Citrus Sinensis ID: 027064


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MAAPSDQKATIIDGKAVAQTIRSEIAEEVRLLSEKYGKVPGLAVVIVGGRKDSQSYVSMKRKACAEVGIKSFDIDLPEQVSEAELISKVHELNVMPDVHGILVQLPLPKHINEEKVLGEISLEKDVDGFHPLNIGKLAMKGRDPLFLPCTPKGCLELLKRSGVTIKGKRAVVVGRSNIVGLPVSLLLLKADATVTIVHSHTTDPESIVREADIVIAAAGQAMMVTMGIL
ccccccccEEEEccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHcHHHHHHHHccccccccccccccHHHHHHHHHHHcccccccEEEEEccccccccHHHHHHcccccccccccccccHHHHHHcccccccccccHHHHHHHHHHHccccccccEEEEcccccccHHHHHHHHHcccEEEEcccccccHHHHHHHccEEEEEcccccccccccc
ccccccccEEEEcHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHHHHHHHccEEEEEEEcccccHHHHHHHHHHHHHcccccEEEEcccccccccHHHHHHcccHHHEcccccHHHHHHHHccccccccccHHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHcccEEEEEccccccHHHHHccccEEEEcccccccEccccc
maapsdqkatiiDGKAVAQTIRSEIAEEVRLLSEKYGKVPGLAVVIVGGRKDSQSYVSMKRKACAEVGiksfdidlpeqvSEAELISKVHelnvmpdvhgilvqlplpkhineekvlgeislekdvdgfhplnigklamkgrdplflpctpkgcLELLkrsgvtikgkrAVVVGRSNIVGLPVSLLLLKADATVTIVhshttdpesivREADIVIAAAGQAMMVTMGIL
maapsdqkatiidgkavaQTIRSEIAEEVRLLsekygkvpgLAVVIVggrkdsqsyVSMKRKACAEVGIKSFDIDLPEQVSEAELISKVHELNVMPDVHGILVQLPLPKHINEEKVLGEISLEKDVDGFHPLNIGKLAMKGRDPLFLPCTPKGCLELLKrsgvtikgkravvvgrsniVGLPVSLLLLKADATVTIVHshttdpesivrEADIVIAAAGQAMMVTMGIL
MAAPSDQKATIIDGKAVAQTIRSEIAEEVRLLSEKYGKVPGLAVVIVGGRKDSQSYVSMKRKACAEVGIKSFDIDLPEQVSEAELISKVHELNVMPDVHGILVQLPLPKHINEEKVLGEISLEKDVDGFHPLNIGKLAMKGRDPLFLPCTPKGCLELLKRSGVTIKGKRAVVVGRSNIVGLPVSLLLLKADATVTIVHSHTTDPESIVREADIVIAAAGQAMMVTMGIL
**********IIDGKAVAQTIRSEIAEEVRLLSEKYGKVPGLAVVIVGGRKDSQSYVSMKRKACAEVGIKSFDIDLPEQVSEAELISKVHELNVMPDVHGILVQLPLPKHINEEKVLGEISLEKDVDGFHPLNIGKLAMKGRDPLFLPCTPKGCLELLKRSGVTIKGKRAVVVGRSNIVGLPVSLLLLKADATVTIVHSHTTDPESIVREADIVIAAAGQAMMVT****
******Q***IIDGKAVAQTIRSEIAEEVRLLSEKYGKVPGLAVVIVGGRKDSQSYVSMKRKACAEVGIKSFDIDLPEQVSEAELISKVHELNVMPDVHGILVQLPLPKHINEEKVLGEISLEKDVDGFHPLNIGKLAMKGRDPLFLPCTPKGCLELLKRSGVTIKGKRAVVVGRSNIVGLPVSLLLLKADATVTIVHSHTTDPESIVREADIVIAAAGQAMMVTMGIL
*********TIIDGKAVAQTIRSEIAEEVRLLSEKYGKVPGLAVVIVGGRKDSQSYVSMKRKACAEVGIKSFDIDLPEQVSEAELISKVHELNVMPDVHGILVQLPLPKHINEEKVLGEISLEKDVDGFHPLNIGKLAMKGRDPLFLPCTPKGCLELLKRSGVTIKGKRAVVVGRSNIVGLPVSLLLLKADATVTIVHSHTTDPESIVREADIVIAAAGQAMMVTMGIL
*******KATIIDGKAVAQTIRSEIAEEVRLLSEKYGKVPGLAVVIVGGRKDSQSYVSMKRKACAEVGIKSFDIDLPEQVSEAELISKVHELNVMPDVHGILVQLPLPKHINEEKVLGEISLEKDVDGFHPLNIGKLAMKGRDPLFLPCTPKGCLELLKRSGVTIKGKRAVVVGRSNIVGLPVSLLLLKADATVTIVHSHTTDPESIVREADIVIAAAGQAMMVT****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHi
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAPSDQKATIIDGKAVAQTIRSEIAEEVRLLSEKYGKVPGLAVVIVGGRKDSQSYVSMKRKACAEVGIKSFDIDLPEQVSEAELISKVHELNVMPDVHGILVQLPLPKHINEEKVLGEISLEKDVDGFHPLNIGKLAMKGRDPLFLPCTPKGCLELLKRSGVTIKGKRAVVVGRSNIVGLPVSLLLLKADATVTIVHSHTTDPESIVREADIVIAAAGQAMMVTMGIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query229 2.2.26 [Sep-21-2011]
A0LE04285 Bifunctional protein FolD yes no 0.934 0.750 0.564 8e-60
A4IQS0284 Bifunctional protein FolD yes no 0.930 0.75 0.555 8e-58
Q8Y7C5284 Bifunctional protein FolD yes no 0.921 0.742 0.556 8e-58
Q92BZ4284 Bifunctional protein FolD yes no 0.921 0.742 0.556 1e-57
C1L2R6284 Bifunctional protein FolD yes no 0.921 0.742 0.556 1e-57
B8DFW8284 Bifunctional protein FolD yes no 0.921 0.742 0.556 1e-57
A5GAM5280 Bifunctional protein FolD yes no 0.930 0.760 0.560 1e-57
Q71ZW2284 Bifunctional protein FolD yes no 0.921 0.742 0.556 4e-57
Q39WH4285 Bifunctional protein FolD yes no 0.930 0.747 0.555 4e-57
B1HRX9284 Bifunctional protein FolD yes no 0.934 0.753 0.516 4e-56
>sp|A0LE04|FOLD_MAGSM Bifunctional protein FolD OS=Magnetococcus sp. (strain MC-1) GN=folD PE=3 SV=1 Back     alignment and function desciption
 Score =  229 bits (585), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 149/216 (68%), Gaps = 2/216 (0%)

Query: 9   ATIIDGKAVAQTIRSEIAEEVRLLSEKYGKVPGLAVVIVGGRKDSQSYVSMKRKACAEVG 68
           A +IDGKA+AQ++R E+  EV  L   +   PGLAVV+VG    SQ YV  K++AC   G
Sbjct: 2   AHVIDGKAIAQSVREELRMEVERLKLNHQLTPGLAVVLVGADPASQVYVRNKKRACETAG 61

Query: 69  IKSFDIDLPEQVSEAELISKVHELNVMPDVHGILVQLPLPKHINEEKVLGEISLEKDVDG 128
           I SF  +L    S+AEL++ + +LN    VHGILVQLPLPKHI+E+KVL  IS  KD DG
Sbjct: 62  IASFSHELAATTSQAELLALIEQLNQDDAVHGILVQLPLPKHIDEQKVLEAISPSKDADG 121

Query: 129 FHPLNIGKLAMKGRDPLFLPCTPKGCLELLKRSGVTIKGKRAVVVGRSNIVGLPVSLLLL 188
           FHP N+G+L     DP F PCTP G +E+LK SGV  KGK AVV+GRSNIVG PV+L+LL
Sbjct: 122 FHPYNVGRLVTG--DPTFQPCTPWGVMEMLKVSGVDPKGKHAVVIGRSNIVGKPVALMLL 179

Query: 189 KADATVTIVHSHTTDPESIVREADIVIAAAGQAMMV 224
            A ATVTI HS T D    V+ ADIV+AA G+A MV
Sbjct: 180 AAHATVTICHSRTPDLAETVKRADIVVAAVGRANMV 215




Catalyzes the oxidation of 5,10-methylenetetrahydrofolate to 5,10-methenyltetrahydrofolate and then the hydrolysis of 5,10-methenyltetrahydrofolate to 10-formyltetrahydrofolate.
Magnetococcus sp. (strain MC-1) (taxid: 156889)
EC: 3EC: .EC: 5EC: .EC: 4EC: .EC: 9
>sp|A4IQS0|FOLD_GEOTN Bifunctional protein FolD OS=Geobacillus thermodenitrificans (strain NG80-2) GN=folD PE=3 SV=1 Back     alignment and function description
>sp|Q8Y7C5|FOLD_LISMO Bifunctional protein FolD OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=folD PE=3 SV=1 Back     alignment and function description
>sp|Q92BZ4|FOLD_LISIN Bifunctional protein FolD OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=folD PE=3 SV=1 Back     alignment and function description
>sp|C1L2R6|FOLD_LISMC Bifunctional protein FolD OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=folD PE=3 SV=1 Back     alignment and function description
>sp|B8DFW8|FOLD_LISMH Bifunctional protein FolD OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=folD PE=3 SV=1 Back     alignment and function description
>sp|A5GAM5|FOLD_GEOUR Bifunctional protein FolD OS=Geobacter uraniireducens (strain Rf4) GN=folD PE=3 SV=1 Back     alignment and function description
>sp|Q71ZW2|FOLD_LISMF Bifunctional protein FolD OS=Listeria monocytogenes serotype 4b (strain F2365) GN=folD PE=3 SV=1 Back     alignment and function description
>sp|Q39WH4|FOLD2_GEOMG Bifunctional protein FolD 2 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=folD2 PE=3 SV=1 Back     alignment and function description
>sp|B1HRX9|FOLD_LYSSC Bifunctional protein FolD OS=Lysinibacillus sphaericus (strain C3-41) GN=folD PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query229
359479954307 PREDICTED: c-1-tetrahydrofolate synthase 0.978 0.729 0.875 1e-110
255582158299 methylenetetrahydrofolate dehydrogenase, 0.978 0.749 0.888 1e-110
118488628299 unknown [Populus trichocarpa] 0.978 0.749 0.857 1e-107
356572720294 PREDICTED: c-1-tetrahydrofolate synthase 0.943 0.734 0.884 1e-107
255646414294 unknown [Glycine max] 0.943 0.734 0.879 1e-106
358248138294 uncharacterized protein LOC100783652 [Gl 0.943 0.734 0.870 1e-106
449469104299 PREDICTED: c-1-tetrahydrofolate synthase 0.978 0.749 0.830 1e-105
4103987294 5,10-methylenetetrahydrofolate dehydroge 0.943 0.734 0.870 1e-105
388517953236 unknown [Lotus japonicus] 0.943 0.915 0.870 1e-104
21553669299 5,10-methylenetetrahydrofolate dehydroge 0.978 0.749 0.843 1e-104
>gi|359479954|ref|XP_002263128.2| PREDICTED: c-1-tetrahydrofolate synthase, cytoplasmic [Vitis vinifera] Back     alignment and taxonomy information
 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/224 (87%), Positives = 212/224 (94%)

Query: 1   MAAPSDQKATIIDGKAVAQTIRSEIAEEVRLLSEKYGKVPGLAVVIVGGRKDSQSYVSMK 60
           MA+P   KA+IIDGKA+AQ IRSEIAEEVR LSEKYGKVPGLAVVIVG RKDSQSYVSMK
Sbjct: 1   MASPDGHKASIIDGKAIAQAIRSEIAEEVRHLSEKYGKVPGLAVVIVGNRKDSQSYVSMK 60

Query: 61  RKACAEVGIKSFDIDLPEQVSEAELISKVHELNVMPDVHGILVQLPLPKHINEEKVLGEI 120
           RKACAEVGIKSFD+DLPEQV E+ELI KVHELN +PDVHGILVQLPLPKHINEEKVL EI
Sbjct: 61  RKACAEVGIKSFDVDLPEQVLESELIGKVHELNALPDVHGILVQLPLPKHINEEKVLSEI 120

Query: 121 SLEKDVDGFHPLNIGKLAMKGRDPLFLPCTPKGCLELLKRSGVTIKGKRAVVVGRSNIVG 180
           SLEKDVDGFHPLNIGKLAMKGR+PLFLPCTPKGCLELL RSG+++KGK+AVVVGRSNIVG
Sbjct: 121 SLEKDVDGFHPLNIGKLAMKGREPLFLPCTPKGCLELLSRSGISVKGKKAVVVGRSNIVG 180

Query: 181 LPVSLLLLKADATVTIVHSHTTDPESIVREADIVIAAAGQAMMV 224
           LPV+LLLLKADATVT+VHSHT DPESI+R+ADIVIAAAGQAMM+
Sbjct: 181 LPVALLLLKADATVTVVHSHTQDPESIIRDADIVIAAAGQAMMI 224




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255582158|ref|XP_002531873.1| methylenetetrahydrofolate dehydrogenase, putative [Ricinus communis] gi|223528481|gb|EEF30510.1| methylenetetrahydrofolate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|118488628|gb|ABK96126.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356572720|ref|XP_003554514.1| PREDICTED: c-1-tetrahydrofolate synthase, cytoplasmic-like [Glycine max] Back     alignment and taxonomy information
>gi|255646414|gb|ACU23686.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|358248138|ref|NP_001239823.1| uncharacterized protein LOC100783652 [Glycine max] gi|255647576|gb|ACU24251.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449469104|ref|XP_004152261.1| PREDICTED: c-1-tetrahydrofolate synthase, cytoplasmic-like [Cucumis sativus] gi|449484305|ref|XP_004156845.1| PREDICTED: c-1-tetrahydrofolate synthase, cytoplasmic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|4103987|gb|AAD01907.1| 5,10-methylenetetrahydrofolate dehydrogenase-5,10-methenyltetrahydrofolate cyclohydrolase [Pisum sativum] gi|6002383|emb|CAB56756.1| 5,10-methylenetetrahydrofolate dehydrogenase: 5,10-methenyltetrahydrofolate cyclohydrolase [Pisum sativum] Back     alignment and taxonomy information
>gi|388517953|gb|AFK47038.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|21553669|gb|AAM62762.1| 5,10-methylenetetrahydrofolate dehydrogenase:5,10-methenyltetrahydrofolate cyclohydrolase, putative [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query229
TAIR|locus:2082254299 AT3G12290 [Arabidopsis thalian 0.978 0.749 0.843 3.7e-96
TAIR|locus:2127113360 EMB3127 "EMBRYO DEFECTIVE 3127 0.960 0.611 0.618 2.1e-70
TAIR|locus:2064143352 AT2G38660 [Arabidopsis thalian 0.938 0.610 0.609 3.1e-67
DICTYBASE|DDB_G0283121292 DDB_G0283121 "methenyl tetrahy 0.934 0.732 0.574 1.5e-60
TIGR_CMR|GSU_0862285 GSU_0862 "folD bifunctional pr 0.930 0.747 0.523 9.2e-52
SGD|S000003436 946 ADE3 "Cytoplasmic trifunctiona 0.934 0.226 0.506 1.6e-50
TIGR_CMR|BA_4405286 BA_4405 "methylenetetrahydrofo 0.934 0.748 0.502 9.5e-50
CGD|CAL0000766 946 MIS11 [Candida albicans (taxid 0.943 0.228 0.493 4.2e-49
UNIPROTKB|Q59SM8 946 MIS11 "Likely C1-tetrahydrofol 0.943 0.228 0.493 4.2e-49
TIGR_CMR|SO_1792284 SO_1792 "methylenetetrahydrofo 0.917 0.739 0.509 6.7e-49
TAIR|locus:2082254 AT3G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 956 (341.6 bits), Expect = 3.7e-96, P = 3.7e-96
 Identities = 189/224 (84%), Positives = 205/224 (91%)

Query:     1 MAAPSDQKATIIDGKAVAQTIRSEIAEEVRLLSEKYGKVPGLAVVIVGGRKDSQSYVSMK 60
             MA+ SD  A IIDGKA+A TIRSEIAEEVR LSEK+GKVPGLAVVIVG RKDSQ+YV+ K
Sbjct:     1 MASSSDHTAKIIDGKAIAHTIRSEIAEEVRGLSEKHGKVPGLAVVIVGSRKDSQTYVNTK 60

Query:    61 RKACAEVGIKSFDIDLPEQVSEAELISKVHELNVMPDVHGILVQLPLPKHINEEKVLGEI 120
             RKACAEVGIKSFD+ LPE+VSEA+LISKVHELN  PDVHGILVQLPLPKHINEE +LG I
Sbjct:    61 RKACAEVGIKSFDVGLPEEVSEADLISKVHELNSNPDVHGILVQLPLPKHINEEHILGAI 120

Query:   121 SLEKDVDGFHPLNIGKLAMKGRDPLFLPCTPKGCLELLKRSGVTIKGKRAVVVGRSNIVG 180
             S++KDVDGFHPLNIGKLAMKGR+PLFLPCTPKGCLELL RSGV IKG+RAVVVGRSNIVG
Sbjct:   121 SIDKDVDGFHPLNIGKLAMKGREPLFLPCTPKGCLELLARSGVKIKGQRAVVVGRSNIVG 180

Query:   181 LPVSLLLLKADATVTIVHSHTTDPESIVREADIVIAAAGQAMMV 224
             LPVSLLLLKADATVT VHSHT DPE+I+READIVIAA GQA M+
Sbjct:   181 LPVSLLLLKADATVTTVHSHTKDPEAIIREADIVIAACGQAHMI 224




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA;ISS
GO:0004488 "methylenetetrahydrofolate dehydrogenase (NADP+) activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0009396 "folic acid-containing compound biosynthetic process" evidence=IEA;ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0019344 "cysteine biosynthetic process" evidence=RCA
GO:0030244 "cellulose biosynthetic process" evidence=RCA
GO:0048193 "Golgi vesicle transport" evidence=RCA
TAIR|locus:2127113 EMB3127 "EMBRYO DEFECTIVE 3127" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2064143 AT2G38660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283121 DDB_G0283121 "methenyl tetrahydrofolate cyclohydrolase / NADP-dependent methylene H4F dehydrogenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0862 GSU_0862 "folD bifunctional protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
SGD|S000003436 ADE3 "Cytoplasmic trifunctional enzyme C1-tetrahydrofolate synthase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
TIGR_CMR|BA_4405 BA_4405 "methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
CGD|CAL0000766 MIS11 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59SM8 MIS11 "Likely C1-tetrahydrofolate synthase" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1792 SO_1792 "methylenetetrahydrofolate dehydrogenase/methylenetetrahydrofolate cyclohydrolase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q71ZW2FOLD_LISMF3, ., 5, ., 4, ., 90.55600.92130.7429yesno
Q75TC1FOLD_GEOKA3, ., 5, ., 4, ., 90.53240.93010.75yesno
O67736FOLD_AQUAE3, ., 5, ., 4, ., 90.50710.91700.7216yesno
A1AL91FOLD_PELPD3, ., 5, ., 4, ., 90.55550.93010.7526yesno
B8DFW8FOLD_LISMH3, ., 5, ., 4, ., 90.55600.92130.7429yesno
A7I254FOLD_CAMHC3, ., 5, ., 4, ., 90.50950.90390.7288yesno
Q1II76FOLD_KORVE3, ., 5, ., 4, ., 90.50690.93440.6970yesno
Q0KBW5FOLD_CUPNH3, ., 5, ., 4, ., 90.52070.93440.7561yesno
A5GAM5FOLD_GEOUR3, ., 5, ., 4, ., 90.56010.93010.7607yesno
C1L2R6FOLD_LISMC3, ., 5, ., 4, ., 90.55600.92130.7429yesno
Q8Y7C5FOLD_LISMO3, ., 5, ., 4, ., 90.55600.92130.7429yesno
Q92BZ4FOLD_LISIN3, ., 5, ., 4, ., 90.55600.92130.7429yesno
C0ZC05FOLD_BREBN3, ., 5, ., 4, ., 90.54160.93010.75yesno
B9M769FOLD_GEOSF3, ., 5, ., 4, ., 90.55090.93010.7607yesno
A3DEE6FOLD_CLOTH3, ., 5, ., 4, ., 90.50700.91700.7368yesno
A0AIG1FOLD_LISW63, ., 5, ., 4, ., 90.54670.92130.7429yesno
Q39WH4FOLD2_GEOMG3, ., 5, ., 4, ., 90.55550.93010.7473yesno
Q74EU7FOLD2_GEOSL3, ., 5, ., 4, ., 90.52310.93010.7473yesno
B1HRX9FOLD_LYSSC3, ., 5, ., 4, ., 90.51610.93440.7535yesno
Q472L4FOLD_CUPPJ3, ., 5, ., 4, ., 90.52070.93440.7561yesno
Q1WUJ3FOLD_LACS13, ., 5, ., 4, ., 90.52310.93010.7473yesno
A0LE04FOLD_MAGSM3, ., 5, ., 4, ., 90.56480.93440.7508yesno
B3R4L6FOLD_CUPTR3, ., 5, ., 4, ., 90.52070.93440.7561yesno
A4IQS0FOLD_GEOTN3, ., 5, ., 4, ., 90.55550.93010.75yesno
Q2RIB4FOLD_MOOTA3, ., 5, ., 4, ., 90.54580.93010.7607yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.5.4.90.914
3rd Layer3.5.40.921
3rd Layer1.5.10.921
4th Layer1.5.1.50.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
PLN02516299 PLN02516, PLN02516, methylenetetrahydrofolate dehy 1e-147
PLN02616364 PLN02616, PLN02616, tetrahydrofolate dehydrogenase 1e-101
PLN02897345 PLN02897, PLN02897, tetrahydrofolate dehydrogenase 1e-100
COG0190283 COG0190, FolD, 5,10-methylene-tetrahydrofolate deh 8e-98
PRK10792285 PRK10792, PRK10792, bifunctional 5,10-methylene-te 3e-91
PRK14190284 PRK14190, PRK14190, bifunctional 5,10-methylene-te 1e-87
PRK14188296 PRK14188, PRK14188, bifunctional 5,10-methylene-te 1e-86
PRK14189285 PRK14189, PRK14189, bifunctional 5,10-methylene-te 1e-85
PRK14179284 PRK14179, PRK14179, bifunctional 5,10-methylene-te 1e-78
PRK14191285 PRK14191, PRK14191, bifunctional 5,10-methylene-te 5e-76
PRK14193284 PRK14193, PRK14193, bifunctional 5,10-methylene-te 1e-75
PRK14186297 PRK14186, PRK14186, bifunctional 5,10-methylene-te 1e-75
PRK14184286 PRK14184, PRK14184, bifunctional 5,10-methylene-te 3e-74
PRK14174295 PRK14174, PRK14174, bifunctional 5,10-methylene-te 1e-73
PRK14167297 PRK14167, PRK14167, bifunctional 5,10-methylene-te 3e-70
PRK14185293 PRK14185, PRK14185, bifunctional 5,10-methylene-te 5e-70
PRK14176287 PRK14176, PRK14176, bifunctional 5,10-methylene-te 3e-68
PRK14194301 PRK14194, PRK14194, bifunctional 5,10-methylene-te 4e-68
PRK14170284 PRK14170, PRK14170, bifunctional 5,10-methylene-te 4e-68
PRK14178279 PRK14178, PRK14178, bifunctional 5,10-methylene-te 3e-67
PRK14168297 PRK14168, PRK14168, bifunctional 5,10-methylene-te 2e-66
PRK14183281 PRK14183, PRK14183, bifunctional 5,10-methylene-te 5e-66
PRK14187294 PRK14187, PRK14187, bifunctional 5,10-methylene-te 1e-65
PRK14192283 PRK14192, PRK14192, bifunctional 5,10-methylene-te 8e-65
PRK14175286 PRK14175, PRK14175, bifunctional 5,10-methylene-te 2e-64
PRK14172278 PRK14172, PRK14172, bifunctional 5,10-methylene-te 3e-64
PRK14182282 PRK14182, PRK14182, bifunctional 5,10-methylene-te 9e-62
PRK14173287 PRK14173, PRK14173, bifunctional 5,10-methylene-te 1e-60
PRK14171288 PRK14171, PRK14171, bifunctional 5,10-methylene-te 1e-59
PRK14180282 PRK14180, PRK14180, bifunctional 5,10-methylene-te 5e-59
PRK14177284 PRK14177, PRK14177, bifunctional 5,10-methylene-te 4e-58
PRK14166282 PRK14166, PRK14166, bifunctional 5,10-methylene-te 5e-58
PRK14169282 PRK14169, PRK14169, bifunctional 5,10-methylene-te 4e-55
PRK14181287 PRK14181, PRK14181, bifunctional 5,10-methylene-te 3e-53
pfam00763117 pfam00763, THF_DHG_CYH, Tetrahydrofolate dehydroge 3e-51
cd01080168 cd01080, NAD_bind_m-THF_DH_Cyclohyd, NADP binding 3e-47
pfam02882160 pfam02882, THF_DHG_CYH_C, Tetrahydrofolate dehydro 6e-46
cd05212140 cd05212, NAD_bind_m-THF_DH_Cyclohyd_like, NAD(P) b 3e-13
cd01079197 cd01079, NAD_bind_m-THF_DH, NAD binding domain of 7e-05
>gnl|CDD|178131 PLN02516, PLN02516, methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
 Score =  412 bits (1061), Expect = e-147
 Identities = 195/224 (87%), Positives = 209/224 (93%)

Query: 1   MAAPSDQKATIIDGKAVAQTIRSEIAEEVRLLSEKYGKVPGLAVVIVGGRKDSQSYVSMK 60
           MA+PSD  A IIDGKA+A+ IRSEIAEEV  LSEK+GKVPGLAVVIVG RKDSQ+YV+MK
Sbjct: 1   MASPSDHVAQIIDGKAIAKAIRSEIAEEVAQLSEKHGKVPGLAVVIVGSRKDSQTYVNMK 60

Query: 61  RKACAEVGIKSFDIDLPEQVSEAELISKVHELNVMPDVHGILVQLPLPKHINEEKVLGEI 120
           RKACAEVGIKSFD+DLPE +SEAELISKVHELN  PDVHGILVQLPLPKHINEEK+L EI
Sbjct: 61  RKACAEVGIKSFDVDLPENISEAELISKVHELNANPDVHGILVQLPLPKHINEEKILNEI 120

Query: 121 SLEKDVDGFHPLNIGKLAMKGRDPLFLPCTPKGCLELLKRSGVTIKGKRAVVVGRSNIVG 180
           SLEKDVDGFHPLNIGKLAMKGR+PLFLPCTPKGCLELL RSG+ IKGK+AVVVGRSNIVG
Sbjct: 121 SLEKDVDGFHPLNIGKLAMKGREPLFLPCTPKGCLELLSRSGIPIKGKKAVVVGRSNIVG 180

Query: 181 LPVSLLLLKADATVTIVHSHTTDPESIVREADIVIAAAGQAMMV 224
           LPVSLLLLKADATVT+VHS T DPESIVREADIVIAAAGQAMM+
Sbjct: 181 LPVSLLLLKADATVTVVHSRTPDPESIVREADIVIAAAGQAMMI 224


Length = 299

>gnl|CDD|215332 PLN02616, PLN02616, tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>gnl|CDD|178485 PLN02897, PLN02897, tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>gnl|CDD|223268 COG0190, FolD, 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|236760 PRK10792, PRK10792, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184560 PRK14190, PRK14190, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184558 PRK14188, PRK14188, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184559 PRK14189, PRK14189, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|237634 PRK14179, PRK14179, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172679 PRK14191, PRK14191, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|237637 PRK14193, PRK14193, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|237636 PRK14186, PRK14186, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|237635 PRK14184, PRK14184, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172662 PRK14174, PRK14174, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184549 PRK14167, PRK14167, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184556 PRK14185, PRK14185, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184553 PRK14176, PRK14176, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172682 PRK14194, PRK14194, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172658 PRK14170, PRK14170, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172666 PRK14178, PRK14178, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|237633 PRK14168, PRK14168, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184555 PRK14183, PRK14183, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172675 PRK14187, PRK14187, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184561 PRK14192, PRK14192, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184552 PRK14175, PRK14175, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172660 PRK14172, PRK14172, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172670 PRK14182, PRK14182, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184551 PRK14173, PRK14173, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172659 PRK14171, PRK14171, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172668 PRK14180, PRK14180, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172665 PRK14177, PRK14177, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172654 PRK14166, PRK14166, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184550 PRK14169, PRK14169, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172669 PRK14181, PRK14181, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|201431 pfam00763, THF_DHG_CYH, Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain Back     alignment and domain information
>gnl|CDD|133448 cd01080, NAD_bind_m-THF_DH_Cyclohyd, NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>gnl|CDD|217267 pfam02882, THF_DHG_CYH_C, Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain Back     alignment and domain information
>gnl|CDD|133451 cd05212, NAD_bind_m-THF_DH_Cyclohyd_like, NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>gnl|CDD|133447 cd01079, NAD_bind_m-THF_DH, NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 229
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 100.0
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 100.0
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 100.0
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 100.0
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
KOG4230 935 consensus C1-tetrahydrofolate synthase [Coenzyme t 100.0
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
KOG0089309 consensus Methylenetetrahydrofolate dehydrogenase/ 100.0
PF00763117 THF_DHG_CYH: Tetrahydrofolate dehydrogenase/cycloh 100.0
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 100.0
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 100.0
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 99.93
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 99.93
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 99.5
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 99.47
PRK12549284 shikimate 5-dehydrogenase; Reviewed 99.46
PRK12749 288 quinate/shikimate dehydrogenase; Reviewed 99.44
PRK12548 289 shikimate 5-dehydrogenase; Provisional 99.42
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 99.4
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 99.38
PRK14027283 quinate/shikimate dehydrogenase; Provisional 99.37
PRK12550272 shikimate 5-dehydrogenase; Reviewed 99.36
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 99.29
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 99.07
COG0373 414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 98.93
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 98.88
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.81
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 98.8
PRK13940 414 glutamyl-tRNA reductase; Provisional 98.7
PTZ00075 476 Adenosylhomocysteinase; Provisional 98.66
PRK00676338 hemA glutamyl-tRNA reductase; Validated 98.6
PRK08306296 dipicolinate synthase subunit A; Reviewed 98.42
cd05311 226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 98.38
PRK05476 425 S-adenosyl-L-homocysteine hydrolase; Provisional 98.34
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 98.31
PLN00203 519 glutamyl-tRNA reductase 98.22
TIGR01035 417 hemA glutamyl-tRNA reductase. This enzyme, togethe 98.22
PRK00045 423 hemA glutamyl-tRNA reductase; Reviewed 98.19
TIGR00936 406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 98.15
COG0499 420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 98.1
cd00401 413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 98.06
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 98.02
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 98.0
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.98
PLN02494 477 adenosylhomocysteinase 97.97
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 97.94
PRK12862 763 malic enzyme; Reviewed 97.89
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 97.85
PRK06718 202 precorrin-2 dehydrogenase; Reviewed 97.83
PRK06719157 precorrin-2 dehydrogenase; Validated 97.78
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 97.69
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 97.69
PRK14982 340 acyl-ACP reductase; Provisional 97.67
PRK12861 764 malic enzyme; Reviewed 97.62
COG0281 432 SfcA Malic enzyme [Energy production and conversio 97.6
TIGR00518 370 alaDH alanine dehydrogenase. The family of known L 97.59
PRK15438 378 erythronate-4-phosphate dehydrogenase PdxB; Provis 97.55
TIGR01470 205 cysG_Nterm siroheme synthase, N-terminal domain. T 97.54
PLN02928 347 oxidoreductase family protein 97.49
PRK00257 381 erythronate-4-phosphate dehydrogenase; Validated 97.49
PRK13243 333 glyoxylate reductase; Reviewed 97.44
PRK14804311 ornithine carbamoyltransferase; Provisional 97.35
PRK12480 330 D-lactate dehydrogenase; Provisional 97.28
PRK06436 303 glycerate dehydrogenase; Provisional 97.25
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.24
PRK04284332 ornithine carbamoyltransferase; Provisional 97.19
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.17
PRK14031 444 glutamate dehydrogenase; Provisional 97.17
KOG1370 434 consensus S-adenosylhomocysteine hydrolase [Coenzy 97.15
PRK00779304 ornithine carbamoyltransferase; Provisional 97.12
PRK07574 385 formate dehydrogenase; Provisional 97.12
PRK15469 312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 97.11
cd05312 279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 97.11
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 97.1
PRK02102331 ornithine carbamoyltransferase; Validated 97.09
PRK02255338 putrescine carbamoyltransferase; Provisional 97.08
PRK08605 332 D-lactate dehydrogenase; Validated 97.06
PRK06932314 glycerate dehydrogenase; Provisional 97.05
cd00762 254 NAD_bind_malic_enz NAD(P) binding domain of malic 97.03
PRK06487 317 glycerate dehydrogenase; Provisional 97.03
TIGR00658304 orni_carb_tr ornithine carbamoyltransferase. Most 97.02
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 97.01
PRK14805302 ornithine carbamoyltransferase; Provisional 97.0
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 96.99
COG0111 324 SerA Phosphoglycerate dehydrogenase and related de 96.99
PLN02342348 ornithine carbamoyltransferase 96.95
PRK13403 335 ketol-acid reductoisomerase; Provisional 96.95
PRK12562334 ornithine carbamoyltransferase subunit F; Provisio 96.95
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 96.94
PLN03129 581 NADP-dependent malic enzyme; Provisional 96.94
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 96.94
PRK13529 563 malate dehydrogenase; Provisional 96.9
PRK15409 323 bifunctional glyoxylate/hydroxypyruvate reductase 96.89
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 96.88
PRK01713334 ornithine carbamoyltransferase; Provisional 96.87
PF0850183 Shikimate_dh_N: Shikimate dehydrogenase substrate 96.86
PRK05579 399 bifunctional phosphopantothenoylcysteine decarboxy 96.83
PLN02527306 aspartate carbamoyltransferase 96.82
PRK06141 314 ornithine cyclodeaminase; Validated 96.82
PRK13814310 pyrB aspartate carbamoyltransferase catalytic subu 96.81
PLN03139 386 formate dehydrogenase; Provisional 96.8
cd01076 227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 96.8
TIGR02992 326 ectoine_eutC ectoine utilization protein EutC. Mem 96.79
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 96.76
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 96.74
PLN02306 386 hydroxypyruvate reductase 96.73
PTZ00317 559 NADP-dependent malic enzyme; Provisional 96.72
COG1648 210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 96.71
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 96.71
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.7
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.69
PRK08291 330 ectoine utilization protein EutC; Validated 96.67
PF03949 255 Malic_M: Malic enzyme, NAD binding domain; InterPr 96.67
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 96.66
PRK05479 330 ketol-acid reductoisomerase; Provisional 96.65
PRK05562 223 precorrin-2 dehydrogenase; Provisional 96.65
cd05313 254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 96.63
PRK09414 445 glutamate dehydrogenase; Provisional 96.63
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 96.62
PRK07340304 ornithine cyclodeaminase; Validated 96.54
PRK00856305 pyrB aspartate carbamoyltransferase catalytic subu 96.51
PRK08618 325 ornithine cyclodeaminase; Validated 96.5
cd05211 217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 96.5
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 96.5
PRK03515336 ornithine carbamoyltransferase subunit I; Provisio 96.49
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 96.46
PLN02477 410 glutamate dehydrogenase 96.4
TIGR00465 314 ilvC ketol-acid reductoisomerase. This is the seco 96.39
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 96.38
COG1052 324 LdhA Lactate dehydrogenase and related dehydrogena 96.37
PRK14030 445 glutamate dehydrogenase; Provisional 96.37
TIGR01505 291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 96.35
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 96.32
PRK06398 258 aldose dehydrogenase; Validated 96.32
COG2085 211 Predicted dinucleotide-binding enzymes [General fu 96.31
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.3
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 96.27
PF13460 183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 96.26
PRK09072 263 short chain dehydrogenase; Provisional 96.19
TIGR00521 390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 96.17
PRK07200 395 aspartate/ornithine carbamoyltransferase family pr 96.17
PRK04523335 N-acetylornithine carbamoyltransferase; Reviewed 96.14
PRK06949 258 short chain dehydrogenase; Provisional 96.14
PRK10637 457 cysG siroheme synthase; Provisional 96.13
PRK08192338 aspartate carbamoyltransferase; Provisional 96.13
PRK11891 429 aspartate carbamoyltransferase; Provisional 96.12
PRK15461 296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 96.1
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.1
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.08
TIGR03316357 ygeW probable carbamoyltransferase YgeW. Members o 96.08
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 96.07
COG0569 225 TrkA K+ transport systems, NAD-binding component [ 96.04
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.01
COG2084 286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 95.98
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 95.96
PF02737 180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 95.96
COG0686 371 Ald Alanine dehydrogenase [Amino acid transport an 95.91
PRK12828 239 short chain dehydrogenase; Provisional 95.9
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 95.89
PRK07856 252 short chain dehydrogenase; Provisional 95.88
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 95.87
PRK12429 258 3-hydroxybutyrate dehydrogenase; Provisional 95.86
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.86
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 95.85
PRK06523 260 short chain dehydrogenase; Provisional 95.85
PRK06550 235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.82
PRK08862 227 short chain dehydrogenase; Provisional 95.79
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 95.77
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 95.77
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.76
PRK07523 255 gluconate 5-dehydrogenase; Provisional 95.75
PRK06124 256 gluconate 5-dehydrogenase; Provisional 95.74
PTZ00117 319 malate dehydrogenase; Provisional 95.73
PTZ00079 454 NADP-specific glutamate dehydrogenase; Provisional 95.72
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 95.7
PLN02712 667 arogenate dehydrogenase 95.7
PRK12367 245 short chain dehydrogenase; Provisional 95.7
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 95.69
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.68
PRK08085 254 gluconate 5-dehydrogenase; Provisional 95.65
PRK07231 251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.62
PLN02545 295 3-hydroxybutyryl-CoA dehydrogenase 95.6
TIGR02356 202 adenyl_thiF thiazole biosynthesis adenylyltransfer 95.59
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 95.58
PLN02688 266 pyrroline-5-carboxylate reductase 95.56
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 95.54
PLN02256 304 arogenate dehydrogenase 95.54
TIGR01832 248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 95.54
PRK07417 279 arogenate dehydrogenase; Reviewed 95.52
TIGR02355 240 moeB molybdopterin synthase sulfurylase MoeB. This 95.51
PRK07424 406 bifunctional sterol desaturase/short chain dehydro 95.46
PRK05866 293 short chain dehydrogenase; Provisional 95.44
PRK07062 265 short chain dehydrogenase; Provisional 95.44
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 95.42
PRK06463 255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.41
PRK05867 253 short chain dehydrogenase; Provisional 95.39
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 95.38
PRK06138 252 short chain dehydrogenase; Provisional 95.38
TIGR03325 262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 95.37
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 95.37
PRK06171 266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 95.37
PRK07063 260 short chain dehydrogenase; Provisional 95.36
PLN00141 251 Tic62-NAD(P)-related group II protein; Provisional 95.36
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.35
PRK06935 258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 95.33
PRK12829 264 short chain dehydrogenase; Provisional 95.33
PRK08339 263 short chain dehydrogenase; Provisional 95.32
PRK08213 259 gluconate 5-dehydrogenase; Provisional 95.32
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 95.32
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 95.32
PF05368 233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 95.31
PRK07530 292 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.3
PRK06057 255 short chain dehydrogenase; Provisional 95.3
PRK08265 261 short chain dehydrogenase; Provisional 95.28
PRK06182 273 short chain dehydrogenase; Validated 95.28
PRK07890 258 short chain dehydrogenase; Provisional 95.28
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 95.28
PRK05717 255 oxidoreductase; Validated 95.27
PLN02253 280 xanthoxin dehydrogenase 95.24
PRK08223 287 hypothetical protein; Validated 95.23
PRK06172 253 short chain dehydrogenase; Provisional 95.23
PRK08628 258 short chain dehydrogenase; Provisional 95.19
PRK08416 260 7-alpha-hydroxysteroid dehydrogenase; Provisional 95.19
PRK12743 256 oxidoreductase; Provisional 95.19
PRK06179 270 short chain dehydrogenase; Provisional 95.18
PRK07679 279 pyrroline-5-carboxylate reductase; Reviewed 95.18
TIGR02354 200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 95.17
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.17
PRK08993 253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 95.14
PRK09186 256 flagellin modification protein A; Provisional 95.13
PRK06841 255 short chain dehydrogenase; Provisional 95.12
PRK05690 245 molybdopterin biosynthesis protein MoeB; Provision 95.12
PRK05225 487 ketol-acid reductoisomerase; Validated 95.11
TIGR01915 219 npdG NADPH-dependent F420 reductase. This model re 95.1
TIGR01214 287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 95.08
PRK07097 265 gluconate 5-dehydrogenase; Provisional 95.06
TIGR01963 255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 95.06
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 95.05
TIGR01763 305 MalateDH_bact malate dehydrogenase, NAD-dependent. 95.05
PLN02586 360 probable cinnamyl alcohol dehydrogenase 95.05
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 95.04
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 95.04
PRK07774 250 short chain dehydrogenase; Provisional 95.03
CHL00194 317 ycf39 Ycf39; Provisional 95.02
PRK12490 299 6-phosphogluconate dehydrogenase-like protein; Rev 94.97
PRK06545 359 prephenate dehydrogenase; Validated 94.97
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 94.95
PRK01390 460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.93
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 94.92
PRK09242 257 tropinone reductase; Provisional 94.92
PRK06125 259 short chain dehydrogenase; Provisional 94.91
PRK07819 286 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.91
PRK07035 252 short chain dehydrogenase; Provisional 94.91
PRK06200 263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 94.9
PRK09291 257 short chain dehydrogenase; Provisional 94.89
PRK05872 296 short chain dehydrogenase; Provisional 94.89
PTZ00082 321 L-lactate dehydrogenase; Provisional 94.89
PRK07060 245 short chain dehydrogenase; Provisional 94.88
COG0287 279 TyrA Prephenate dehydrogenase [Amino acid transpor 94.88
PRK06194 287 hypothetical protein; Provisional 94.88
PRK08264 238 short chain dehydrogenase; Validated 94.87
PRK08703 239 short chain dehydrogenase; Provisional 94.87
PRK15059 292 tartronate semialdehyde reductase; Provisional 94.86
PRK08936 261 glucose-1-dehydrogenase; Provisional 94.84
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 94.82
cd00757 228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 94.81
PRK05876 275 short chain dehydrogenase; Provisional 94.8
PRK06223 307 malate dehydrogenase; Reviewed 94.79
cd00650 263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 94.79
PRK05808 282 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.79
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.78
PRK12826 251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 94.76
PRK05565 247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.75
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 94.75
PRK12481 251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 94.74
PRK05653 246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.73
PRK08589 272 short chain dehydrogenase; Validated 94.73
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 94.72
PLN02896 353 cinnamyl-alcohol dehydrogenase 94.72
PRK07666 239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.7
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 94.68
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 94.68
PRK08277 278 D-mannonate oxidoreductase; Provisional 94.65
PRK07067 257 sorbitol dehydrogenase; Provisional 94.65
PRK07634 245 pyrroline-5-carboxylate reductase; Reviewed 94.64
PRK05854 313 short chain dehydrogenase; Provisional 94.62
PRK07576 264 short chain dehydrogenase; Provisional 94.62
PRK06114 254 short chain dehydrogenase; Provisional 94.61
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.6
PRK07478 254 short chain dehydrogenase; Provisional 94.58
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 94.58
PRK13394 262 3-hydroxybutyrate dehydrogenase; Provisional 94.57
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 94.56
KOG1494 345 consensus NAD-dependent malate dehydrogenase [Ener 94.56
PRK08644 212 thiamine biosynthesis protein ThiF; Provisional 94.56
PRK07814 263 short chain dehydrogenase; Provisional 94.55
PRK06196 315 oxidoreductase; Provisional 94.55
PRK06077 252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.53
PRK06500 249 short chain dehydrogenase; Provisional 94.53
PRK07825 273 short chain dehydrogenase; Provisional 94.52
PLN00198 338 anthocyanidin reductase; Provisional 94.5
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 94.49
PRK12939 250 short chain dehydrogenase; Provisional 94.49
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 94.47
PRK10423327 transcriptional repressor RbsR; Provisional 94.47
PRK01368 454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.44
PRK12742 237 oxidoreductase; Provisional 94.44
PRK05557 248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.43
PLN02427 386 UDP-apiose/xylose synthase 94.43
PRK08217 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.41
PRK05786 238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.4
KOG1198 347 consensus Zinc-binding oxidoreductase [Energy prod 94.4
PRK12823 260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 94.37
KOG0725 270 consensus Reductases with broad range of substrate 94.37
PRK12937 245 short chain dehydrogenase; Provisional 94.36
PRK08818 370 prephenate dehydrogenase; Provisional 94.34
PRK12779 944 putative bifunctional glutamate synthase subunit b 94.33
PRK12827 249 short chain dehydrogenase; Provisional 94.31
PLN02695 370 GDP-D-mannose-3',5'-epimerase 94.31
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 94.31
PRK09135 249 pteridine reductase; Provisional 94.3
PRK06139 330 short chain dehydrogenase; Provisional 94.27
PRK08643 256 acetoin reductase; Validated 94.25
PRK05875 276 short chain dehydrogenase; Provisional 94.22
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 94.22
TIGR03206 250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 94.22
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 94.21
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 94.2
cd05293 312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 94.2
PRK08226 263 short chain dehydrogenase; Provisional 94.18
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 94.17
cd05290 307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 94.17
COG2910 211 Putative NADH-flavin reductase [General function p 94.16
COG5322351 Predicted dehydrogenase [General function predicti 94.15
PRK08642 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.11
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.11
PRK08278 273 short chain dehydrogenase; Provisional 94.09
cd00704 323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 94.08
PRK06198 260 short chain dehydrogenase; Provisional 94.08
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.07
PRK08263 275 short chain dehydrogenase; Provisional 94.07
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 94.06
PRK08655 437 prephenate dehydrogenase; Provisional 94.06
PLN02778 298 3,5-epimerase/4-reductase 94.06
PRK07326 237 short chain dehydrogenase; Provisional 94.04
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 94.04
PLN02214 342 cinnamoyl-CoA reductase 94.03
PRK07806 248 short chain dehydrogenase; Provisional 93.99
PRK07577 234 short chain dehydrogenase; Provisional 93.99
PRK06181 263 short chain dehydrogenase; Provisional 93.96
PF01370 236 Epimerase: NAD dependent epimerase/dehydratase fam 93.95
PRK06079 252 enoyl-(acyl carrier protein) reductase; Provisiona 93.91
PRK09620 229 hypothetical protein; Provisional 93.89
COG0078310 ArgF Ornithine carbamoyltransferase [Amino acid tr 93.88
PRK06113 255 7-alpha-hydroxysteroid dehydrogenase; Validated 93.88
PRK06701 290 short chain dehydrogenase; Provisional 93.86
PRK08594 257 enoyl-(acyl carrier protein) reductase; Provisiona 93.86
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 93.84
PRK12936 245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 93.84
PRK05993 277 short chain dehydrogenase; Provisional 93.82
TIGR01777 292 yfcH conserved hypothetical protein TIGR01777. Thi 93.81
PRK09599 301 6-phosphogluconate dehydrogenase-like protein; Rev 93.81
PRK06914 280 short chain dehydrogenase; Provisional 93.8
PRK07533 258 enoyl-(acyl carrier protein) reductase; Provisiona 93.8
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 93.8
PRK11303328 DNA-binding transcriptional regulator FruR; Provis 93.8
COG0604 326 Qor NADPH:quinone reductase and related Zn-depende 93.78
PRK08507 275 prephenate dehydrogenase; Validated 93.78
PRK07677 252 short chain dehydrogenase; Provisional 93.77
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 93.77
cd08294 329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 93.77
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 93.76
cd05294 309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 93.75
PLN03209 576 translocon at the inner envelope of chloroplast su 93.75
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 93.74
TIGR03376 342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 93.74
PRK06197 306 short chain dehydrogenase; Provisional 93.73
PRK12744 257 short chain dehydrogenase; Provisional 93.69
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 93.67
PLN02602 350 lactate dehydrogenase 93.65
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 93.63
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 93.61
PRK07411 390 hypothetical protein; Validated 93.59
PRK07680 273 late competence protein ComER; Validated 93.56
PRK08267 260 short chain dehydrogenase; Provisional 93.53
PF04321 286 RmlD_sub_bind: RmlD substrate binding domain; Inte 93.53
PRK05086 312 malate dehydrogenase; Provisional 93.52
PRK07109 334 short chain dehydrogenase; Provisional 93.52
PRK07985 294 oxidoreductase; Provisional 93.52
TIGR02371 325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 93.51
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 93.51
PRK06128 300 oxidoreductase; Provisional 93.46
PRK08945 247 putative oxoacyl-(acyl carrier protein) reductase; 93.45
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 93.44
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 93.42
PRK08220 252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 93.4
PRK08303 305 short chain dehydrogenase; Provisional 93.4
PF00208 244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 93.37
PLN02653 340 GDP-mannose 4,6-dehydratase 93.35
PRK12935 247 acetoacetyl-CoA reductase; Provisional 93.34
cd01487 174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 93.33
PTZ00188 506 adrenodoxin reductase; Provisional 93.32
PRK10401346 DNA-binding transcriptional regulator GalS; Provis 93.31
PRK06720169 hypothetical protein; Provisional 93.31
PLN02206 442 UDP-glucuronate decarboxylase 93.28
PRK12746 254 short chain dehydrogenase; Provisional 93.26
COG0059 338 IlvC Ketol-acid reductoisomerase [Amino acid trans 93.25
COG0334 411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 93.24
PLN02514 357 cinnamyl-alcohol dehydrogenase 93.22
KOG0409 327 consensus Predicted dehydrogenase [General functio 93.2
PRK12491 272 pyrroline-5-carboxylate reductase; Reviewed 93.2
PRK09526342 lacI lac repressor; Reviewed 93.16
PRK07102 243 short chain dehydrogenase; Provisional 93.15
PLN00106 323 malate dehydrogenase 93.13
COG0039 313 Mdh Malate/lactate dehydrogenases [Energy producti 93.13
PRK12384 259 sorbitol-6-phosphate dehydrogenase; Provisional 93.11
PRK07791 286 short chain dehydrogenase; Provisional 93.1
PRK06505 271 enoyl-(acyl carrier protein) reductase; Provisiona 93.1
PLN02178 375 cinnamyl-alcohol dehydrogenase 93.09
COG0240 329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 93.08
PRK11880 267 pyrroline-5-carboxylate reductase; Reviewed 93.06
PLN03154 348 putative allyl alcohol dehydrogenase; Provisional 93.02
cd01337 310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 93.02
PRK06180 277 short chain dehydrogenase; Provisional 93.02
cd08292 324 ETR_like_2 2-enoyl thioester reductase (ETR) like 93.0
PRK12938 246 acetyacetyl-CoA reductase; Provisional 93.0
PRK07831 262 short chain dehydrogenase; Provisional 92.98
PRK06823 315 ornithine cyclodeaminase; Validated 92.96
PRK07024 257 short chain dehydrogenase; Provisional 92.95
cd08295 338 double_bond_reductase_like Arabidopsis alkenal dou 92.95
PRK08177 225 short chain dehydrogenase; Provisional 92.94
PRK08324 681 short chain dehydrogenase; Validated 92.9
PRK06483 236 dihydromonapterin reductase; Provisional 92.89
PLN02780 320 ketoreductase/ oxidoreductase 92.88
PRK07889 256 enoyl-(acyl carrier protein) reductase; Provisiona 92.86
PRK12825 249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.79
PRK12747 252 short chain dehydrogenase; Provisional 92.76
cd08239 339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 92.74
PRK03806 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.69
PLN02240 352 UDP-glucose 4-epimerase 92.66
PRK09496 453 trkA potassium transporter peripheral membrane com 92.63
PRK07454 241 short chain dehydrogenase; Provisional 92.61
TIGR02417327 fruct_sucro_rep D-fructose-responsive transcriptio 92.61
PRK12778 752 putative bifunctional 2-polyprenylphenol hydroxyla 92.59
PRK08063 250 enoyl-(acyl carrier protein) reductase; Provisiona 92.59
cd08281 371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 92.57
PRK07453 322 protochlorophyllide oxidoreductase; Validated 92.55
TIGR01087 433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 92.52
COG1028 251 FabG Dehydrogenases with different specificities ( 92.52
PRK05855 582 short chain dehydrogenase; Validated 92.49
cd01338 322 MDH_choloroplast_like Chloroplast-like malate dehy 92.48
PLN02858 1378 fructose-bisphosphate aldolase 92.47
PLN02353 473 probable UDP-glucose 6-dehydrogenase 92.47
PRK07074 257 short chain dehydrogenase; Provisional 92.46
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 92.44
PRK06300 299 enoyl-(acyl carrier protein) reductase; Provisiona 92.43
PLN02572 442 UDP-sulfoquinovose synthase 92.43
PRK09880343 L-idonate 5-dehydrogenase; Provisional 92.41
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 92.41
PRK06928 277 pyrroline-5-carboxylate reductase; Reviewed 92.39
TIGR02415 254 23BDH acetoin reductases. One member of this famil 92.35
TIGR03451 358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 92.35
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 92.35
KOG0023 360 consensus Alcohol dehydrogenase, class V [Secondar 92.34
PRK04148134 hypothetical protein; Provisional 92.32
PRK12814 652 putative NADPH-dependent glutamate synthase small 92.3
PRK14874 334 aspartate-semialdehyde dehydrogenase; Provisional 92.28
PLN02852 491 ferredoxin-NADP+ reductase 92.28
PLN02583 297 cinnamoyl-CoA reductase 92.25
PTZ00345 365 glycerol-3-phosphate dehydrogenase; Provisional 92.23
PRK09987 299 dTDP-4-dehydrorhamnose reductase; Provisional 92.22
PLN02858 1378 fructose-bisphosphate aldolase 92.19
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
Probab=100.00  E-value=2.4e-74  Score=515.93  Aligned_cols=229  Identities=85%  Similarity=1.239  Sum_probs=222.1

Q ss_pred             CCCCccchhhhcccHHHHHHHHHHHHHHHHHHHhcCCCCCeEEEEEECCCcccHHHHHHHHHHHHHcCCeeeeecCCCCC
Q 027064            1 MAAPSDQKATIIDGKAVAQTIRSEIAEEVRLLSEKYGKVPGLAVVIVGGRKDSQSYVSMKRKACAEVGIKSFDIDLPEQV   80 (229)
Q Consensus         1 ~~~~~~~~~~il~G~~la~~i~~~i~~~~~~l~~~~~~~P~LaiI~vg~~~~s~~Y~~~k~k~a~~~Gi~~~~~~l~~~~   80 (229)
                      |+.|..-|+.+|||+++|++++++++++++.|+++.|++|+|++|++|+||+|..|+++|.|+|+++||+++.++||+++
T Consensus         1 ~~~~~~~~~~ildGk~vA~~i~~~l~~~v~~l~~~~g~~P~LaiI~vg~d~as~~Yv~~k~k~a~~~Gi~~~~~~l~~~~   80 (299)
T PLN02516          1 MASPSDHVAQIIDGKAIAKAIRSEIAEEVAQLSEKHGKVPGLAVVIVGSRKDSQTYVNMKRKACAEVGIKSFDVDLPENI   80 (299)
T ss_pred             CCCCccccCeEeehHHHHHHHHHHHHHHHHHHHHcCCCCCeEEEEEECCChhHHHHHHHHHHHHHHcCCEEEEEECCCCC
Confidence            77777778889999999999999999999999988789999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHhcCCCCCcEEEEeCCCCCCCCHHHHHhcCCccCcccccCccchhhhhccCCCCCcccCCHHHHHHHHHH
Q 027064           81 SEAELISKVHELNVMPDVHGILVQLPLPKHINEEKVLGEISLEKDVDGFHPLNIGKLAMKGRDPLFLPCTPKGCLELLKR  160 (229)
Q Consensus        81 ~~~el~~~I~~lN~d~~v~GIlvq~Plp~~i~~~~i~~~I~p~KDVDg~~~~N~g~l~~~~~~~~~~PcTa~av~~lL~~  160 (229)
                      +++||++.|++||+|++|||||||+|||+|+|+++++++|+|+|||||+|+.|+|+|+.++..++|+||||+||++||++
T Consensus        81 s~~el~~~I~~lN~D~~V~GIlvq~PlP~~id~~~i~~~I~p~KDVDGl~~~n~g~l~~~~~~~~~~PcTp~avi~lL~~  160 (299)
T PLN02516         81 SEAELISKVHELNANPDVHGILVQLPLPKHINEEKILNEISLEKDVDGFHPLNIGKLAMKGREPLFLPCTPKGCLELLSR  160 (299)
T ss_pred             CHHHHHHHHHHHhCCCCCCeEEEecCCCCCcCHHHHHhccCcccccCccCHhhHhhHhcCCCCCCCCCCCHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999998643578999999999999999


Q ss_pred             hCCCCCCCeEEEEccchhhhHHHHHHHhhCCCEEEEEcCCCCCHHhhhccCcEEEEecCCCCCCCCCCC
Q 027064          161 SGVTIKGKRAVVVGRSNIVGLPVSLLLLKADATVTIVHSHTTDPESIVREADIVIAAAGQAMMVTMGIL  229 (229)
Q Consensus       161 ~~~~l~gk~v~ViG~s~~VG~pla~~L~~~~atVtv~~~~t~~l~~~~~~aDivisA~g~p~~i~~~~v  229 (229)
                      |+++++||+|+|||||.+||||+++||+++|||||+|||+|+++.+++++|||||+|+|+|+||++|||
T Consensus       161 ~~i~l~Gk~vvVIGRS~iVGkPla~lL~~~~ATVtvchs~T~nl~~~~~~ADIvv~AvGk~~~i~~~~v  229 (299)
T PLN02516        161 SGIPIKGKKAVVVGRSNIVGLPVSLLLLKADATVTVVHSRTPDPESIVREADIVIAAAGQAMMIKGDWI  229 (299)
T ss_pred             hCCCCCCCEEEEECCCccchHHHHHHHHHCCCEEEEeCCCCCCHHHHHhhCCEEEEcCCCcCccCHHHc
Confidence            999999999999999999999999999999999999999999999999999999999999999999996



>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG4230 consensus C1-tetrahydrofolate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG0089 consensus Methylenetetrahydrofolate dehydrogenase/methylenetetrahydrofolate cyclohydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PF00763 THF_DHG_CYH: Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain; InterPro: IPR020630 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK14804 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK04284 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK00779 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK02102 ornithine carbamoyltransferase; Validated Back     alignment and domain information
>PRK02255 putrescine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information
>PRK14805 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02342 ornithine carbamoyltransferase Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK12562 ornithine carbamoyltransferase subunit F; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK01713 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PF08501 Shikimate_dh_N: Shikimate dehydrogenase substrate binding domain; InterPro: IPR013708 This domain is the substrate binding domain of shikimate dehydrogenase [] Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PLN02527 aspartate carbamoyltransferase Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK13814 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PTZ00317 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK03515 ornithine carbamoyltransferase subunit I; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>PRK07200 aspartate/ornithine carbamoyltransferase family protein; Validated Back     alignment and domain information
>PRK04523 N-acetylornithine carbamoyltransferase; Reviewed Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PRK08192 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>PRK11891 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03316 ygeW probable carbamoyltransferase YgeW Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>KOG1494 consensus NAD-dependent malate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK10423 transcriptional repressor RbsR; Provisional Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>COG0078 ArgF Ornithine carbamoyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK11303 DNA-binding transcriptional regulator FruR; Provisional Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK10401 DNA-binding transcriptional regulator GalS; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK09526 lacI lac repressor; Reviewed Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
4a26_A300 The Crystal Structure Of Leishmania Major N5,N10- M 9e-62
4a5o_A286 Crystal Structure Of Pseudomonas Aeruginosa N5, N10 1e-49
3l07_A285 Methylenetetrahydrofolate DehydrogenaseMETHENYLTETR 2e-49
1b0a_A288 5,10, Methylene-Tetrahydropholate DehydrogenaseCYCL 2e-49
1dia_A306 Human Methylenetetrahydrofolate Dehydrogenase Cyclo 2e-47
1a4i_A301 Human Tetrahydrofolate Dehydrogenase CYCLOHYDROLASE 3e-47
3p2o_A285 Crystal Structure Of Fold Bifunctional Protein From 2e-46
4b4u_A303 Crystal Structure Of Acinetobacter Baumannii N5, N1 7e-46
2c2x_A281 Three Dimensional Structure Of Bifunctional Methyle 6e-45
3ngl_A276 Crystal Structure Of Bifunctional 5,10-Methylenetet 1e-21
1edz_A320 Structure Of The Nad-Dependent 5,10- Methylenetetra 4e-09
>pdb|4A26|A Chain A, The Crystal Structure Of Leishmania Major N5,N10- Methylenetetrahydrofolate DehydrogenaseCYCLOHYDROLASE Length = 300 Back     alignment and structure

Iteration: 1

Score = 233 bits (593), Expect = 9e-62, Method: Compositional matrix adjust. Identities = 122/215 (56%), Positives = 156/215 (72%), Gaps = 3/215 (1%) Query: 9 ATIIDGKAVAQTIRSEIAEEVRLLSEKYG-KVPGLAVVIVGGRKDSQSYVSMKRKACAEV 67 A IIDGKA+A IRSE+ ++V L E YG +VPGLA +IVG R DS+ YV +K KA AEV Sbjct: 6 AQIIDGKAIAAAIRSELKDKVAALRELYGGRVPGLASIIVGQRMDSKKYVQLKHKAAAEV 65 Query: 68 GIKSFDIDLPEQVSEAELISKVHELNVMPDVHGILVQLPLPKHINEEKVLGEISLEKDVD 127 G+ SF+++LPE +S+ L V +LN P+ HGI+VQLPLPKH+NE + + +I KD D Sbjct: 66 GMASFNVELPEDISQEVLEVNVEKLNNDPNCHGIIVQLPLPKHLNENRAIEKIHPHKDAD 125 Query: 128 GFHPLNIGKLAMKGRDPLFLPCTPKGCLELLKRSGVTIKGKRAVVVGRSNIVGLPVSLLL 187 P+N+G L KGR+P F PCT KG + LLKR G+ + GKRAVV+GRSNIVG PV+ LL Sbjct: 126 ALLPVNVGLLHYKGREPPFTPCTAKGVIVLLKRCGIEMAGKRAVVLGRSNIVGAPVAALL 185 Query: 188 LKADATVTIVHSHTTDPESI--VREADIVIAAAGQ 220 +K +ATVTIVHS T+ + I +R ADIVIAA GQ Sbjct: 186 MKENATVTIVHSGTSTEDMIDYLRTADIVIAAMGQ 220
>pdb|4A5O|A Chain A, Crystal Structure Of Pseudomonas Aeruginosa N5, N10- Methylenetetrahydrofolate Dehydrogenase-Cyclohydrolase (Fold) Length = 286 Back     alignment and structure
>pdb|3L07|A Chain A, Methylenetetrahydrofolate DehydrogenaseMETHENYLTETRAHYDROFOLATE Cyclohydrolase, Putative Bifunctional Protein Fold From Francisella Tularensis. Length = 285 Back     alignment and structure
>pdb|1B0A|A Chain A, 5,10, Methylene-Tetrahydropholate DehydrogenaseCYCLOHYDROLASE FROM E COLI Length = 288 Back     alignment and structure
>pdb|1DIA|A Chain A, Human Methylenetetrahydrofolate Dehydrogenase Cyclohydrolase Complexed With Nadp And Inhibitor Ly249543 Length = 306 Back     alignment and structure
>pdb|1A4I|A Chain A, Human Tetrahydrofolate Dehydrogenase CYCLOHYDROLASE Length = 301 Back     alignment and structure
>pdb|3P2O|A Chain A, Crystal Structure Of Fold Bifunctional Protein From Campylobacter Jejuni Length = 285 Back     alignment and structure
>pdb|4B4U|A Chain A, Crystal Structure Of Acinetobacter Baumannii N5, N10-Methylenetetrahydrofolate Dehydrogenase-Cyclohydrolase (Fold) Complexed With Nadp Cofactor Length = 303 Back     alignment and structure
>pdb|2C2X|A Chain A, Three Dimensional Structure Of Bifunctional Methylenetetrahydrofolate Dehydrogenase-Cyclohydrolase From Mycobacterium Tuberculosis Length = 281 Back     alignment and structure
>pdb|3NGL|A Chain A, Crystal Structure Of Bifunctional 5,10-Methylenetetrahydrofolate Dehydrogenase CYCLOHYDROLASE FROM THERMOPLASMA ACIDOPHILUM Length = 276 Back     alignment and structure
>pdb|1EDZ|A Chain A, Structure Of The Nad-Dependent 5,10- Methylenetetrahydrofolate Dehydrogenase From Saccharomyces Cerevisiae Length = 320 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 1e-129
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 1e-128
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 1e-126
3l07_A285 Bifunctional protein fold; structural genomics, ID 1e-126
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 1e-125
3p2o_A285 Bifunctional protein fold; structural genomics, ce 1e-125
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 1e-119
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 1e-115
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 2e-99
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Length = 300 Back     alignment and structure
 Score =  364 bits (937), Expect = e-129
 Identities = 123/220 (55%), Positives = 155/220 (70%), Gaps = 3/220 (1%)

Query: 9   ATIIDGKAVAQTIRSEIAEEVRLLSEKY-GKVPGLAVVIVGGRKDSQSYVSMKRKACAEV 67
           A IIDGKA+A  IRSE+ ++V  L E Y G+VPGLA +IVG R DS+ YV +K KA AEV
Sbjct: 6   AQIIDGKAIAAAIRSELKDKVAALRELYGGRVPGLASIIVGQRMDSKKYVQLKHKAAAEV 65

Query: 68  GIKSFDIDLPEQVSEAELISKVHELNVMPDVHGILVQLPLPKHINEEKVLGEISLEKDVD 127
           G+ SF+++LPE +S+  L   V +LN  P+ HGI+VQLPLPKH+NE + + +I   KD D
Sbjct: 66  GMASFNVELPEDISQEVLEVNVEKLNNDPNCHGIIVQLPLPKHLNENRAIEKIHPHKDAD 125

Query: 128 GFHPLNIGKLAMKGRDPLFLPCTPKGCLELLKRSGVTIKGKRAVVVGRSNIVGLPVSLLL 187
              P+N+G L  KGR+P F PCT KG + LLKR G+ + GKRAVV+GRSNIVG PV+ LL
Sbjct: 126 ALLPVNVGLLHYKGREPPFTPCTAKGVIVLLKRCGIEMAGKRAVVLGRSNIVGAPVAALL 185

Query: 188 LKADATVTIVHSH--TTDPESIVREADIVIAAAGQAMMVT 225
           +K +ATVTIVHS   T D    +R ADIVIAA GQ   V 
Sbjct: 186 MKENATVTIVHSGTSTEDMIDYLRTADIVIAAMGQPGYVK 225


>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Length = 301 Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Length = 286 Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Length = 285 Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Length = 288 Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Length = 285 Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Length = 281 Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Length = 276 Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Length = 320 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query229
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 100.0
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 100.0
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 100.0
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 100.0
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 100.0
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 100.0
3p2o_A285 Bifunctional protein fold; structural genomics, ce 100.0
3l07_A285 Bifunctional protein fold; structural genomics, ID 100.0
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 100.0
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 100.0
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 99.81
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 99.78
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 99.78
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 99.77
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 99.75
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 99.74
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 99.63
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 99.6
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 99.5
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 99.48
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 99.46
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 99.46
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 99.44
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 99.42
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 99.34
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 99.31
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 99.21
2dvm_A 439 Malic enzyme, 439AA long hypothetical malate oxido 99.15
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 98.73
1vl6_A 388 Malate oxidoreductase; TM0542, NAD-dependent malic 98.7
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 98.64
3h9u_A 436 Adenosylhomocysteinase; NAD CO-factor complex, str 98.55
3n58_A 464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 98.44
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.39
3gvp_A 435 Adenosylhomocysteinase 3; protein CO-factor comple 98.29
2a9f_A 398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 98.23
3d64_A 494 Adenosylhomocysteinase; structural genomics, ssgci 97.98
3jtm_A 351 Formate dehydrogenase, mitochondrial; mitochondrio 97.95
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 97.94
1v8b_A 479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 97.9
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 97.9
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 97.86
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 97.85
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 97.8
2rir_A300 Dipicolinate synthase, A chain; structural genomic 97.77
1pjc_A 361 Protein (L-alanine dehydrogenase); oxidoreductase, 97.75
3dfz_A 223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 97.73
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 97.71
1leh_A 364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 97.7
1l7d_A 384 Nicotinamide nucleotide transhydrogenase, subunit 97.66
3nv9_A 487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 97.65
3ce6_A 494 Adenosylhomocysteinase; protein-substrate complex, 97.61
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 97.59
4dio_A 405 NAD(P) transhydrogenase subunit alpha PART 1; stru 97.55
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 97.54
1x13_A 401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 97.5
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 97.47
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 97.46
3evt_A 324 Phosphoglycerate dehydrogenase; structural genomic 97.44
3hg7_A 324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 97.43
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 97.43
2gcg_A 330 Glyoxylate reductase/hydroxypyruvate reductase; NA 97.41
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 97.41
3pp8_A 315 Glyoxylate/hydroxypyruvate reductase A; structural 97.39
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 97.38
1qp8_A 303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 97.36
1xdw_A 331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 97.36
2d0i_A 333 Dehydrogenase; structural genomics, NPPSFA, nation 97.36
2yq5_A 343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 97.36
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 97.35
4e5n_A 330 Thermostable phosphite dehydrogenase; D-2-hydroxya 97.35
2w2k_A 348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 97.35
2pi1_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 97.34
2dbq_A 334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 97.34
4hy3_A 365 Phosphoglycerate oxidoreductase; PSI-biology, stru 97.34
1dxy_A 333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 97.32
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 97.32
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.3
2raf_A 209 Putative dinucleotide-binding oxidoreductase; NP_7 97.3
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 97.3
3e8x_A 236 Putative NAD-dependent epimerase/dehydratase; stru 97.29
1mx3_A 347 CTBP1, C-terminal binding protein 1; nuclear prote 97.29
1j4a_A 333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 97.28
2vhw_A 377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 97.24
3dtt_A 245 NADP oxidoreductase; structural genomics, joint ce 97.24
3gg9_A 352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 97.2
2j6i_A 364 Formate dehydrogenase; oxidoreductase, D-specific- 97.19
1c1d_A 355 L-phenylalanine dehydrogenase; amino acid dehydrog 97.11
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 97.1
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 97.1
2nac_A 393 NAD-dependent formate dehydrogenase; oxidoreductas 97.09
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 97.06
2eez_A 369 Alanine dehydrogenase; TTHA0216, structural genomi 97.06
4f2g_A309 Otcase 1, ornithine carbamoyltransferase 1; struct 97.05
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 97.04
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.04
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 97.02
3csu_A310 Protein (aspartate carbamoyltransferase); transfer 97.0
3gd5_A323 Otcase, ornithine carbamoyltransferase; structural 97.0
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 96.98
1hdo_A 206 Biliverdin IX beta reductase; foetal metabolism, H 96.95
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 96.94
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 96.93
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 96.93
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 96.89
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 96.88
1pg5_A299 Aspartate carbamoyltransferase; 2.60A {Sulfolobus 96.87
3kb6_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 96.84
1gtm_A 419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 96.83
1kyq_A 274 Met8P, siroheme biosynthesis protein Met8; homodim 96.82
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 96.82
2bka_A 242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 96.81
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 96.79
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 96.79
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 96.77
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 96.77
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 96.76
3qha_A 296 Putative oxidoreductase; seattle structural genomi 96.75
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 96.75
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, thermus 96.74
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 96.74
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 96.74
3ew7_A 221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 96.73
2qrj_A 394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 96.73
3tpf_A307 Otcase, ornithine carbamoyltransferase; structural 96.73
3hdj_A 313 Probable ornithine cyclodeaminase; APC62486, borde 96.72
3dhn_A 227 NAD-dependent epimerase/dehydratase; reductase, PF 96.72
3aog_A 440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 96.71
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 96.71
1u7z_A 226 Coenzyme A biosynthesis bifunctional protein coabc 96.7
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 96.7
1ml4_A308 Aspartate transcarbamoylase; beta pleated sheet, p 96.7
2o23_A 265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 96.69
3sds_A353 Ornithine carbamoyltransferase, mitochondrial; str 96.69
1o5i_A 249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 96.68
3r7f_A304 Aspartate carbamoyltransferase; aspartate transcar 96.67
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 96.65
4ezb_A 317 Uncharacterized conserved protein; structural geno 96.65
1zej_A 293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 96.63
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 96.62
4h15_A 261 Short chain alcohol dehydrogenase-related dehydro; 96.61
2gf2_A 296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 96.61
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 96.61
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 96.61
1jw9_B 249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 96.59
3c85_A183 Putative glutathione-regulated potassium-efflux S 96.58
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 96.58
3obb_A 300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 96.58
4ep1_A340 Otcase, ornithine carbamoyltransferase; structural 96.58
3qvo_A 236 NMRA family protein; structural genomics, PSI-biol 96.56
2gk4_A 232 Conserved hypothetical protein; alpha-beta-alpha s 96.56
2vns_A 215 Metalloreductase steap3; metal-binding, transmembr 96.56
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 96.56
1lss_A140 TRK system potassium uptake protein TRKA homolog; 96.55
3gt0_A 247 Pyrroline-5-carboxylate reductase; structural geno 96.54
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 96.53
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 96.51
4a8t_A339 Putrescine carbamoyltransferase; trabnsferase PALO 96.51
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 96.51
3tpc_A 257 Short chain alcohol dehydrogenase-related dehydro; 96.5
3grf_A328 Ornithine carbamoyltransferase; ornithine transcar 96.5
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crys 96.5
1xq6_A 253 Unknown protein; structural genomics, protein stru 96.48
3r6d_A 221 NAD-dependent epimerase/dehydratase; structural ge 96.48
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 96.47
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 96.47
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 96.47
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 96.47
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 96.47
2nm0_A 253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 96.46
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 96.46
3afn_B 258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 96.46
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 96.45
4b79_A 242 PA4098, probable short-chain dehydrogenase; oxidor 96.45
3d7l_A 202 LIN1944 protein; APC89317, structural genomics, PS 96.43
3dqp_A 219 Oxidoreductase YLBE; alpha-beta protein., structur 96.41
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 96.41
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 96.4
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 96.4
1vlv_A325 Otcase, ornithine carbamoyltransferase; TM1097, st 96.4
2fwm_X 250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 96.37
4gkb_A 258 3-oxoacyl-[acyl-carrier protein] reductase; putati 96.36
2rcy_A 262 Pyrroline carboxylate reductase; malaria, structur 96.36
3d3w_A 244 L-xylulose reductase; uronate cycle, short-chain d 96.36
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 96.36
3ak4_A 263 NADH-dependent quinuclidinone reductase; SDR, (R)- 96.36
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 96.36
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 96.35
2q2v_A 255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 96.34
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 96.34
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 96.34
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 96.33
2yjz_A 201 Metalloreductase steap4; oxidoreductase, metabolic 95.32
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 96.32
4a8p_A 355 Putrescine carbamoyltransferase; ornithine agmatin 96.32
3d1l_A 266 Putative NADP oxidoreductase BF3122; structural ge 96.32
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 96.31
3gms_A 340 Putative NADPH:quinone reductase; structural genom 96.31
4fs3_A 256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 96.31
1vl0_A 292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 96.31
4ekn_B306 Aspartate carbamoyltransferase; atcase, aspartate 96.29
2hjr_A 328 Malate dehydrogenase; malaria, structural genomics 96.29
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.28
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 96.27
2pd6_A 264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 96.27
2pnf_A 248 3-oxoacyl-[acyl-carrier-protein] reductase; short 96.26
3d6n_B291 Aspartate carbamoyltransferase; reactor, chamber, 96.26
3tri_A 280 Pyrroline-5-carboxylate reductase; amino acid bios 96.26
3orf_A 251 Dihydropteridine reductase; alpha-beta-alpha sandw 96.25
3gem_A 260 Short chain dehydrogenase; structural genomics, AP 96.24
1nff_A 260 Putative oxidoreductase RV2002; directed evolution 96.23
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 96.22
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 96.22
3un1_A 260 Probable oxidoreductase; structural genomics, PSI- 96.22
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 96.21
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 96.21
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 96.2
1ooe_A 236 Dihydropteridine reductase; structural genomics, P 96.19
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 96.19
1uzm_A 247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 96.19
1fmc_A 255 7 alpha-hydroxysteroid dehydrogenase; short-chain 96.19
3h2s_A 224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 96.18
2d1y_A 256 Hypothetical protein TT0321; strucrtural genomics, 96.18
1id1_A153 Putative potassium channel protein; RCK domain, E. 96.17
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 96.16
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 96.16
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 96.16
2ahr_A 259 Putative pyrroline carboxylate reductase; pyrrolin 96.16
4amu_A365 Ornithine carbamoyltransferase, catabolic; ornithi 96.15
3op4_A 248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 96.15
1dxh_A335 Ornithine carbamoyltransferase; transcarbamylase; 96.15
4huj_A 220 Uncharacterized protein; PSI-biology, nysgrc, stru 96.15
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 96.14
1oth_A321 Protein (ornithine transcarbamoylase); transferase 96.14
1o0s_A 605 NAD-ME, NAD-dependent malic enzyme; oxidoreductase 96.13
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 96.13
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 96.13
4iin_A 271 3-ketoacyl-acyl carrier protein reductase (FABG); 96.13
2w37_A359 Ornithine carbamoyltransferase, catabolic; transca 96.12
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 96.12
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 96.12
2a4k_A 263 3-oxoacyl-[acyl carrier protein] reductase; reduct 96.12
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 96.11
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 96.11
3v2g_A 271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.1
2b4q_A 276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 96.1
1i36_A 264 Conserved hypothetical protein MTH1747; NADP bindi 96.1
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 96.09
1gq2_A 555 Malic enzyme; oxidoreductase, pigeon liver, NADP-d 96.08
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 96.08
1dhr_A 241 Dihydropteridine reductase; oxidoreductase(acting 96.08
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 96.08
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 96.08
3uf0_A 273 Short-chain dehydrogenase/reductase SDR; gluconate 96.08
3uce_A 223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 96.07
1x7d_A 350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 96.06
3grp_A 266 3-oxoacyl-(acyl carrierprotein) reductase; structu 96.05
3aoe_E 419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 96.04
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 96.03
2hcy_A 347 Alcohol dehydrogenase 1; tetramer of asymmetric di 96.02
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 96.01
4dqx_A 277 Probable oxidoreductase protein; structural genomi 96.01
4eye_A 342 Probable oxidoreductase; structural genomics, niai 96.0
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 96.0
4dmm_A 269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 95.99
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 95.97
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 95.97
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 95.96
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 95.96
3gaf_A 256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 95.95
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 95.95
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 95.94
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 95.94
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 95.93
1uay_A 242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 95.92
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 95.91
3tl3_A 257 Short-chain type dehydrogenase/reductase; ssgcid, 95.9
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 95.9
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 95.9
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 95.88
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 95.88
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 95.88
1omo_A 322 Alanine dehydrogenase; two-domain, beta-sandwich-d 95.88
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 95.87
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 95.86
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 95.86
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 95.86
1zud_1 251 Adenylyltransferase THIF; thiamin, thiazole, prote 95.86
1duv_G333 Octase-1, ornithine transcarbamoylase; enzyme-inhi 95.85
2vn8_A 375 Reticulon-4-interacting protein 1; mitochondrion, 95.85
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 95.85
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 95.85
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 95.84
1sny_A 267 Sniffer CG10964-PA; alpha and beta protein, rossma 95.82
2ehd_A 234 Oxidoreductase, oxidoreductase, short-chain dehydr 95.82
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 95.82
3is3_A 270 17BETA-hydroxysteroid dehydrogenase; short chain d 95.81
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 95.8
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 95.8
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 95.8
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 95.8
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 95.8
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 95.8
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 95.79
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 95.79
3eag_A 326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 95.79
4b4o_A 298 Epimerase family protein SDR39U1; isomerase; HET: 95.78
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 95.77
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 95.76
2dkn_A 255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 95.75
3tl2_A 315 Malate dehydrogenase; center for structural genomi 95.75
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 95.75
4imr_A 275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 95.75
1ur5_A 309 Malate dehydrogenase; oxidoreductase, tricarboxyli 95.72
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 95.71
3rwb_A 247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 95.71
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 95.7
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 95.7
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 95.69
3ftp_A 270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 95.68
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 95.68
3gqv_A 371 Enoyl reductase; medium-chain reductase (MDR super 95.68
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 95.67
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 95.67
3qiv_A 253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 95.67
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 95.66
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 95.66
1pj3_A 564 NAD-dependent malic enzyme, mitochondrial; oxidati 95.65
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 95.65
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 95.64
1hdc_A 254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 95.63
2duw_A145 Putative COA-binding protein; ligand binding prote 95.61
1v9l_A 421 Glutamate dehydrogenase; protein-NAD complex, oxid 95.6
2a35_A 215 Hypothetical protein PA4017; alpha-beta-alpha sand 95.6
4eso_A 255 Putative oxidoreductase; NADP, structural genomics 95.59
4dyv_A 272 Short-chain dehydrogenase/reductase SDR; structura 95.59
3b1f_A 290 Putative prephenate dehydrogenase; enzyme, 4-hydro 95.59
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 95.58
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 95.58
3qwb_A 334 Probable quinone oxidoreductase; rossmann fold, qu 95.58
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 95.57
1cyd_A 244 Carbonyl reductase; short-chain dehydrogenase, oxi 95.57
3dii_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 95.56
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 95.55
3i1j_A 247 Oxidoreductase, short chain dehydrogenase/reducta; 95.55
2c0c_A 362 Zinc binding alcohol dehydrogenase, domain contain 95.55
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 95.55
1yo6_A 250 Putative carbonyl reductase sniffer; tyrosine-depe 95.54
1ks9_A 291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 95.53
3ppi_A 281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 95.53
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 95.52
1guz_A 310 Malate dehydrogenase; oxidoreductase, tricarboxyli 95.52
4b7c_A 336 Probable oxidoreductase; NADP cofactor, rossmann f 95.52
3s2e_A 340 Zinc-containing alcohol dehydrogenase superfamily; 95.52
2yfq_A 421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 95.51
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 95.51
3jyn_A 325 Quinone oxidoreductase; rossmann fold, protein-NAD 95.51
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 95.51
2ekp_A 239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 95.51
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 95.5
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 95.49
1fjh_A 257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 95.49
2wsb_A 254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 95.49
3rih_A 293 Short chain dehydrogenase or reductase; structural 95.48
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 95.48
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 95.48
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 95.48
3osu_A 246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 95.48
3k92_A 424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 95.48
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 95.48
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 95.46
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 95.43
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 95.43
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 95.42
3f1l_A 252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 95.41
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 95.41
3l4b_C 218 TRKA K+ channel protien TM1088B; potassium channel 95.4
2hq1_A 247 Glucose/ribitol dehydrogenase; CTH-1438, structura 95.4
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 95.38
3awd_A 260 GOX2181, putative polyol dehydrogenase; oxidoreduc 95.38
3oid_A 258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 95.37
3imf_A 257 Short chain dehydrogenase; structural genomics, in 95.37
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 95.36
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 95.35
4iiu_A 267 3-oxoacyl-[acyl-carrier protein] reductase; struct 95.35
3q98_A 399 Transcarbamylase; rossmann fold, transferase; 2.00 95.34
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 95.34
2tmg_A 415 Protein (glutamate dehydrogenase); metabolic role, 95.33
1jay_A 212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 95.33
3f9i_A 249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 95.33
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 95.33
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 95.31
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 95.31
3oig_A 266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 95.3
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 95.3
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 95.3
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 95.3
3icc_A 255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 95.29
3ay3_A 267 NAD-dependent epimerase/dehydratase; glucuronic ac 95.29
3t4x_A 267 Oxidoreductase, short chain dehydrogenase/reducta; 95.29
3ijr_A 291 Oxidoreductase, short chain dehydrogenase/reducta; 95.29
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 95.28
1uls_A 245 Putative 3-oxoacyl-acyl carrier protein reductase; 95.28
3e9n_A 245 Putative short-chain dehydrogenase/reductase; stru 95.28
2ae2_A 260 Protein (tropinone reductase-II); oxidoreductase, 95.28
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 95.28
3rkr_A 262 Short chain oxidoreductase; rossmann fold; HET: NA 95.27
1x1t_A 260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 95.27
1yqg_A 263 Pyrroline-5-carboxylate reductase; structural geno 95.27
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 95.27
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 95.27
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 95.25
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 95.25
2jah_A 247 Clavulanic acid dehydrogenase; short-chain dehydro 95.24
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 95.24
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 95.24
3ehe_A 313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 95.24
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 95.23
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 95.23
3ctm_A 279 Carbonyl reductase; alcohol dehydrogenase, short-c 95.23
1yb1_A 272 17-beta-hydroxysteroid dehydrogenase type XI; shor 95.23
1hyh_A 309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 95.23
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 95.22
2ew8_A 249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 95.22
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 95.21
2z1n_A 260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 95.2
1zk4_A 251 R-specific alcohol dehydrogenase; short chain redu 95.2
1zem_A 262 Xylitol dehydrogenase; rossmann fold, dinucleotide 95.2
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 95.19
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 95.19
3fbg_A 346 Putative arginate lyase; structural genomics, unkn 95.19
4f6c_A 427 AUSA reductase domain protein; thioester reductase 95.17
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 95.16
4dry_A 281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 95.16
2ag5_A 246 DHRS6, dehydrogenase/reductase (SDR family) member 95.16
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 95.15
4ibo_A 271 Gluconate dehydrogenase; enzyme function initiativ 95.15
1b8p_A 329 Protein (malate dehydrogenase); oxidoreductase; 1. 95.15
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 95.15
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 95.12
1iy8_A 267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 95.12
1xg5_A 279 ARPG836; short chain dehydrogenase, human, SGC, st 95.11
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 95.11
1hxh_A 253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 95.11
3u5t_A 267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 95.11
3hwr_A 318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 95.1
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 95.1
1oju_A 294 MDH, malate dehydrogenase; hyperthermophilic, oxid 95.1
3nep_X 314 Malate dehydrogenase; halophIle, molecular adpatat 95.1
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 95.09
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 95.09
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 95.09
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 95.09
2zat_A 260 Dehydrogenase/reductase SDR family member 4; alpha 95.09
3edm_A 259 Short chain dehydrogenase; structural genomics, ox 95.09
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 95.08
4hp8_A 247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 95.08
2dc1_A 236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 95.08
3ksu_A 262 3-oxoacyl-acyl carrier protein reductase; structur 95.07
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 95.07
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 95.05
4h31_A358 Otcase, ornithine carbamoyltransferase; structural 95.05
3uko_A 378 Alcohol dehydrogenase class-3; alcohol dehydrogena 95.05
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 95.05
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 95.04
1zmo_A 244 Halohydrin dehalogenase; haloalcohol dehalogenase, 95.03
1sby_A 254 Alcohol dehydrogenase; ternary complex, NAD, trifl 95.03
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 95.03
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 95.02
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 95.02
1y7t_A 327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 95.02
2x0j_A 294 Malate dehydrogenase; oxidoreductase, hyperthermop 95.01
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 95.01
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 95.01
3uog_A 363 Alcohol dehydrogenase; structural genomics, protei 95.0
3lyl_A 247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 95.0
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 95.0
3nyw_A 250 Putative oxidoreductase; fatty acid synthesis,3-ox 94.99
3l6e_A 235 Oxidoreductase, short-chain dehydrogenase/reducta; 94.99
1xq1_A 266 Putative tropinone reducatse; structural genomics, 94.99
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 94.98
1y6j_A 318 L-lactate dehydrogenase; southeast collaboratory f 94.98
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 94.97
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 94.95
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 94.95
3iup_A 379 Putative NADPH:quinone oxidoreductase; YP_296108.1 94.95
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 94.93
2gdz_A 267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 94.93
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 94.92
3ldh_A 330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 94.91
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 94.89
4e3z_A 272 Putative oxidoreductase protein; PSI-biology, stru 94.88
2uvd_A 246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 94.88
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 94.87
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 94.87
1mld_A 314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 94.86
1edo_A 244 Beta-keto acyl carrier protein reductase; nucleoti 94.85
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 94.85
2bma_A 470 Glutamate dehydrogenase (NADP+); malaria, drug des 94.85
4fcc_A 450 Glutamate dehydrogenase; protein complex, rossmann 94.85
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
Probab=100.00  E-value=3.7e-77  Score=533.32  Aligned_cols=222  Identities=41%  Similarity=0.723  Sum_probs=217.3

Q ss_pred             cchhhhcccHHHHHHHHHHHHHHHHHHHhcCCCCCeEEEEEECCCcccHHHHHHHHHHHHHcCCeeeeecCCCCCCHHHH
Q 027064            6 DQKATIIDGKAVAQTIRSEIAEEVRLLSEKYGKVPGLAVVIVGGRKDSQSYVSMKRKACAEVGIKSFDIDLPEQVSEAEL   85 (229)
Q Consensus         6 ~~~~~il~G~~la~~i~~~i~~~~~~l~~~~~~~P~LaiI~vg~~~~s~~Y~~~k~k~a~~~Gi~~~~~~l~~~~~~~el   85 (229)
                      ..||+|||||++|++|+++++++++.|+++.|++|+||+|+||+||+|..|+++|.|+|+++||+++.++||++++|+||
T Consensus        20 ~~Ma~ildGk~iA~~i~~~l~~~v~~l~~~~g~~P~LavIlVG~dpaS~~Yv~~K~k~c~~vGi~s~~~~lp~~~se~el   99 (303)
T 4b4u_A           20 GHMALVLDGRALAKQIEENLLVRVEALKAKTGRTPILATILVGDDGASATYVRMKGNACRRVGMDSLKIELPQETTTEQL   99 (303)
T ss_dssp             --CCEECCHHHHHHHHHHHHHHHHHHHHHHHSCCCEEEEEEESCCHHHHHHHHHHHHHHHHTTCEEEEEEECTTCCHHHH
T ss_pred             CCCCEEeehHHHHHHHHHHHHHHHHHHHHcCCCCCcEEEEEeCCCHHHHHHHHHHHHHHHHcCCeEEEEecCccCCHHHH
Confidence            35799999999999999999999999998889999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcCCCCCcEEEEeCCCCCCCCHHHHHhcCCccCcccccCccchhhhhccCCCCCcccCCHHHHHHHHHHhCCCC
Q 027064           86 ISKVHELNVMPDVHGILVQLPLPKHINEEKVLGEISLEKDVDGFHPLNIGKLAMKGRDPLFLPCTPKGCLELLKRSGVTI  165 (229)
Q Consensus        86 ~~~I~~lN~d~~v~GIlvq~Plp~~i~~~~i~~~I~p~KDVDg~~~~N~g~l~~~~~~~~~~PcTa~av~~lL~~~~~~l  165 (229)
                      ++.|++||+|++|||||||+|||+|+|+++++++|+|+|||||||+.|+|+|+.|  .+.|+||||.||++||++|++++
T Consensus       100 l~~I~~LN~D~~V~GIlVQlPLP~hid~~~i~~~I~p~KDVDG~hp~N~G~L~~g--~~~~~PcTp~gv~~lL~~~~i~l  177 (303)
T 4b4u_A          100 LAEIEKLNANPDVHGILLQHPVPAQIDERACFDAISLAKDVDGVTCLGFGRMAMG--EAAYGSATPAGIMTILKENNIEI  177 (303)
T ss_dssp             HHHHHHHHTCTTCCEEEECSSCCTTSCHHHHHHHSCGGGCTTCCCHHHHHHHHTT--CCCCCCHHHHHHHHHHHHTTCCC
T ss_pred             HHHHHHhcCCCCccEEEEeCCCccccChHHHHhccCcccccCccCcchHHHhcCC--CCcccCccHHHHHHHHHHHCCCC
Confidence            9999999999999999999999999999999999999999999999999999998  68999999999999999999999


Q ss_pred             CCCeEEEEccchhhhHHHHHHHhhCCCEEEEEcCCCCCHHhhhccCcEEEEecCCCCCCCCCCC
Q 027064          166 KGKRAVVVGRSNIVGLPVSLLLLKADATVTIVHSHTTDPESIVREADIVIAAAGQAMMVTMGIL  229 (229)
Q Consensus       166 ~gk~v~ViG~s~~VG~pla~~L~~~~atVtv~~~~t~~l~~~~~~aDivisA~g~p~~i~~~~v  229 (229)
                      +||+|+|||||++||||+|+||+++|||||+|||+|+|+.+++++|||||+|+|+|+||++|||
T Consensus       178 ~Gk~vvViGRS~iVGkPla~LL~~~~ATVTi~Hs~T~dl~~~~~~ADIvV~A~G~p~~i~~d~v  241 (303)
T 4b4u_A          178 AGKHAVVVGRSAILGKPMAMMLLQANATVTICHSRTQNLPELVKQADIIVGAVGKAELIQKDWI  241 (303)
T ss_dssp             TTCEEEEECCCTTTHHHHHHHHHHTTCEEEEECTTCSSHHHHHHTCSEEEECSCSTTCBCGGGS
T ss_pred             CCCEEEEEeccccccchHHHHHHhcCCEEEEecCCCCCHHHHhhcCCeEEeccCCCCccccccc
Confidence            9999999999999999999999999999999999999999999999999999999999999997



>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>4f2g_A Otcase 1, ornithine carbamoyltransferase 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... Back     alignment and structure
>3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis, ARGI biosynthesis; 2.10A {Gloeobacter violaceus} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} SCOP: c.78.1.1 c.78.1.1 PDB: 2be9_A* Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, thermus thermophil structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3sds_A Ornithine carbamoyltransferase, mitochondrial; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.80A {Coccidioides immitis} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3r7f_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, carbamoyl phosphate, transferas catalytic cycle; 2.10A {Bacillus subtilis} PDB: 3r7d_A 3r7l_A* 2at2_A Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>4ep1_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 3.25A {Bacillus anthracis} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>4a8t_A Putrescine carbamoyltransferase; trabnsferase PALO, delta-N-(phosphonoacetyl)-L- ornithine, agmatine deiminase route, agmatine catabolism; HET: PAO PGE; 1.59A {Enterococcus faecalis} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>4a8p_A Putrescine carbamoyltransferase; ornithine agmatine deiminase route; HET: PAO; 2.00A {Enterococcus faecalis} PDB: 4a8h_A* 3txx_A Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>4ekn_B Aspartate carbamoyltransferase; atcase, aspartate transcarbamoylase, pyrimidine biosynthesis thermostability, substrate channeling; 2.50A {Methanocaldococcus jannaschii} PDB: 3e2p_A 2rgw_A Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal-B pyrimidine biosynthesis, hydrolase-transferase; HET: FLC; 2.30A {Aquifex aeolicus} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>4amu_A Ornithine carbamoyltransferase, catabolic; ornithine transcarbamoylase, hydrolase; 2.50A {Mycoplasma penetrans} PDB: 4anf_A Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>1oth_A Protein (ornithine transcarbamoylase); transferase; HET: PAO; 1.85A {Homo sapiens} SCOP: c.78.1.1 c.78.1.1 PDB: 1ep9_A 1fvo_A 1c9y_A* 1fb5_A Back     alignment and structure
>1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3q98_A Transcarbamylase; rossmann fold, transferase; 2.00A {Escherichia coli} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>4h31_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PE5; 1.70A {Vibrio vulnificus} PDB: 3upd_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 229
d1edza2146 c.58.1.2 (A:3-148) Tetrahydrofolate dehydrogenase/ 6e-41
d1b0aa2121 c.58.1.2 (A:2-122) Tetrahydrofolate dehydrogenase/ 1e-34
d1a4ia2125 c.58.1.2 (A:2-126) Tetrahydrofolate dehydrogenase/ 1e-34
d1a4ia1170 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehy 3e-23
d1b0aa1166 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehy 1e-20
d1edza1171 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehy 2e-19
>d1edza2 c.58.1.2 (A:3-148) Tetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Aminoacid dehydrogenase-like, N-terminal domain
superfamily: Aminoacid dehydrogenase-like, N-terminal domain
family: Tetrahydrofolate dehydrogenase/cyclohydrolase
domain: Tetrahydrofolate dehydrogenase/cyclohydrolase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score =  135 bits (340), Expect = 6e-41
 Identities = 26/148 (17%), Positives = 55/148 (37%), Gaps = 6/148 (4%)

Query: 9   ATIIDGKAVAQTIRSEIAEEVRLLSEKY-GKVPGLAVVIVGGRKDSQSYVSMKRKACAEV 67
              I    VA+T  +EI   V    + + G+ P L   +      ++ Y +  +K    +
Sbjct: 3   GRTILASKVAETFNTEIINNVEEYKKTHNGQGPLLVGFLANNDPAAKMYATWTQKTSESM 62

Query: 68  GIKSFDIDLPEQVSEAELISKVHELNVMPDVHGILVQLPLPKHINEEKVLGEISLEKDVD 127
           G +     + ++     L   + + N    V+GI+V  P+  +  ++ +   +  EKDV+
Sbjct: 63  GFRYDLRVIEDKD---FLEEAIIQANGDDSVNGIMVYFPVFGNAQDQYLQQVVCKEKDVE 119

Query: 128 GFHPLNIGKLAMKGRDPLFLPCTPKGCL 155
           G + +    L                 +
Sbjct: 120 GLNHVYYQNLYH--NVRYLDKENRLKSI 145


>d1b0aa2 c.58.1.2 (A:2-122) Tetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d1a4ia2 c.58.1.2 (A:2-126) Tetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query229
d1edza2146 Tetrahydrofolate dehydrogenase/cyclohydrolase {Bak 100.0
d1b0aa2121 Tetrahydrofolate dehydrogenase/cyclohydrolase {Esc 100.0
d1a4ia2125 Tetrahydrofolate dehydrogenase/cyclohydrolase {Hum 100.0
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 100.0
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 100.0
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 99.93
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 99.07
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 98.88
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 98.85
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.6
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 98.44
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 98.43
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 98.35
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 98.29
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 98.27
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 98.1
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.89
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 97.72
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 97.69
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.68
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.65
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 97.6
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 97.57
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 97.57
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 97.51
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.45
d1hdoa_ 205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.44
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 97.38
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 97.37
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 97.34
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 97.3
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 97.29
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 97.24
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 97.22
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.14
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 97.13
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 97.12
d1mv8a2 202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 97.1
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 97.07
d1uzma1 237 beta-keto acyl carrier protein reductase {Mycobact 97.07
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 97.06
d1leha1 230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 97.04
d1cyda_ 242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 97.01
d1pr9a_ 244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 96.99
d2o23a1 248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 96.97
d1o5ia_ 234 beta-keto acyl carrier protein reductase {Thermoto 96.96
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.9
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 96.88
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 96.87
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.87
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 96.86
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 96.86
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 96.85
d2ag5a1 245 Dehydrogenase/reductase SDR family member 6, DHRS6 96.85
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 96.83
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 96.8
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 96.8
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 96.79
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 96.77
d1sbya1 254 Drosophila alcohol dehydrogenase {Fly (Drosophila 96.77
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 96.76
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 96.73
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.71
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 96.71
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 96.69
d2bkaa1 232 TAT-interacting protein TIP30 {Human (Homo sapiens 96.68
d1f0ya2 192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 96.67
d2d1ya1 248 Hypothetical protein TTHA0369 {Thermus thermophilu 96.67
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 96.67
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 96.66
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 96.66
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 96.65
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.63
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 96.62
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.62
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 96.62
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 96.6
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 96.58
d1vi2a2102 Putative shikimate dehydrogenase YdiB {Escherichia 96.58
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 96.57
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 96.57
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 96.57
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 96.56
d1nffa_ 244 Putative oxidoreductase Rv2002 {Mycobacterium tube 96.53
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 96.53
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 96.52
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.52
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 96.5
d2a4ka1 241 beta-keto acyl carrier protein reductase {Thermus 96.5
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 96.49
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 96.47
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 96.45
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 96.44
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 96.44
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 96.44
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 96.43
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 96.42
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 96.42
d1q7ba_ 243 beta-keto acyl carrier protein reductase {Escheric 96.41
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.41
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 96.39
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 96.38
d2ew8a1 247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 96.37
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 96.36
d1ulua_ 256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 96.32
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 96.31
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 96.31
d1wdka3 186 Fatty oxidation complex alpha subunit, middle doma 96.3
d1dhra_ 236 Dihydropteridin reductase (pteridine reductase) {R 96.29
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 96.26
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 96.24
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 96.23
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 96.22
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.18
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 96.17
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 96.16
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 96.14
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 96.14
d1nyta2101 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.13
d1v9la1 242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 96.12
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 96.1
d1npya2102 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 96.07
d1p77a2101 Shikimate 5-dehydrogenase AroE {Haemophilus influe 96.06
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 96.06
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 96.05
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 96.05
d1gtea4 196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 96.02
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 96.01
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 96.0
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.0
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 95.99
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 95.97
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 95.97
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 95.96
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 95.96
d1tuga1310 Aspartate carbamoyltransferase catalytic subunit { 95.96
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 95.94
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 95.93
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 95.89
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.88
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 95.87
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 95.85
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 95.85
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 95.83
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 95.82
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 95.81
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 95.77
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 95.71
d2h7ma1 268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 95.71
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 95.62
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 95.61
d2q46a1 252 Hypothetical protein At5g02240 (T7H20_290) {Thale 95.6
d2a35a1 212 Hypothetical protein PA4017 {Pseudomonas aeruginos 95.6
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 95.58
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 95.55
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 95.53
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.53
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 95.49
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 95.49
d1dlja2 196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 95.49
d1fcda1 186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 95.48
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 95.45
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 95.45
d1u7za_ 223 Coenzyme A biosynthesis bifunctional protein CoaBC 95.43
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 95.43
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 95.43
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 95.42
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 95.4
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 95.39
d1bgva1 255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 95.38
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 95.37
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 95.35
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 95.33
d1nvta2110 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 95.33
d1b26a1 234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 95.32
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 95.32
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 95.24
d1qsga_ 258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 95.22
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 95.17
d1gtma1 239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 95.06
d1uaya_ 241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 95.04
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 95.01
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 95.0
d1jaya_ 212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 94.98
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 94.96
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 94.96
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 94.93
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 94.87
d1pj3a1 294 Mitochondrial NAD(P)-dependent malic enzyme {Human 94.84
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 94.84
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 94.81
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 94.8
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 94.78
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 94.75
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 94.71
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 94.64
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 94.62
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.6
d1vl6a1 222 Malate oxidoreductase (malic enzyme) {Thermotoga m 94.59
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 94.56
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 94.56
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 94.45
d1fjha_ 257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 94.4
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.3
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 94.26
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 94.24
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 94.19
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 94.15
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 94.13
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 94.13
d1o0sa1 308 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 94.11
d1djqa3 233 Trimethylamine dehydrogenase, middle domain {Methy 94.1
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 94.07
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 94.07
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 94.06
d1gq2a1 298 Mitochondrial NAD(P)-dependent malic enzyme {Domes 93.99
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 93.97
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 93.87
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 93.84
d1ooea_ 235 Dihydropteridin reductase (pteridine reductase) {N 93.83
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 93.82
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 93.81
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 93.76
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 93.75
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 93.74
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 93.69
d1oaaa_ 259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 93.61
d1w4xa2 235 Phenylacetone monooxygenase {Thermobifida fusca [T 93.59
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 93.55
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 93.54
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 93.51
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 93.5
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 93.48
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 93.32
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 93.26
d1cjca2 230 Adrenodoxin reductase of mitochondrial p450 system 93.24
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 93.24
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 93.23
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 93.12
d1ml4a2157 Aspartate carbamoyltransferase catalytic subunit { 93.11
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 93.03
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 92.95
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 92.95
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 92.92
d1cjca1 225 Adrenodoxin reductase of mitochondrial p450 system 92.79
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 92.75
d1trba1 190 Thioredoxin reductase {Escherichia coli [TaxId: 56 92.64
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 92.54
d1lqta2 239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 92.4
d1dxha2185 Ornithine transcarbamoylase {Pseudomonas aeruginos 92.4
d1otha2170 Ornithine transcarbamoylase {Human (Homo sapiens) 92.35
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 92.34
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 92.33
d1pgja2 178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 92.33
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 92.33
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 92.28
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.26
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 92.06
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 92.01
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 92.0
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 91.98
d1q1ra1 185 Putidaredoxin reductase {Pseudomonas putida [TaxId 91.98
d2g17a1 179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 91.93
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 91.91
d1pg5a2153 Aspartate carbamoyltransferase catalytic subunit { 91.82
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 91.78
d2bd0a1 240 Bacterial sepiapterin reductase {Chlorobium tepidu 91.61
d1e7wa_ 284 Dihydropteridin reductase (pteridine reductase) {L 91.48
d1id1a_153 Rck domain from putative potassium channel Kch {Es 91.32
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 91.22
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 91.17
d2at2a2151 Aspartate carbamoyltransferase catalytic subunit { 91.05
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 91.04
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 90.98
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 90.81
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 90.79
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 90.71
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 90.69
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 90.6
d1jw9b_ 247 Molybdenum cofactor biosynthesis protein MoeB {Esc 90.55
d2gf3a1 281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 90.52
d1omoa_ 320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 90.45
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 90.16
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 90.09
d1zmta1 252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 89.92
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 89.83
d1duvg2183 Ornithine transcarbamoylase {Escherichia coli [Tax 89.7
d1vdca1 192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 89.56
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 89.54
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 89.51
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 89.3
d2i0za1 251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 89.27
d1yo6a1 250 Putative carbonyl reductase sniffer {Caenorhabditi 89.09
d1edoa_ 244 beta-keto acyl carrier protein reductase {Oil seed 89.05
d1mxha_ 266 Dihydropteridin reductase (pteridine reductase) {T 89.03
d1ekxa2160 Aspartate carbamoyltransferase catalytic subunit { 88.67
d2gqfa1 253 Hypothetical protein HI0933 {Haemophilus influenza 88.64
d1jtva_ 285 Human estrogenic 17beta-hydroxysteroid dehydrogena 88.53
d1dlja3108 UDP-glucose dehydrogenase (UDPGDH), C-terminal (UD 88.3
d1fl2a1 184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 88.28
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 88.24
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 88.19
d1kifa1 246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 88.16
d1y0pa2 308 Flavocytochrome c3 (respiratory fumarate reductase 87.95
d2h1qa1251 Hypothetical protein Dhaf_3308 {Desulfitobacterium 87.91
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 87.89
d1f4pa_147 Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} 87.84
d1x7da_ 340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 87.77
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 87.61
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 87.36
d1o4va_169 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 87.26
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 87.06
d1snya_ 248 Carbonyl reductase sniffer {Fruit fly (Drosophila 86.84
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 86.69
d1u11a_159 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 86.55
d1vmea1148 ROO-like flavoprotein TM0755, C-terminal domain {T 86.07
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 86.0
d1xhca1 167 NADH oxidase /nitrite reductase {Pyrococcus furios 85.63
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 85.61
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 85.48
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 85.23
d1gesa1 217 Glutathione reductase {Escherichia coli [TaxId: 56 85.0
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 84.94
d1v59a1 233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 84.31
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 84.19
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 84.08
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 83.38
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 82.92
d1h6va1 235 Mammalian thioredoxin reductase {Rat (Rattus norve 82.73
d1lvla1 220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 82.46
d1ebda1 223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 82.44
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 82.22
d1rp0a1 278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 82.21
d1dxla1 221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 82.17
d1ojta1 229 Dihydrolipoamide dehydrogenase {Neisseria meningit 82.05
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 81.89
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 81.44
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 81.35
d1nhpa1 198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 81.19
d1xmpa_155 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 80.86
d1qcza_163 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 80.72
d2fr1a1 259 Erythromycin synthase, eryAI, 1st ketoreductase mo 80.64
d1eq2a_ 307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 80.55
>d1edza2 c.58.1.2 (A:3-148) Tetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Aminoacid dehydrogenase-like, N-terminal domain
superfamily: Aminoacid dehydrogenase-like, N-terminal domain
family: Tetrahydrofolate dehydrogenase/cyclohydrolase
domain: Tetrahydrofolate dehydrogenase/cyclohydrolase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00  E-value=1.3e-45  Score=297.33  Aligned_cols=142  Identities=18%  Similarity=0.202  Sum_probs=133.6

Q ss_pred             hhhcccHHHHHHHHHHHHHHHHHHHhcC-CCCCeEEEEEECCCcccHHHHHHHHHHHHHcCCeeeeecCCCCCCHHHHHH
Q 027064            9 ATIIDGKAVAQTIRSEIAEEVRLLSEKY-GKVPGLAVVIVGGRKDSQSYVSMKRKACAEVGIKSFDIDLPEQVSEAELIS   87 (229)
Q Consensus         9 ~~il~G~~la~~i~~~i~~~~~~l~~~~-~~~P~LaiI~vg~~~~s~~Y~~~k~k~a~~~Gi~~~~~~l~~~~~~~el~~   87 (229)
                      +++|+|+++|++++++++++++.|+++. |++|+|++|+||+|++|.+|+++|.|+|+++||+++.   ++..+++++++
T Consensus         3 gkiidG~~iA~~i~~~l~~~v~~l~~~~~g~~P~Lavilvg~d~aS~~Yv~~k~k~a~~~Gi~~~l---~~~~~~~~l~~   79 (146)
T d1edza2           3 GRTILASKVAETFNTEIINNVEEYKKTHNGQGPLLVGFLANNDPAAKMYATWTQKTSESMGFRYDL---RVIEDKDFLEE   79 (146)
T ss_dssp             CEECCHHHHHHHHHHHHHHHHHHHHHHTTTCCCEEEEEECCCCHHHHHHHHHHHHHHHHHTCEEEE---EECSSGGGHHH
T ss_pred             CeeccHHHHHHHHHHHHHHHHHHHHHhcCCCCceEEEEEeCCCHHHHHHHHHHHHHHHHcCCcccc---CccchHHHHHH
Confidence            5689999999999999999999998764 7999999999999999999999999999999998764   45567899999


Q ss_pred             HHHHhcCCCCCcEEEEeCCCCCCCCHHHHHhcCCccCcccccCccchhhhhccCCCCCcccCCHHHHH
Q 027064           88 KVHELNVMPDVHGILVQLPLPKHINEEKVLGEISLEKDVDGFHPLNIGKLAMKGRDPLFLPCTPKGCL  155 (229)
Q Consensus        88 ~I~~lN~d~~v~GIlvq~Plp~~i~~~~i~~~I~p~KDVDg~~~~N~g~l~~~~~~~~~~PcTa~av~  155 (229)
                      .|++||+|++|||||||+|||+|+|+++++++|+|+|||||+|+.|+|+||.|  .+++.||||+||+
T Consensus        80 ~I~~LN~D~~V~GIlvQlPLP~~i~~~~i~~~I~p~KDVDGl~p~N~G~L~~~--~~~l~P~t~~~~i  145 (146)
T d1edza2          80 AIIQANGDDSVNGIMVYFPVFGNAQDQYLQQVVCKEKDVEGLNHVYYQNLYHN--VRYLDKENRLKSI  145 (146)
T ss_dssp             HHHHHHHCTTCCEEEECSCSSSSHHHHHHTTTSCTTTBTTCCSHHHHHHHHTT--CCBSSSSSCSBCC
T ss_pred             HHHHHhcchhhhhhhhcCCCCcccCHHHHHHhcCCCCCcCCCChHhHHHHHcC--CCCCCCCCccCcc
Confidence            99999999999999999999999999999999999999999999999999998  7889999998864



>d1b0aa2 c.58.1.2 (A:2-122) Tetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4ia2 c.58.1.2 (A:2-126) Tetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1vi2a2 c.58.1.5 (A:5-106) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1nyta2 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1npya2 c.58.1.5 (A:1-102) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p77a2 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1tuga1 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1nvta2 c.58.1.5 (A:1-110) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1otha2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2at2a2 c.78.1.1 (A:145-295) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dlja3 c.26.3.1 (A:295-402) UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2h1qa1 c.67.3.1 (A:1-251) Hypothetical protein Dhaf_3308 {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1f4pa_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Back     information, alignment and structure
>d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure