (45%), Positives = 133/206 (64%), Gaps = 14/206 (6%)
Query: 19 LQNLSLSVNDLLACCGFLCGDGCDGGYPISAWRYFVHHGVVTEE-------CDPYFDSTG 71
++ +S DLL CCG +CGDGC+GGYP AW ++ G+V+ C PY
Sbjct: 50 HVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPC 109
Query: 72 CSH-----PGCEPAYPTPKCVRKCVK-KNQLWRNSKHYSISAYRINSDPEDIMAEIYKNG 125
H P C TPKC + C + ++ KHY ++Y +++ +DIMAEIYKNG
Sbjct: 110 EHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNG 169
Query: 126 PVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGA 185
PVE +F+VY DF YKSGVY+H+TG++MGGHA++++GWG ++G YW++AN WN WG
Sbjct: 170 PVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGV-ENGTPYWLVANSWNTDWGD 228
Query: 186 DGYFKIKRGSNECGIEEDVVAGLPSS 211
+G+FKI RG + CGIE +VVAG+P +
Sbjct: 229 NGFFKILRGQDHCGIESEVVAGIPRT 254
|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 | Back information, alignment and structure |
|---|
| >d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 229 | |||
| d1gmya_ | 254 | (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1deua_ | 275 | (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| g1k3b.1 | 233 | Cathepsin C (dipeptidyl peptidase I), catalytic do | 100.0 | |
| g8pch.1 | 228 | Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| d1xkga1 | 302 | Major mite fecal allergen der p 1 {House-dust mite | 100.0 | |
| d1cs8a_ | 316 | (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1m6da_ | 214 | Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1yala_ | 218 | Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | 100.0 | |
| d1me4a_ | 215 | Cruzain {Trypanosoma cruzi [TaxId: 5693]} | 100.0 | |
| d2r6na1 | 215 | (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1ppoa_ | 216 | Caricain (protease omega) {Papaya (Carica papaya) | 100.0 | |
| d2oula1 | 241 | Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} | 100.0 | |
| d1cqda_ | 216 | Proline-specific cysteine protease {Ginger rhizome | 100.0 | |
| d2h7ja1 | 217 | (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1fh0a_ | 221 | (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1aeca_ | 218 | Actinidin {Chinese gooseberry or kiwifruit (Actini | 100.0 | |
| d1khqa_ | 212 | Papain {Papaya (Carica papaya) [TaxId: 3649]} | 100.0 | |
| d1s4va_ | 224 | Vignain (bean endopeptidase) {Castor bean (Ricinus | 100.0 | |
| d1o0ea_ | 208 | Ervatamin C {East indian rosebay (Ervatamia corona | 100.0 | |
| d1iwda_ | 215 | Ervatamin B {Adam's apple (Ervatamia coronaria) [T | 100.0 | |
| d3gcba_ | 458 | Bleomycin hydrolase {Baker's yeast (Saccharomyces | 99.11 | |
| d2cb5a_ | 453 | Bleomycin hydrolase {Human (Homo sapiens) [TaxId: | 98.81 | |
| d1pxva_ | 183 | Staphopain SspB {Staphylococcus aureus [TaxId: 128 | 82.62 |
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: (Pro)cathepsin B species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=5.6e-44 Score=299.65 Aligned_cols=206 Identities=46% Similarity=0.988 Sum_probs=156.1
Q ss_pred hhchHHHHhccc-cccC--CCCCCCHHHHhhcCCCCCCCCCCCCChHHHHHHHHHcCccCCCCccCCCC-CCCCCCCCCC
Q 027054 4 TRTNRDALSSSP-YVSL--QNLSLSVNDLLACCGFLCGDGCDGGYPISAWRYFVHHGVVTEECDPYFDS-TGCSHPGCEP 79 (229)
Q Consensus 4 ~~~~~~a~~s~~-~~~~--~~~~lS~Q~l~dC~~~~~~~gC~Gg~~~~Al~~~~~~Gi~~e~~~PY~~~-~~~~~~~c~~ 79 (229)
+-|++.+||+.. ++++ ...+||+|+|++|.....+.||.||++..|++++.++|+++|+.||+... ..+..+.|..
T Consensus 32 AfA~~~~lEs~~~i~~~~~~~~~lS~~~l~~~~~~~~~~gc~gg~~~~a~~~~~~~G~~~e~~~~~~~~~~~~~~~~~~~ 111 (254)
T d1gmya_ 32 AFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEH 111 (254)
T ss_dssp HHHHHHHHHHHHHHHTTTSSCCCBCHHHHHHHSGGGGBCGGGCBCHHHHHHHHHHTCBCBCCSTTCCCSSSCCCSCCCBS
T ss_pred HHHHHHHHHHHHHHHHCCCCccccchHHHHhhccccCCCCCCCCcHHHHHHHHHHcCccccccccccccccccccccccc
Confidence 346677788754 3333 45789999999998755678999999999999999999999999988432 1122222211
Q ss_pred C-----------CCCcccccccccccc-cccccceeEeeeEEeCCcHHHHHHHHHhCCCEEEEEEecCcccccCCceEEc
Q 027054 80 A-----------YPTPKCVRKCVKKNQ-LWRNSKHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKH 147 (229)
Q Consensus 80 ~-----------~~~~~~~~~c~~~~~-~~~~~~~~~i~~y~~~~~~~~ik~~L~~~gPV~v~~~~~~~f~~y~~Giy~~ 147 (229)
. ...+.....|..... .+...+......+....+++.||++|+++|||++++.+.++|+.|++||+..
T Consensus 112 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ik~~l~~~gpv~~~~~~~~~f~~y~~gi~~~ 191 (254)
T d1gmya_ 112 HVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQH 191 (254)
T ss_dssp SSCCSSCBCCSCCCCCCCCCSCCTTCCSCHHHHCBCBSCCEECCSCHHHHHHHHHHHCCEEEEEEEEGGGTTCCSSEECC
T ss_pred cccCccCccccccCCccccccccCCcccceeeeeeeeeeeeccccHHHHHHHHHHHcCCEEEEEEeechhhhccCCcccc
Confidence 1 111111111221111 1122222333444556678999999999999999999999999999999988
Q ss_pred cCCCccCCcEEEEEEecccCCCceEEEEEcCCCCCCCCCCeEEEEeCCCccCcCcceeEEeec
Q 027054 148 ITGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLPS 210 (229)
Q Consensus 148 ~~~~~~~~Hav~iVGyg~~~~~~~ywivkNSWG~~WG~~Gy~~i~~~~n~cgi~~~~~~~~p~ 210 (229)
.+....++|||+||||| ++++.+|||||||||++||++|||||+|+.|.|||++++++++|.
T Consensus 192 ~~~~~~~~Hav~IVGyg-~~~g~~ywIvkNSWG~~WGd~GYf~i~~~~n~cgi~~~~~~~~p~ 253 (254)
T d1gmya_ 192 VTGEMMGGHAIRILGWG-VENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPR 253 (254)
T ss_dssp CSCCEEEEEEEEEEEEE-EETTEEEEEEECSBCTTSTBTTEEEEECSSCGGGTTTSCEECCBC
T ss_pred ccccccccEEEEEEEEe-ccCCceEEEEEcCCCCCcCCCceEEEEcCCCccCcCCceEeccCC
Confidence 88777789999999999 778899999999999999999999999999999999999999985
|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pxva_ d.3.1.1 (A:) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|