Citrus Sinensis ID: 027078
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 228 | ||||||
| 224072695 | 232 | predicted protein [Populus trichocarpa] | 0.991 | 0.974 | 0.844 | 1e-110 | |
| 224057561 | 232 | predicted protein [Populus trichocarpa] | 0.991 | 0.974 | 0.844 | 1e-109 | |
| 255572771 | 231 | Defective in cullin neddylation protein, | 0.991 | 0.978 | 0.831 | 1e-108 | |
| 225443086 | 231 | PREDICTED: DCN1-like protein 4 isoform 1 | 0.991 | 0.978 | 0.792 | 1e-106 | |
| 217074494 | 228 | unknown [Medicago truncatula] gi|3885005 | 0.986 | 0.986 | 0.765 | 1e-103 | |
| 238478498 | 227 | uncharacterized protein [Arabidopsis tha | 0.991 | 0.995 | 0.770 | 1e-101 | |
| 449468930 | 230 | PREDICTED: DCN1-like protein 4-like [Cuc | 0.991 | 0.982 | 0.786 | 1e-101 | |
| 388506842 | 231 | unknown [Lotus japonicus] | 0.991 | 0.978 | 0.774 | 1e-100 | |
| 359482420 | 212 | PREDICTED: DCN1-like protein 4 isoform 2 | 0.929 | 1.0 | 0.765 | 1e-100 | |
| 334182605 | 236 | uncharacterized protein [Arabidopsis tha | 0.991 | 0.957 | 0.741 | 2e-99 |
| >gi|224072695|ref|XP_002303837.1| predicted protein [Populus trichocarpa] gi|222841269|gb|EEE78816.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 404 bits (1037), Expect = e-110, Method: Compositional matrix adjust.
Identities = 196/232 (84%), Positives = 217/232 (93%), Gaps = 6/232 (2%)
Query: 3 MRRSVSRKTGQTNST------DATDLFRSASSKASSKEMERIDNLFYSYANKSSGMIDPE 56
MRRS S+KTGQ+NST ATDLFRS+SSKASSKEMERIDNLFYSYAN+SSGMIDPE
Sbjct: 1 MRRSASKKTGQSNSTTASITSSATDLFRSSSSKASSKEMERIDNLFYSYANRSSGMIDPE 60
Query: 57 GIESLCSDIEVSHTDVRILMLAWKMKAEKQGYFTLEEWRRGLKALRADTVNKLKKALPDL 116
GIE+LCSD+EV HTDVRILMLAWKM+AEKQGYFTLEEWR+GLK+LRADT+NKLKKALPDL
Sbjct: 61 GIETLCSDMEVDHTDVRILMLAWKMRAEKQGYFTLEEWRQGLKSLRADTLNKLKKALPDL 120
Query: 117 EKEVKRPTNFQDFYAFAFRYCLTEEKQKSVDIESVCELLGLVLGSQYRAQVDYLIEYLKI 176
EKEVKRP+NF DFY +AFRYCLTEEKQKS+DIES+C+LL LVLGS ++AQVDY IEYLKI
Sbjct: 121 EKEVKRPSNFVDFYNYAFRYCLTEEKQKSIDIESICQLLDLVLGSHFQAQVDYFIEYLKI 180
Query: 177 QSDYKVINMDQWMGFYRFCNEISFPDFNNYDPNLAWPLVLDNFVEWMKAKQT 228
QSDYKVINMDQWMGFYRFCNEISFPDF+NYDP LAWPL+LDNFVEWM+AK+T
Sbjct: 181 QSDYKVINMDQWMGFYRFCNEISFPDFSNYDPELAWPLILDNFVEWMRAKRT 232
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224057561|ref|XP_002299268.1| predicted protein [Populus trichocarpa] gi|222846526|gb|EEE84073.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255572771|ref|XP_002527318.1| Defective in cullin neddylation protein, putative [Ricinus communis] gi|223533318|gb|EEF35070.1| Defective in cullin neddylation protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225443086|ref|XP_002273365.1| PREDICTED: DCN1-like protein 4 isoform 1 [Vitis vinifera] gi|297743605|emb|CBI36472.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|217074494|gb|ACJ85607.1| unknown [Medicago truncatula] gi|388500562|gb|AFK38347.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|238478498|ref|NP_001154344.1| uncharacterized protein [Arabidopsis thaliana] gi|240254082|ref|NP_563983.4| uncharacterized protein [Arabidopsis thaliana] gi|32815875|gb|AAP88334.1| At1g15860 [Arabidopsis thaliana] gi|332191253|gb|AEE29374.1| uncharacterized protein [Arabidopsis thaliana] gi|332191254|gb|AEE29375.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449468930|ref|XP_004152174.1| PREDICTED: DCN1-like protein 4-like [Cucumis sativus] gi|449527597|ref|XP_004170796.1| PREDICTED: DCN1-like protein 4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|388506842|gb|AFK41487.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|359482420|ref|XP_003632772.1| PREDICTED: DCN1-like protein 4 isoform 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|334182605|ref|NP_001185006.1| uncharacterized protein [Arabidopsis thaliana] gi|332191255|gb|AEE29376.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 228 | ||||||
| DICTYBASE|DDB_G0284369 | 274 | DDB_G0284369 "DUF298 family pr | 0.820 | 0.682 | 0.405 | 4.9e-37 | |
| UNIPROTKB|B4DH25 | 336 | DCUN1D4 "cDNA FLJ55777, highly | 0.793 | 0.538 | 0.424 | 5.1e-35 | |
| UNIPROTKB|Q92564 | 292 | DCUN1D4 "DCN1-like protein 4" | 0.793 | 0.619 | 0.424 | 5.1e-35 | |
| MGI|MGI:2140972 | 292 | Dcun1d4 "DCN1, defective in cu | 0.793 | 0.619 | 0.430 | 5.1e-35 | |
| UNIPROTKB|Q9BTE7 | 237 | DCUN1D5 "DCN1-like protein 5" | 0.798 | 0.767 | 0.374 | 3.2e-33 | |
| MGI|MGI:1924113 | 237 | Dcun1d5 "DCN1, defective in cu | 0.798 | 0.767 | 0.374 | 4.1e-33 | |
| RGD|1307008 | 237 | Dcun1d5 "DCN1, defective in cu | 0.798 | 0.767 | 0.374 | 4.1e-33 | |
| UNIPROTKB|Q5RDF9 | 237 | DCUN1D5 "DCN1-like protein 5" | 0.798 | 0.767 | 0.368 | 1.8e-32 | |
| ZFIN|ZDB-GENE-040426-2603 | 249 | dcun1d5 "DCN1, defective in cu | 0.789 | 0.722 | 0.351 | 1.3e-29 | |
| UNIPROTKB|Q8IWE4 | 304 | DCUN1D3 "DCN1-like protein 3" | 0.899 | 0.674 | 0.336 | 1.2e-26 |
| DICTYBASE|DDB_G0284369 DDB_G0284369 "DUF298 family protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Score = 398 (145.2 bits), Expect = 4.9e-37, P = 4.9e-37
Identities = 77/190 (40%), Positives = 117/190 (61%)
Query: 36 ERIDNLFYSYANKS-SGMIDPEGIESLCSDIEVSHTDVRILMLAWKMKAEKQGYFTLEEW 94
+RI++ F Y ++ + +I P+GI LC D+ V DV +L+LAW + A++ GYF+ E+
Sbjct: 82 KRIEDFFDKYKDEDDNNVIGPDGITRLCKDLGVEPEDVVVLVLAWHLGAKQMGYFSKAEF 141
Query: 95 RRGLKALRADTVNKLKKALPDLEKEVKRPTNFQDFYAFAFRYCLTEEKQKSVDIESVCEL 154
+GL L D++ KL++ LP +K++ P NF+D Y FAF + E K +D+ES C +
Sbjct: 142 TQGLSKLNIDSLQKLQQHLPTFKKDLDNPNNFKDIYRFAFIFAKENENNKILDLESACSM 201
Query: 155 LGLVLGSQYRAQVDYLIEYLKIQSDYKVINMDQWMGFYRFCNEISFPDFNNYDPNLAWPL 214
L LVL +Y + L E+L Q YKV+NMDQW+ F I+ + +NYD N AWP+
Sbjct: 202 LQLVLADRY-PHTEKLQEFLMQQKSYKVLNMDQWLSILEFSKIIN-ANCSNYDENGAWPV 259
Query: 215 VLDNFVEWMK 224
+LD + EW K
Sbjct: 260 LLDEYSEWRK 269
|
|
| UNIPROTKB|B4DH25 DCUN1D4 "cDNA FLJ55777, highly similar to DCN1-like protein 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q92564 DCUN1D4 "DCN1-like protein 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2140972 Dcun1d4 "DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9BTE7 DCUN1D5 "DCN1-like protein 5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1924113 Dcun1d5 "DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1307008 Dcun1d5 "DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5RDF9 DCUN1D5 "DCN1-like protein 5" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2603 dcun1d5 "DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IWE4 DCUN1D3 "DCN1-like protein 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 228 | |||
| pfam03556 | 117 | pfam03556, Cullin_binding, Cullin binding | 1e-34 |
| >gnl|CDD|217613 pfam03556, Cullin_binding, Cullin binding | Back alignment and domain information |
|---|
Score = 119 bits (300), Expect = 1e-34
Identities = 48/119 (40%), Positives = 66/119 (55%), Gaps = 4/119 (3%)
Query: 107 NKLKKALPDLEKEVK-RPTNFQDFYAFAFRYCLTEEKQKSVDIESVCELLGLVLGSQYRA 165
KLK LP+L E+K P F+D Y F F + EE QKS+D+E+ E L+ GS+
Sbjct: 2 EKLKAKLPELRSELKSDPEKFKDLYRFTFDFAR-EEGQKSLDLETAIEYWKLLFGSRTFP 60
Query: 166 QVDYLIEYLKIQSDYKVINMDQWMGFYRFCNEISFPDFNNYDPNLAWPLVLDNFVEWMK 224
+D IE+L+ + K I+ D W F I D +NYD AWP ++D FVEW+K
Sbjct: 61 LLDQWIEFLE-EKHKKSISKDTWNMLLEFSKTID-EDLSNYDEEGAWPSLIDEFVEWLK 117
|
This domain binds to cullins and to Rbx-1, components of an E3 ubiquitin ligase complex for neddylation. Neddylation is the process by which the C-terminal glycine of the ubiquitin-like protein Nedd8 is covalently linked to lysine residues in a protein through an isopeptide bond. The structure of this domain is composed entirely of alpha helices. Length = 117 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 228 | |||
| KOG3077 | 260 | consensus Uncharacterized conserved protein [Funct | 100.0 | |
| PF03556 | 117 | Cullin_binding: Cullin binding; InterPro: IPR00517 | 100.0 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 94.9 | |
| cd05031 | 94 | S-100A10_like S-100A10_like: S-100A10 domain found | 94.13 | |
| PTZ00183 | 158 | centrin; Provisional | 94.11 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 93.96 | |
| PTZ00184 | 149 | calmodulin; Provisional | 93.81 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 93.8 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 93.39 | |
| KOG3077 | 260 | consensus Uncharacterized conserved protein [Funct | 93.25 | |
| cd05030 | 88 | calgranulins Calgranulins: S-100 domain found in p | 93.08 | |
| PTZ00183 | 158 | centrin; Provisional | 92.93 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 92.59 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 92.23 | |
| cd00213 | 88 | S-100 S-100: S-100 domain, which represents the la | 91.65 | |
| PTZ00184 | 149 | calmodulin; Provisional | 90.97 | |
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 89.91 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 89.8 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 88.88 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 88.08 | |
| KOG0036 | 463 | consensus Predicted mitochondrial carrier protein | 87.96 | |
| PF09279 | 83 | EF-hand_like: Phosphoinositide-specific phospholip | 84.7 | |
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 83.95 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 82.99 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 82.63 | |
| TIGR01446 | 73 | DnaD_dom DnaD and phage-associated domain. This mo | 82.17 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 81.93 | |
| KOG0028 | 172 | consensus Ca2+-binding protein (centrin/caltractin | 81.13 |
| >KOG3077 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.4e-65 Score=450.21 Aligned_cols=222 Identities=34% Similarity=0.625 Sum_probs=198.7
Q ss_pred CCcccccccCCCCCch--------h-hHHHhcCC------CCCChhhHHHHHHHHHHhcCCCC-CCCCHHHHHHHHHhhC
Q 027078 3 MRRSVSRKTGQTNSTD--------A-TDLFRSAS------SKASSKEMERIDNLFYSYANKSS-GMIDPEGIESLCSDIE 66 (228)
Q Consensus 3 ~~~~~~~~~~~~~~~~--------A-~d~y~~~~------~~~~~~~~~~l~~lFd~Y~d~~~-~~I~~dG~~~~~~DLg 66 (228)
|+-|++++..|.+.+- | .+.||.++ +.....+..+++++|.+|+|+++ +.|++|||.+||+|||
T Consensus 16 ~~~~~~~~~~s~~~~~~~dw~~~~~~~~s~~~~~~~~~~~~~~~~~s~~~l~~~f~~y~d~~d~~~i~~dgi~~fc~dlg 95 (260)
T KOG3077|consen 16 MSFTASRKKTSLSCLAACDWNLKYAFNDSYYTNPQSLREESVQARVSEKRLEELFNQYKDPDDDNLIGPDGIEKFCEDLG 95 (260)
T ss_pred cccccccchhhhhhhcccccccchhcccchhcchhHHHHhhhhccccHHHHHHHHHHhcCcccccccChHHHHHHHHHhC
Confidence 5667777755544222 5 34454443 22334678899999999999976 6999999999999999
Q ss_pred CCCCcHHHHHHHHhhcccccccccHHHHHHHhHHccCCcHHHHHHhhHHHHHHhCCcchhHHHHHhHhhhccCccccccc
Q 027078 67 VSHTDVRILMLAWKMKAEKQGYFTLEEWRRGLKALRADTVNKLKKALPDLEKEVKRPTNFQDFYAFAFRYCLTEEKQKSV 146 (228)
Q Consensus 67 v~~ed~~~LvLa~~l~a~~~g~itr~eF~~g~~~l~~dsi~~lk~~l~~l~~~l~d~~~Fk~~Y~f~F~f~~~~~~qk~L 146 (228)
|+|+|+++|||||+|+|++||+|||++|+.||.++||+|+++|++.|+.++..|+|++.|+++|+|||+|+++ +|||+|
T Consensus 96 ~~p~~i~~LvlAwkl~A~~m~~Fsr~ef~~g~~~l~~dS~d~lq~~l~~l~~~l~d~~~Fk~iY~faf~fa~e-~~qk~L 174 (260)
T KOG3077|consen 96 VEPEDISVLVLAWKLGAATMCEFSREEFLKGMTALGCDSIDKLQQRLDFLRSVLKDLEKFKSIYRFAFNFAKE-PGQKSL 174 (260)
T ss_pred CCchhHHHHHHHHHhccchhhhhhHHHHHHHHHHcCCCcHHHHHHHHHHHHHHHccHHHhhHHHHhhhhhccC-cCcCcC
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999995 899999
Q ss_pred cHHhHHHHHhhhhCCCChhhHHHHHHHHHhcCCCCcCChhhHHHHHHHHhhcCCCCCCCCCCCCCchhhHHHHHHHHHhh
Q 027078 147 DIESVCELLGLVLGSQYRAQVDYLIEYLKIQSDYKVINMDQWMGFYRFCNEISFPDFNNYDPNLAWPLVLDNFVEWMKAK 226 (228)
Q Consensus 147 ~~d~Ai~~W~lll~~~~~~~l~~W~~Fl~~~~~~k~IskD~W~~~l~F~~~v~~~dls~YDe~~AWP~liDeFVe~~r~~ 226 (228)
++++||.||.|||+.++| .++.|++||.+ .+++.|+||||||+|+|++++. +++|||||+||||+||||||||+|.+
T Consensus 175 d~~~ai~~w~ll~~~~~p-ll~~w~~FL~~-~~~~~~~KDtW~~~l~Fs~~i~-~dlSnYDeegAWP~liDeFVe~~r~~ 251 (260)
T KOG3077|consen 175 DLETAISLWKLLFGQTPP-LLDQWIQFLKD-SPNRAISKDTWNLLLDFSKTID-PDLSNYDEEGAWPVLIDEFVEYLRDK 251 (260)
T ss_pred CHHHHHHHHHHHhCCCCc-hHHHHHHHHHh-CcCcccCcccHHHHHHHHHhcC-ccccCccccccchHHHHHHHHHHHHh
Confidence 999999999999988875 99999999997 5789999999999999999986 99999999999999999999999998
Q ss_pred CC
Q 027078 227 QT 228 (228)
Q Consensus 227 ~~ 228 (228)
++
T Consensus 252 ~~ 253 (260)
T KOG3077|consen 252 QS 253 (260)
T ss_pred cc
Confidence 64
|
|
| >PF03556 Cullin_binding: Cullin binding; InterPro: IPR005176 The eukaryotic defective in cullin neddylation (DCN) protein family, may contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >KOG3077 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >TIGR01446 DnaD_dom DnaD and phage-associated domain | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 228 | ||||
| 3kev_A | 199 | X-Ray Crystal Structure Of A Dcun1 Domain-Containin | 6e-28 | ||
| 4gba_A | 221 | Dcnl Complex With N-terminally Acetylated Nedd8 E2 | 4e-26 | ||
| 3tdu_A | 200 | N-Terminal Acetylation Acts As An Avidity Enhancer | 1e-22 | ||
| 4gao_A | 200 | Dcnl Complex With N-terminally Acetylated Nedd8 E2 | 1e-21 |
| >pdb|3KEV|A Chain A, X-Ray Crystal Structure Of A Dcun1 Domain-Containing Protein From Galdieria Sulfuraria Length = 199 | Back alignment and structure |
|
| >pdb|4GBA|A Chain A, Dcnl Complex With N-terminally Acetylated Nedd8 E2 Peptide Length = 221 | Back alignment and structure |
| >pdb|3TDU|A Chain A, N-Terminal Acetylation Acts As An Avidity Enhancer Within An Interconnected Multiprotein Complex: Structure Of A Human Cul1whb- Dcn1p-Acetylated Ubc12n Complex Length = 200 | Back alignment and structure |
| >pdb|4GAO|A Chain A, Dcnl Complex With N-terminally Acetylated Nedd8 E2 Peptide Length = 200 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 228 | |||
| 3kev_A | 199 | Galieria sulfuraria DCUN1 domain-containing prote; | 2e-62 | |
| 3tdu_A | 200 | DCN1-like protein 1; E2:E3, ligase-protein binding | 2e-58 | |
| 3bq3_A | 270 | Defective in cullin neddylation protein 1; ubiquit | 2e-48 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-04 |
| >3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} Length = 199 | Back alignment and structure |
|---|
Score = 192 bits (490), Expect = 2e-62
Identities = 67/198 (33%), Positives = 112/198 (56%), Gaps = 5/198 (2%)
Query: 30 ASSKEMERIDNLFYSYANKSSGMIDPEGIESLCSDIEVSHTDVRILMLAWKMKAEKQGYF 89
+ + + I LF +Y I EG++ L DI+V +DV L+LAWK+KA F
Sbjct: 1 SKRADKKAILELFQTYKEPLGNYIGAEGLQRLFEDIQVDPSDVVTLVLAWKLKASSTCEF 60
Query: 90 TLEEWRRGLKALRADTVNKLKKALPDLEKEVKRPTNFQDFYAFAFRYCLTEEKQKSVDIE 149
+ +E+ GL L+ D++ KLK+ L L KE++ P+ F+ FY F F+Y E Q+S+ E
Sbjct: 61 SEKEFVEGLANLQVDSLEKLKRKLSSLRKEIEDPSKFRAFYQFVFQYSK-EPSQRSLPAE 119
Query: 150 SVCELLGLVLGSQYRAQVDYLIEYLKIQSDYKVINMDQWMGFYRFCNEISFPDFNNYDPN 209
+ L ++L ++ +D +E+L +++ I+ D W Y F D ++YD N
Sbjct: 120 TAMALWDVLLRGRFS-LLDSWLEFL--KNNTHSISRDTWNLLYDFSQLSE-KDLSDYDEN 175
Query: 210 LAWPLVLDNFVEWMKAKQ 227
AWP+++D+FV+W+K +Q
Sbjct: 176 GAWPVLIDDFVKWLKHEQ 193
|
| >3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A Length = 200 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 228 | |||
| 3kev_A | 199 | Galieria sulfuraria DCUN1 domain-containing prote; | 100.0 | |
| 3tdu_A | 200 | DCN1-like protein 1; E2:E3, ligase-protein binding | 100.0 | |
| 4gba_A | 221 | DCN1-like protein 3; E3 ligase, ligase-peptide com | 100.0 | |
| 3bq3_A | 270 | Defective in cullin neddylation protein 1; ubiquit | 100.0 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 97.08 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 97.01 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 96.85 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 96.72 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 96.65 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 96.64 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 96.64 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 96.57 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 96.56 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 96.56 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 96.53 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 96.5 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 96.5 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 96.44 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 96.39 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 96.34 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 96.34 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 96.32 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 96.21 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 96.18 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 96.08 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 96.08 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 96.05 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 96.03 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 96.03 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 96.01 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 95.93 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 95.92 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 95.77 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 95.71 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 95.64 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 95.6 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 95.56 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 95.55 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 95.51 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 95.43 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 95.37 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 95.37 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 95.36 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 95.35 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 95.34 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 95.32 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 95.3 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 95.25 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 95.24 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 95.24 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 95.23 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 95.22 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 95.2 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 95.18 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 95.16 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 95.15 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 95.01 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 95.0 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 95.0 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 95.0 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 94.99 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 94.94 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 94.94 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 94.84 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 94.79 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 94.76 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 94.7 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 94.65 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 94.65 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 94.63 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 94.59 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 94.59 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 94.56 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 94.5 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 94.47 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 94.39 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 94.36 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 94.32 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 94.26 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 94.22 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 94.21 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 94.15 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 94.12 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 94.12 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 94.11 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 94.01 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 93.98 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 93.93 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 93.92 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 93.89 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 93.85 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 93.84 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 93.81 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 93.8 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 93.79 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 93.74 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 93.66 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 93.62 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 93.6 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 93.56 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 93.56 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 93.55 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 93.53 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 93.51 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 93.49 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 93.49 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 93.44 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 93.44 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 93.42 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 93.38 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 93.36 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 93.36 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 93.35 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 93.3 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 93.29 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 93.16 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 93.15 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 93.09 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 93.07 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 93.06 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 93.06 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 93.05 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 92.96 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 92.93 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 92.92 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 92.87 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 92.85 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 92.79 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 92.74 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 92.68 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 92.66 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 92.65 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 92.55 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 92.53 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 92.44 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 92.42 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 92.41 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 92.32 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 92.32 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 92.3 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 92.29 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 92.27 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 92.23 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 92.14 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 92.12 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 92.06 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 91.94 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 91.9 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 91.84 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 91.8 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 91.8 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 91.71 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 91.69 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 91.49 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 91.47 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 91.4 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 91.04 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 90.94 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 90.88 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 90.81 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 90.78 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 90.73 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 90.68 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 90.46 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 90.36 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 90.25 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 90.23 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 90.22 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 90.17 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 90.17 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 90.09 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 89.89 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 89.87 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 89.85 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 89.8 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 89.8 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 89.67 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 89.59 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 89.4 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 89.02 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 88.85 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 88.81 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 88.76 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 88.73 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 88.59 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 88.54 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 88.47 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 88.01 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 87.79 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 87.75 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 87.01 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 86.86 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 86.78 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 86.77 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 86.58 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 86.43 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 86.3 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 86.26 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 85.97 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 85.87 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 85.86 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 85.85 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 85.64 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 85.61 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 85.52 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 85.51 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 85.37 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 85.25 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 84.87 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 84.79 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 84.43 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 84.09 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 83.64 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 83.49 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 83.35 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 83.16 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 83.13 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 82.9 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 82.83 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 82.81 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 82.62 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 82.34 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 81.99 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 81.9 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 81.41 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 81.39 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 81.23 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 80.86 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 80.76 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 80.46 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 80.23 |
| >3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.8e-75 Score=499.98 Aligned_cols=191 Identities=35% Similarity=0.676 Sum_probs=177.8
Q ss_pred hhhHHHHHHHHHHhcCCCCCCCCHHHHHHHHHhhCCCCCcHHHHHHHHhhcccccccccHHHHHHHhHHccCCcHHHHHH
Q 027078 32 SKEMERIDNLFYSYANKSSGMIDPEGIESLCSDIEVSHTDVRILMLAWKMKAEKQGYFTLEEWRRGLKALRADTVNKLKK 111 (228)
Q Consensus 32 ~~~~~~l~~lFd~Y~d~~~~~I~~dG~~~~~~DLgv~~ed~~~LvLa~~l~a~~~g~itr~eF~~g~~~l~~dsi~~lk~ 111 (228)
+.+.++|+++|++|++++++.||++|+++||+||||+|||+++|||||+|+|++||+|||+||++||+++||+|+++||+
T Consensus 3 ~~~~~~l~~lF~~Y~d~~~~~I~~dG~~~~~~DLgv~ped~~~LvLaw~l~a~~~g~ftr~ef~~G~~~l~~dsi~~lk~ 82 (199)
T 3kev_A 3 RADKKAILELFQTYKEPLGNYIGAEGLQRLFEDIQVDPSDVVTLVLAWKLKASSTCEFSEKEFVEGLANLQVDSLEKLKR 82 (199)
T ss_dssp -CCHHHHHHHHHHHCCTTSSEECHHHHHHHHHHTTCCTTSHHHHHHHHHTTCCSTTCEEHHHHHHHHHHTTCCSHHHHHH
T ss_pred ccCHHHHHHHHHHhcCCCcCccCHHHHHHHHHHcCCChhhHHHHHHHHHcCCCccCcccHHHHHHHHHHhCCCCHHHHHH
Confidence 35789999999999998767999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhHHHHHHhCCcchhHHHHHhHhhhccCccccccccHHhHHHHHhhhhCCCChhhHHHHHHHHHhcCCCCcCChhhHHHH
Q 027078 112 ALPDLEKEVKRPTNFQDFYAFAFRYCLTEEKQKSVDIESVCELLGLVLGSQYRAQVDYLIEYLKIQSDYKVINMDQWMGF 191 (228)
Q Consensus 112 ~l~~l~~~l~d~~~Fk~~Y~f~F~f~~~~~~qk~L~~d~Ai~~W~lll~~~~~~~l~~W~~Fl~~~~~~k~IskD~W~~~ 191 (228)
+|++|+++|+||.+||+||+|||+|+|+ +|||+|++|+||+||+|||+++|+ +++.|++||+++ + |+||||||+|+
T Consensus 83 ~l~~l~~~l~d~~~Fk~~Y~ftF~~~re-~gqk~L~~e~Ai~~W~lll~~~~~-~l~~W~~FL~~~-~-k~IskD~W~~~ 158 (199)
T 3kev_A 83 KLSSLRKEIEDPSKFRAFYQFVFQYSKE-PSQRSLPAETAMALWDVLLRGRFS-LLDSWLEFLKNN-T-HSISRDTWNLL 158 (199)
T ss_dssp HHHHHHHHTTSHHHHHHHHHHHHHHHSC-TTCSSBCHHHHHHHHHHHHTTTCT-THHHHHHHGGGC-C-SCBCHHHHHHH
T ss_pred HHHHHHHHccCHHHHHHHHHHHHHHHcC-cCcCCCCHHHHHHHHHHHhCCccH-HHHHHHHHHHhc-C-CCcCHHHHHHH
Confidence 9999999999999999999999999996 799999999999999999999995 999999999864 4 99999999999
Q ss_pred HHHHhhcCCCCCCCCCCCCCchhhHHHHHHHHHhhC
Q 027078 192 YRFCNEISFPDFNNYDPNLAWPLVLDNFVEWMKAKQ 227 (228)
Q Consensus 192 l~F~~~v~~~dls~YDe~~AWP~liDeFVe~~r~~~ 227 (228)
|+|+++++ +++++|||+||||+||||||||+|+++
T Consensus 159 l~F~~~i~-~dls~YDe~gAWP~liDeFVe~~r~~~ 193 (199)
T 3kev_A 159 YDFSQLSE-KDLSDYDENGAWPVLIDDFVKWLKHEQ 193 (199)
T ss_dssp HHHHTC---CTTTTCC---CCCHHHHHHHHHHTTC-
T ss_pred HHHHHHhc-ccccCCCCCCCchHHHHHHHHHHHHcC
Confidence 99999986 999999999999999999999999875
|
| >3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A* | Back alignment and structure |
|---|
| >4gba_A DCN1-like protein 3; E3 ligase, ligase-peptide complex; HET: AME; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 228 | |||
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 96.74 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 96.7 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 96.57 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 96.47 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 96.36 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 96.35 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 96.29 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 96.1 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 96.02 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 95.95 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 95.93 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 95.88 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 95.73 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 95.43 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 95.42 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 95.23 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 94.85 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 94.85 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 94.82 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 94.56 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 94.45 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 94.15 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 93.95 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 93.9 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 93.84 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 93.84 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 93.66 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 93.63 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 93.58 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 93.54 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 93.47 | |
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 93.4 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 93.28 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 93.14 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 92.76 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 92.54 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 92.41 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 92.35 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 92.31 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 92.29 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 92.21 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 92.08 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 91.73 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 91.56 | |
| d1k8ua_ | 89 | Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta | 91.46 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 91.33 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 91.27 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 91.04 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 90.99 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 90.97 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 90.9 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 90.87 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 90.81 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 90.64 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 90.38 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 90.33 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 90.32 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 89.95 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 89.83 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 89.73 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 89.56 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 89.46 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 89.38 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 89.26 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 89.18 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 89.15 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 88.74 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 88.56 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 88.21 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 86.63 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 86.13 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 85.42 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 85.23 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 84.6 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 84.53 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 83.87 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 83.21 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 82.29 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 80.7 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 80.27 |
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: EF Hand-like superfamily: EF-hand family: Polcalcin domain: Polcalcin Che a 3 species: Pigweed (Chenopodium album) [TaxId: 3559]
Probab=96.74 E-value=0.0047 Score=42.38 Aligned_cols=69 Identities=12% Similarity=0.287 Sum_probs=58.8
Q ss_pred hhhHHHHHHHHHHhcCCCCCCCCHHHHHHHHHhhCCCCCcHHHHHHHHhhcccccccccHHHHHHHhHHc
Q 027078 32 SKEMERIDNLFYSYANKSSGMIDPEGIESLCSDIEVSHTDVRILMLAWKMKAEKQGYFTLEEWRRGLKAL 101 (228)
Q Consensus 32 ~~~~~~l~~lFd~Y~d~~~~~I~~dG~~~~~~DLgv~~ed~~~LvLa~~l~a~~~g~itr~eF~~g~~~l 101 (228)
+...+.+.++|+.|=...++.|+.+-+.+.+..|| .|..-.+--+.-.+....-|.|+.+||+..|+..
T Consensus 2 ~ee~~e~~~~F~~~D~d~~G~I~~~El~~~l~~lg-~~~~~ei~~~~~~~D~d~~G~I~~~EF~~~~~~~ 70 (81)
T d2opoa1 2 PQDIADRERIFKRFDTNGDGKISSSELGDALKTLG-SVTPDEVRRMMAEIDTDGDGFISFDEFTDFARAN 70 (81)
T ss_dssp HHHHHHHHHHHHHHCTTCSSEEEHHHHHHHHHTTT-TCCHHHHHHHHHHHCTTCSSEECHHHHHHHHHHC
T ss_pred HHHHHHHHHHHHHHCCCCCCCCcHHHHHHHHHHhh-cCCHHHHHHHHHHhCCCCCCeEeHHHHHHHHHHC
Confidence 45678999999999766668999999999999999 5766677777778888889999999999987763
|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|