Citrus Sinensis ID: 027217

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------

MEGSANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSVCDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDEELQMNSSIFFPSFFR

ccccccccccccccccccccccccccEEcccccccccccccHHcccccccccccccccccccccEEEEcccccccccccccccccccccEEEccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccHHccccccccEEEEcccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHccccccccccc

cccccHHHHHccccccccHHccccEEEEccccccEEEccccccccccccccccHcccccHHHHHHHHHHHccccccccHHHcccccHHHHHHHHHcEccccccccccEccccccEEEcccccccEEccccccEEEEEEccccccEHccccccccccHHHHccccccEEEcccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHcccccHHcc

megsaneritfgkmgygckhyrrrcrirapccneifdcrhcHNEAAsmlrnpydrhelVRQDVKQVICSVCDTEQPVAQVCTncgvnmgeyfCDICKFYdddiekgqfhcddcgicriggrenyfhckrcgscystslrnnhlciensmhhhcpiCYEYLFDSlrnttvmkcghtmhcECYHemikrdkyccpicsksvidmSRTWKRIDEElqmnssiffpsffr

megsaneritfgkmgygckhyrRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSVCDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDEelqmnssiffpsffr

********ITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSVCDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDEELQMNSSIFF*****

***************YGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSVCDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNN***IENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDEELQMNSSIFFPS***

**********FGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPY*RHELVRQDVKQVICSVCDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDEELQMNSSIFFP****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		226	2.2.26 [Sep-21-2011]
Q9CR50		261	RING finger and CHY zinc	yes	no	0.867	0.750	0.419	2e-42
Q96PM5		261	RING finger and CHY zinc	yes	no	0.938	0.812	0.399	4e-42
O14099		425	Uncharacterized RING fing	yes	no	0.836	0.444	0.43	4e-40

>sp\|Q9CR50\|ZN363_MOUSE RING finger and CHY zinc finger domain-containing protein 1 OS=Mus musculus GN=Rchy1 PE=1 SV=1	Back alignment and function desciption

 Score =  172 bits (435), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 88/210 (41%), Positives = 127/210 (60%), Gaps = 14/210 (6%)

Query: 17  GCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSVCDTEQP 76
           GC+HY R C ++APCC++++ CR CH+          + H+L R  VK+V C  C+  Q 
Sbjct: 19  GCEHYDRACLLKAPCCDKLYTCRLCHDTN--------EDHQLDRFKVKEVQCINCEKLQH 70

Query: 77  VAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYST 136
             Q C +C    GEY+C IC  +D D  K Q+HC+ CGICRIG +E++FHC +C  C +T
Sbjct: 71  AQQTCEDCSTLFGEYYCSICHLFDKD--KRQYHCESCGICRIGPKEDFFHCLKCNLCLTT 128

Query: 137 SLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICS 196
           +LR  H CIEN    +CPIC E +  S     V+ CGH +H  CY EM+K + Y CP+C 
Sbjct: 129 NLRGKHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLK-EGYRCPLCM 187

Query: 197 KSVIDMSRTWKRIDEELQMNSSIFFPSFFR 226
            S +DM+R W+++D E+   +    PS ++
Sbjct: 188 HSALDMTRYWRQLDTEV---AQTPMPSEYQ 214

Mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including p53/TP53, HDAC1 and CDKN1B. Preferentially acts on tetrameric p53/TP53. Increases AR transcription factor activity (By similarity). Contributes to the regulation of CDKN1B and p53/TP53 levels, and thereby contributes to the regulation of the cell cycle progression.
Mus musculus (taxid: 10090)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -

>sp\|Q96PM5\|ZN363_HUMAN RING finger and CHY zinc finger domain-containing protein 1 OS=Homo sapiens GN=RCHY1 PE=1 SV=1	Back alignment and function description

>sp\|O14099\|YERG_SCHPO Uncharacterized RING finger protein C2F3.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2F3.16 PE=4 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		226
359806446		267	uncharacterized protein LOC100792038 [Gl	0.986	0.835	0.800	1e-106
357447417		267	RING finger and CHY zinc finger domain-c	0.986	0.835	0.796	1e-105
358248192		267	uncharacterized protein LOC100812839 [Gl	0.986	0.835	0.796	1e-105
388519059		267	unknown [Medicago truncatula]	0.986	0.835	0.792	1e-105
225432370		267	PREDICTED: RING finger and CHY zinc fing	0.955	0.808	0.824	1e-105
356555553		267	PREDICTED: RING finger and CHY zinc fing	0.986	0.835	0.792	1e-104
297807887		267	zinc finger family protein [Arabidopsis	0.986	0.835	0.778	1e-104
15238890		267	ring finger and CHY zinc finger domain-c	0.986	0.835	0.778	1e-103
388496792		267	unknown [Lotus japonicus]	0.986	0.835	0.778	1e-102
372477771		267	zinc-finger protein [Malus x domestica]	0.986	0.835	0.783	1e-102

>gi\|359806446\|ref\|NP_001241502.1\| uncharacterized protein LOC100792038 [Glycine max] gi\|255646865\|gb\|ACU23903.1\| unknown [Glycine max]	Back alignment and taxonomy information

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 181/226 (80%), Positives = 205/226 (90%), Gaps = 3/226 (1%)

Query: 1   MEGSANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVR 60
           MEGS NER+ FGKMGYGC HYRRRCRIRAPCCNEI+ CRHCHN+AAS+L+NP+DRHELVR
Sbjct: 1   MEGSVNERLDFGKMGYGCNHYRRRCRIRAPCCNEIYSCRHCHNDAASLLKNPFDRHELVR 60

Query: 61  QDVKQVICSVCDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGG 120
           QDVKQV+CSVCDTEQPVAQVCTNCGV MGEYFC+ICKF+DDD+EK QFHCDDCGICR+GG
Sbjct: 61  QDVKQVVCSVCDTEQPVAQVCTNCGVKMGEYFCNICKFFDDDVEKEQFHCDDCGICRVGG 120

Query: 121 RENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCEC 180
           R+N+FHCK+CGSCY+  LR+NHLC+ENSM HHCPICYEYLFDSL++T VMKCGHTMH EC
Sbjct: 121 RDNFFHCKKCGSCYAIGLRDNHLCVENSMRHHCPICYEYLFDSLKDTIVMKCGHTMHHEC 180

Query: 181 YHEMIKRDKYCCPICSKSVIDMSRTWKRIDEELQMNSSIFFPSFFR 226
           Y EMIK DKYCCPICSKSVIDMS+TWKRIDEE++   +   P  +R
Sbjct: 181 YVEMIKNDKYCCPICSKSVIDMSKTWKRIDEEIE---ATVMPEDYR 223

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|357447417\|ref\|XP_003593984.1\| RING finger and CHY zinc finger domain-containing protein [Medicago truncatula] gi\|355483032\|gb\|AES64235.1\| RING finger and CHY zinc finger domain-containing protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|358248192\|ref\|NP_001239836.1\| uncharacterized protein LOC100812839 [Glycine max] gi\|255636475\|gb\|ACU18576.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|388519059\|gb\|AFK47591.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

>gi\|225432370\|ref\|XP_002276039.1\| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 [Vitis vinifera] gi\|297736904\|emb\|CBI26105.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356555553\|ref\|XP_003546095.1\| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|297807887\|ref\|XP_002871827.1\| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi\|297317664\|gb\|EFH48086.1\| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|15238890\|ref\|NP_197366.1\| ring finger and CHY zinc finger domain-containing protein 1 [Arabidopsis thaliana] gi\|17381208\|gb\|AAL36416.1\| unknown protein [Arabidopsis thaliana] gi\|20465813\|gb\|AAM20011.1\| unknown protein [Arabidopsis thaliana] gi\|332005211\|gb\|AED92594.1\| ring finger and CHY zinc finger domain-containing protein 1 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|388496792\|gb\|AFK36462.1\| unknown [Lotus japonicus]	Back alignment and taxonomy information

>gi\|372477771\|gb\|AEX97080.1\| zinc-finger protein [Malus x domestica]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		226
TAIR\|locus:2180074		267	MIEL1 "MYB30-Interacting E3 Li	0.986	0.835	0.778	1.1e-108
TAIR\|locus:2099212		287	AT3G62970 [Arabidopsis thalian	0.898	0.707	0.655	3.8e-85
TAIR\|locus:2172656		291	AT5G22920 [Arabidopsis thalian	0.893	0.694	0.620	4.2e-79
TAIR\|locus:2179474		328	AT5G25560 [Arabidopsis thalian	0.938	0.646	0.572	2.5e-74
DICTYBASE\|DDB_G0281595		342	rchy "RING finger and CHY zinc	0.818	0.540	0.461	5.8e-50
ZFIN\|ZDB-GENE-040801-73		264	rchy1 "ring finger and CHY zin	0.827	0.708	0.426	2.5e-49
UNIPROTKB\|Q96PM5		261	RCHY1 "RING finger and CHY zin	0.823	0.712	0.441	1.1e-48
MGI\|MGI:1915348		261	Rchy1 "ring finger and CHY zin	0.823	0.712	0.441	1.4e-48
UNIPROTKB\|A4IFE2		261	RCHY1 "RCHY1 protein" [Bos tau	0.823	0.712	0.431	2.9e-48
RGD\|1359180		261	Rchy1 "ring finger and CHY zin	0.823	0.712	0.431	4.7e-48

TAIR\|locus:2180074 MIEL1 "MYB30-Interacting E3 Ligase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1074 (383.1 bits), Expect = 1.1e-108, P = 1.1e-108
 Identities = 176/226 (77%), Positives = 202/226 (89%)

Query:     1 MEGSANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVR 60
             ME S N+R+ FGKMG+GCKHY+RRC+IRAPCCNE+FDCRHCHNE+ S LRN YDRH+LVR
Sbjct:     1 MEASPNDRLHFGKMGFGCKHYKRRCQIRAPCCNEVFDCRHCHNESTSTLRNIYDRHDLVR 60

Query:    61 QDVKQVICSVCDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGG 120
             QDVKQVICSVCDTEQP AQVC+NCGVNMGEYFC IC FYDDD EK QFHCDDCGICR+GG
Sbjct:    61 QDVKQVICSVCDTEQPAAQVCSNCGVNMGEYFCSICIFYDDDTEKQQFHCDDCGICRVGG 120

Query:   121 RENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCEC 180
             REN+FHCK+CGSCY+  LRNNH C+ENSM HHCPICYEYLFDSL++T VMKCGHTMH EC
Sbjct:   121 RENFFHCKKCGSCYAVGLRNNHRCVENSMRHHCPICYEYLFDSLKDTNVMKCGHTMHVEC 180

Query:   181 YHEMIKRDKYCCPICSKSVIDMSRTWKRIDEELQMNSSIFFPSFFR 226
             Y+EMIKRDK+CCPICS+SVIDMS+TW+R+DEE++  +    PS +R
Sbjct:   181 YNEMIKRDKFCCPICSRSVIDMSKTWQRLDEEIEATA---MPSDYR 223

GO:0005634 "nucleus" evidence=ISM

GO:0008270 "zinc ion binding" evidence=IEA;ISS

TAIR\|locus:2099212 AT3G62970 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2172656 AT5G22920 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2179474 AT5G25560 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0281595 rchy "RING finger and CHY zinc finger-containing protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040801-73 rchy1 "ring finger and CHY zinc finger domain containing 1" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|Q96PM5 RCHY1 "RING finger and CHY zinc finger domain-containing protein 1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

MGI\|MGI:1915348 Rchy1 "ring finger and CHY zinc finger domain containing 1" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|A4IFE2 RCHY1 "RCHY1 protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

RGD\|1359180 Rchy1 "ring finger and CHY zinc finger domain containing 1, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q96PM5	ZN363_HUMAN	6, ., 3, ., 2, ., -	0.3991	0.9380	0.8122	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00019811001	SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (267 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		226
pfam05495		74	pfam05495, zf-CHY, CHY zinc finger	4e-20
cd00162		45	cd00162, RING, RING-finger (Really Interesting New	5e-04
smart00184		40	smart00184, RING, Ring finger	0.001
COG1198		730	COG1198, PriA, Primosomal protein N' (replication	0.002

>gnl\|CDD\|218608 pfam05495, zf-CHY, CHY zinc finger	Back alignment and domain information

 Score = 80.4 bits (199), Expect = 4e-20
 Identities = 40/84 (47%), Positives = 49/84 (58%), Gaps = 11/84 (13%)

Query: 18  CKHYRRR-CRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSVCDTEQP 76
           CKHY R  C IRAPCCN+ + CR CH+E           H L R +VK V+C VC TEQ 
Sbjct: 1   CKHYHRNLCAIRAPCCNKYYPCRLCHDELED--------HPLDRWNVKAVLCGVCRTEQT 52

Query: 77  VAQVCTNCGVNMGEYFCDICKFYD 100
           V +   NCGV   +Y+C ICK + 
Sbjct: 53  VQE--YNCGVEFADYYCPICKLFF 74

This family of domains are likely to bind to zinc ions. They contain many conserved cysteine and histidine residues. We have named this domain after the N-terminal motif CXHY. This domain can be found in isolation in some proteins, but is also often associated with pfam00097. One of the proteins in this family is a mitochondrial intermembrane space protein called Hot13. This protein is involved in the assembly of small TIM complexes. Length = 74

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>gnl\|CDD\|214546 smart00184, RING, Ring finger	Back alignment and domain information

>gnl\|CDD\|224119 COG1198, PriA, Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		226
KOG1940		276	consensus Zn-finger protein [General function pred	100.0
PF05495		71	zf-CHY: CHY zinc finger; InterPro: IPR008913 Zinc	99.9
COG4357		105	Zinc finger domain containing protein (CHY type) [	99.71
PF13639		44	zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C	99.45
PF12678		73	zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766	99.11
COG5243		491	HRD1 HRD ubiquitin ligase complex, ER membrane com	99.06
cd00162		45	RING RING-finger (Really Interesting New Gene) dom	99.05
KOG4628		348	consensus Predicted E3 ubiquitin ligase [Posttrans	98.97
PF13923		39	zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger);	98.93
PHA02929		238	N1R/p28-like protein; Provisional	98.89
PF13920		50	zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger);	98.81
PF00097		41	zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I	98.78
smart00184		39	RING Ring finger. E3 ubiquitin-protein ligase acti	98.77
COG5540		374	RING-finger-containing ubiquitin ligase [Posttrans	98.69
PF14634		44	zf-RING_5: zinc-RING finger domain	98.67
PF15227		42	zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB:	98.54
PF13445		43	zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A.	98.5
PF12861		85	zf-Apc11: Anaphase-promoting complex subunit 11 RI	98.5
KOG0802		543	consensus E3 ubiquitin ligase [Posttranslational m	98.46
PLN03208		193	E3 ubiquitin-protein ligase RMA2; Provisional	98.39
PHA02926		242	zinc finger-like protein; Provisional	98.37
KOG0320		187	consensus Predicted E3 ubiquitin ligase [Posttrans	98.19
smart00504		63	Ubox Modified RING finger domain. Modified RING fi	98.11
smart00744		49	RINGv The RING-variant domain is a C4HC3 zinc-fing	98.07
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	98.04
PF11793		70	FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A.	97.96
TIGR00599		397	rad18 DNA repair protein rad18. This family is bas	97.91
COG5194		88	APC11 Component of SCF ubiquitin ligase and anapha	97.85
PF14599		61	zinc_ribbon_6: Zinc-ribbon; PDB: 2K2D_A.	97.85
KOG0317		293	consensus Predicted E3 ubiquitin ligase, integral	97.71
KOG0827		465	consensus Predicted E3 ubiquitin ligase [Posttrans	97.68
TIGR00570		309	cdk7 CDK-activating kinase assembly factor MAT1. A	97.67
KOG2177		386	consensus Predicted E3 ubiquitin ligase [Posttrans	97.67
KOG0828		636	consensus Predicted E3 ubiquitin ligase [Posttrans	97.55
KOG2164		513	consensus Predicted E3 ubiquitin ligase [Posttrans	97.41
KOG0823		230	consensus Predicted E3 ubiquitin ligase [Posttrans	97.41
KOG1734		328	consensus Predicted RING-containing E3 ubiquitin l	97.27
PF14835		65	zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM	97.26
KOG0287		442	consensus Postreplication repair protein RAD18 [Re	97.2
PF04564		73	U-box: U-box domain; InterPro: IPR003613 Quality c	97.18
KOG1493		84	consensus Anaphase-promoting complex (APC), subuni	97.04
KOG1941		518	consensus Acetylcholine receptor-associated protei	97.0
KOG4265		349	consensus Predicted E3 ubiquitin ligase [Posttrans	96.81
COG5574		271	PEX10 RING-finger-containing E3 ubiquitin ligase [	96.73
PF14570		48	zf-RING_4: RING/Ubox like zinc-binding domain; PDB	96.51
KOG2930		114	consensus SCF ubiquitin ligase, Rbx1 component [Po	96.44
KOG0825		1134	consensus PHD Zn-finger protein [General function	96.43
COG5219		1525	Uncharacterized conserved protein, contains RING Z	96.41
KOG0311		381	consensus Predicted E3 ubiquitin ligase [Posttrans	96.27
KOG4172		62	consensus Predicted E3 ubiquitin ligase [Posttrans	96.26
PF11789		57	zf-Nse: Zinc-finger of the MIZ type in Nse subunit	96.26
KOG3002		299	consensus Zn finger protein [General function pred	96.18
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	96.15
KOG1785		563	consensus Tyrosine kinase negative regulator CBL [	95.99
KOG1428		3738	consensus Inhibitor of type V adenylyl cyclases/Ne	95.96
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	95.93
PF10367		109	Vps39_2: Vacuolar sorting protein 39 domain 2; Int	95.87
PRK14890		59	putative Zn-ribbon RNA-binding protein; Provisiona	95.58
PF12906		47	RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A.	95.5
KOG1039		344	consensus Predicted E3 ubiquitin ligase [Posttrans	95.31
KOG3970		299	consensus Predicted E3 ubiquitin ligase [Posttrans	95.15
KOG1571		355	consensus Predicted E3 ubiquitin ligase [Posttrans	94.85
COG5432		391	RAD18 RING-finger-containing E3 ubiquitin ligase [	94.57
KOG2879		298	consensus Predicted E3 ubiquitin ligase [Posttrans	94.55
PF14447		55	Prok-RING_4: Prokaryotic RING finger family 4	94.45
PF05883		134	Baculo_RING: Baculovirus U-box/Ring-like domain; I	94.37
KOG4275		350	consensus Predicted E3 ubiquitin ligase [Posttrans	94.07
KOG3800		300	consensus Predicted E3 ubiquitin ligase containing	93.67
KOG3268		234	consensus Predicted E3 ubiquitin ligase [Posttrans	93.41
KOG0824		324	consensus Predicted E3 ubiquitin ligase [Posttrans	93.29
KOG4185		296	consensus Predicted E3 ubiquitin ligase [Posttrans	93.0
KOG4739		233	consensus Uncharacterized protein involved in syna	92.98
KOG4159		398	consensus Predicted E3 ubiquitin ligase [Posttrans	92.77
PF12773		50	DZR: Double zinc ribbon	92.64
KOG2660		331	consensus Locus-specific chromosome binding protei	92.57
COG2888		61	Predicted Zn-ribbon RNA-binding protein with a fun	92.4
KOG0297		391	consensus TNF receptor-associated factor [Signal t	91.73
PF04641		260	Rtf2: Rtf2 RING-finger	91.14
KOG0309		1081	consensus Conserved WD40 repeat-containing protein	90.65
KOG1814		445	consensus Predicted E3 ubiquitin ligase [Posttrans	90.63
PF07800		162	DUF1644: Protein of unknown function (DUF1644); In	90.42
PHA02862		156	5L protein; Provisional	90.18
PF07191		70	zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807	90.17
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	90.14
COG5175		480	MOT2 Transcriptional repressor [Transcription]	89.73
KOG1002		791	consensus Nucleotide excision repair protein RAD16	89.48
KOG4445		368	consensus Uncharacterized conserved protein, conta	89.3
KOG3161		861	consensus Predicted E3 ubiquitin ligase [Posttrans	88.85
KOG3039		303	consensus Uncharacterized conserved protein [Funct	88.46
PF13248		26	zf-ribbon_3: zinc-ribbon domain	87.67
KOG2817		394	consensus Predicted E3 ubiquitin ligase [Posttrans	87.6
PHA02825		162	LAP/PHD finger-like protein; Provisional	87.36
COG5236		493	Uncharacterized conserved protein, contains RING Z	86.81
KOG2034		911	consensus Vacuolar sorting protein PEP3/VPS18 [Int	86.38
KOG1952		950	consensus Transcription factor NF-X1, contains NFX	86.38
PF03854		50	zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc	86.17
KOG1813		313	consensus Predicted E3 ubiquitin ligase [Posttrans	85.93
KOG4692		489	consensus Predicted E3 ubiquitin ligase [Posttrans	85.53
PRK04023		1121	DNA polymerase II large subunit; Validated	85.43
COG5152		259	Uncharacterized conserved protein, contains RING a	85.36
smart00734		26	ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18	85.17
PF10571		26	UPF0547: Uncharacterised protein family UPF0547; I	84.94
PF09538		108	FYDLN_acid: Protein of unknown function (FYDLN_aci	84.78
PF13240		23	zinc_ribbon_2: zinc-ribbon domain	84.73
PF02891		50	zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041	83.42
PRK14559		645	putative protein serine/threonine phosphatase; Pro	82.94
PF07191		70	zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807	82.15
PHA00626		59	hypothetical protein	81.9
PF13894		24	zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP	80.93
PF14446		54	Prok-RING_1: Prokaryotic RING finger family 1	80.76
PF08746		43	zf-RING-like: RING-like domain; InterPro: IPR01485	80.26
smart00132		39	LIM Zinc-binding domain present in Lin-11, Isl-1,	80.01

>KOG1940 consensus Zn-finger protein [General function prediction only]	Back alignment and domain information

Probab=100.00  E-value=1.4e-56  Score=400.64  Aligned_cols=205  Identities=49%  Similarity=1.043  Sum_probs=198.3

Q ss_pred             ccccccCCCCccCcccccccceeecCCCCCcccChhhHHhhhcCCCCCCCCccccccccceeEeCCCCccccccccCCCC
Q 027217            5 ANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSVCDTEQPVAQVCTNC   84 (226)
Q Consensus         5 ~~~~~~~~~~~~gC~HY~r~c~l~~pCC~~~y~Cr~CHde~~~h~~~~~~~H~~~r~~~~~v~Cg~C~~~q~v~~~C~~C   84 (226)
                      .+++.|++.++.+|+||+|++++++|+|+++|.|++||+++.        +|.++|+.+.+|+|+.|+++|++++.|.+|
T Consensus        22 ~~~~~d~~~~~~~c~hy~r~~~~~a~ccd~~~~C~hCH~~s~--------~h~~~r~~v~~~~C~~C~~~q~~~~~c~~c   93 (276)
T KOG1940|consen   22 HSDAEDEIAFPYGCPHYRRNCKSRAPCCDREITCRHCHNESE--------DHDLDRKTVYELLCMKCRKIQPVGQICSNC   93 (276)
T ss_pred             ccccccccccccCCchhhhccccccccccceeeeEEecChhh--------hcccchhhhhhhhhhhHHhhhhhhhccccc
Confidence            456789999999999999999999999999999999999984        699999999999999999999999999999


Q ss_pred             CCCcceeecCccccccCCCCCCeeccCCCCcceeCCccceeeccccCccccccccCcceeecCCCCCCCccchhhcccCC
Q 027217           85 GVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSL  164 (226)
Q Consensus        85 g~~f~~Y~C~~C~l~dd~~~k~~yHC~~CgiCR~G~~~~~fHC~~C~~C~s~~l~~~H~C~e~~~~~~CpICle~lf~s~  164 (226)
                      +..+++|||++|+||||+++ +||||+.|||||+|++++||||++|+.|++..+.+.|+|+|++++.|||||.|+||++.
T Consensus        94 ~~~~g~~~c~~C~l~dd~~~-~~~hC~~C~icr~g~~~~~fhc~~c~~c~~~~~~~~H~c~e~~~~~ncPic~e~l~~s~  172 (276)
T KOG1940|consen   94 HVELGEYYCLICKLFDDDPS-KQYHCDLCGICREGLGLDFFHCKKCKACLSAYLSNWHKCVERSSEFNCPICKEYLFLSF  172 (276)
T ss_pred             hhhhhhhcCccccccccccc-ceeccccccccccccccchhHHhhhHhHHhhhcccccchhhhcccCCCchhHHHhcccc
Confidence            99999999999999999999 99999999999999999999999999999999999999999999999999999999999


Q ss_pred             cceeeeccCCccCHHHHHHHHhcCcCCCCCCCeecccchHHHHHHHHHHHhCCCCC
Q 027217          165 RNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDEELQMNSSIF  220 (226)
Q Consensus       165 ~~v~~LpCGH~~H~~C~~~~l~~~~~~CPiCrksi~dm~~~~~~lD~~i~~~pm~~  220 (226)
                      ..+.+|+|||.+|..||++++..+ |+||+|.| +.||+.+|+++|.+|+++|||.
T Consensus       173 ~~~~~~~CgH~~h~~cf~e~~~~~-y~CP~C~~-~~d~~~~~~~~d~~l~~~~~p~  226 (276)
T KOG1940|consen  173 EDAGVLKCGHYMHSRCFEEMICEG-YTCPICSK-PGDMSHYFRKLDKELAGSPMPE  226 (276)
T ss_pred             ccCCccCcccchHHHHHHHHhccC-CCCCcccc-hHHHHHHHHHHHHHHhcCCCCc
Confidence            999999999999999999999875 99999999 9999999999999999999973

>PF05495 zf-CHY: CHY zinc finger; InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown]	Back alignment and domain information

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A	Back alignment and domain information

>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A	Back alignment and domain information

>PHA02929 N1R/p28-like protein; Provisional	Back alignment and domain information

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A	Back alignment and domain information

>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>smart00184 RING Ring finger	Back alignment and domain information

>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14634 zf-RING_5: zinc-RING finger domain	Back alignment and domain information

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A	Back alignment and domain information

>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A	Back alignment and domain information

>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger	Back alignment and domain information

>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

>PHA02926 zinc finger-like protein; Provisional	Back alignment and domain information

>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00504 Ubox Modified RING finger domain	Back alignment and domain information

>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A	Back alignment and domain information

>TIGR00599 rad18 DNA repair protein rad18	Back alignment and domain information

>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning]	Back alignment and domain information

>PF14599 zinc_ribbon_6: Zinc-ribbon; PDB: 2K2D_A	Back alignment and domain information

>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1	Back alignment and domain information

>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B	Back alignment and domain information

>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair]	Back alignment and domain information

>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis	Back alignment and domain information

>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures]	Back alignment and domain information

>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B	Back alignment and domain information

>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0825 consensus PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C	Back alignment and domain information

>KOG3002 consensus Zn finger protein [General function prediction only]	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms]	Back alignment and domain information

>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1	Back alignment and domain information

>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional	Back alignment and domain information

>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A	Back alignment and domain information

>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]	Back alignment and domain information

>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14447 Prok-RING_4: Prokaryotic RING finger family 4	Back alignment and domain information

>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length	Back alignment and domain information

>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12773 DZR: Double zinc ribbon	Back alignment and domain information

>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown]	Back alignment and domain information

>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms]	Back alignment and domain information

>PF04641 Rtf2: Rtf2 RING-finger	Back alignment and domain information

>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function	Back alignment and domain information

>PHA02862 5L protein; Provisional	Back alignment and domain information

>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown]	Back alignment and domain information

>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3039 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13248 zf-ribbon_3: zinc-ribbon domain	Back alignment and domain information

>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA02825 LAP/PHD finger-like protein; Provisional	Back alignment and domain information

>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription]	Back alignment and domain information

>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK04023 DNA polymerase II large subunit; Validated	Back alignment and domain information

>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]	Back alignment and domain information

>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger	Back alignment and domain information

>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines	Back alignment and domain information

>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues	Back alignment and domain information

>PF13240 zinc_ribbon_2: zinc-ribbon domain	Back alignment and domain information

>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PRK14559 putative protein serine/threonine phosphatase; Provisional	Back alignment and domain information

>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length	Back alignment and domain information

>PHA00626 hypothetical protein	Back alignment and domain information

>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A	Back alignment and domain information

>PF14446 Prok-RING_1: Prokaryotic RING finger family 1	Back alignment and domain information

>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO)	Back alignment and domain information

>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		226
2dkt_A		143	Solution Structure Of The Chy Zinc Finger Domain Of		2e-26
2k2c_A		137	Solution Nmr Structure Of N-Terminal Domain Of Huma		2e-25
2jrj_A		52	Solution Structure Of The Human Pirh2 Ring-H2 Domai		2e-04
2ecm_A		55	Solution Structure Of The Ring Domain Of The Ring F		3e-04

>pdb|2DKT|A Chain A, Solution Structure Of The Chy Zinc Finger Domain Of The Ring Finger And Chy Zinc Finger Domain-Containing Protein 1 From Mus Musculus Length = 143

Back alignment and structure

Iteration: 1

Score = 115 bits (289), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 58/132 (43%), Positives = 82/132 (62%), Gaps = 10/132 (7%) Query: 17 GCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSVCDTEQP 76 GC+HY R C ++APCC++++ CR CH+ + H+L R VK+V C C+ Q Sbjct: 18 GCEHYDRACLLKAPCCDKLYTCRLCHDTN--------EDHQLDRFKVKEVQCINCEKLQH 69 Query: 77 VAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYST 136 Q C +C GEY+C IC +D D K Q+HC+ CGICRIG +E++FHC +C C +T Sbjct: 70 AQQTCEDCSTLFGEYYCSICHLFDKD--KRQYHCESCGICRIGPKEDFFHCLKCNLCLTT 127 Query: 137 SLRNNHLCIENS 148 +LR H CIE+ Sbjct: 128 NLRGKHKCIESG 139

PyMOL of 2dkt

>pdb|2K2C|A Chain A, Solution Nmr Structure Of N-Terminal Domain Of Human Pirh2. Northeast Structural Genomics Consortium (Nesg) Target Ht2a Length = 137

Back alignment and structure

>pdb|2JRJ|A Chain A, Solution Structure Of The Human Pirh2 Ring-H2 Domain. Northeast Structural Genomics Consortium Target Ht2b Length = 52

Back alignment and structure

>pdb|2ECM|A Chain A, Solution Structure Of The Ring Domain Of The Ring Finger And Chy Zinc Finger Domain-Containing Protein 1 From Mus Musculus Length = 55

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		226
2dkt_A		143	Ring finger and CHY zinc finger domain- containing	7e-43
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	2e-13
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	2e-07
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	3e-05
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	5e-04
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	8e-04

>2dkt_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.89.1.1 g.93.1.1 PDB: 2k2c_A Length = 143	Back alignment and structure

 Score =  140 bits (354), Expect = 7e-43
 Identities = 60/149 (40%), Positives = 86/149 (57%), Gaps = 10/149 (6%)

Query: 2   EGSANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQ 61
            GS+       +   GC+HY R C ++APCC++++ CR CH+          + H+L R 
Sbjct: 3   SGSSGGVRNLAQGPRGCEHYDRACLLKAPCCDKLYTCRLCHDTN--------EDHQLDRF 54

Query: 62  DVKQVICSVCDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGR 121
            VK+V C  C+  Q   Q C +C    GEY+C IC  +D D  K Q+HC+ CGICRIG +
Sbjct: 55  KVKEVQCINCEKLQHAQQTCEDCSTLFGEYYCSICHLFDKD--KRQYHCESCGICRIGPK 112

Query: 122 ENYFHCKRCGSCYSTSLRNNHLCIENSMH 150
           E++FHC +C  C +T+LR  H CIE+   
Sbjct: 113 EDFFHCLKCNLCLTTNLRGKHKCIESGPS 141

PyMOL of 2dkt

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		226
2dkt_A		143	Ring finger and CHY zinc finger domain- containing	100.0
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	99.46
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	99.39
1iym_A		55	EL5; ring-H2 finger, ubiquitin ligase, DNA binding	99.38
1x4j_A		75	Ring finger protein 38; structural genomics, NPPSF	99.37
2ecl_A		81	Ring-box protein 2; RNF7, ring domian, zinc-bindin	99.37
2kiz_A		69	E3 ubiquitin-protein ligase arkadia; ring-H2 finge	99.37
1v87_A		114	Deltex protein 2; ring-H2 domain, zinc-binding dom	99.33
2l0b_A		91	E3 ubiquitin-protein ligase praja-1; zinc finger,	99.32
2ect_A		78	Ring finger protein 126; metal binding protein, st	99.3
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	99.27
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	99.27
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	99.26
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	99.25
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	99.22
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	99.19
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	99.18
3dpl_R		106	Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST	99.16
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	99.14
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	99.11
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	99.11
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	99.09
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	99.09
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	99.08
4ayc_A		138	E3 ubiquitin-protein ligase RNF8; DNA damage, K63	99.05
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	99.04
1t1h_A		78	Gspef-atpub14, armadillo repeat containing protein	99.03
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	99.03
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	99.03
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	99.01
2d8s_A		80	Cellular modulator of immune recognition; C-MIR, m	99.01
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	98.98
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	98.97
4a0k_B		117	E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi	98.96
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	98.96
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	98.95
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	98.95
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	98.94
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	98.93
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	98.92
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	98.91
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	98.91
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	98.9
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	98.87
2k2d_A		79	Ring finger and CHY zinc finger domain- containing	98.86
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	98.85
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	98.85
1z6u_A		150	NP95-like ring finger protein isoform B; structura	98.79
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	98.68
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	98.64
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	98.61
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	98.59
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	98.58
4ic3_A		74	E3 ubiquitin-protein ligase XIAP; ring domain, zin	98.55
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	98.55
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	98.5
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	98.49
1wim_A		94	KIAA0161 protein; ring finger domain, UBCM4-intera	98.41
2kr4_A		85	Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri	98.36
2ecg_A		75	Baculoviral IAP repeat-containing protein 4; BIRC4	98.35
2ea5_A		68	Cell growth regulator with ring finger domain prot	98.34
1vyx_A		60	ORF K3, K3RING; zinc-binding protein, ring domain,	98.34
2kre_A		100	Ubiquitin conjugation factor E4 B; U-box domain, E	98.31
1wgm_A		98	Ubiquitin conjugation factor E4A; ubiquitinating e	98.26
2yu4_A		94	E3 SUMO-protein ligase NSE2; SP-ring domain, struc	98.25
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	98.2
2yho_A		79	E3 ubiquitin-protein ligase mylip; ligase, E2 liga	98.18
3k1l_B		381	Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A	98.16
3htk_C		267	E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-	97.88
2f42_A		179	STIP1 homology and U-box containing protein 1; cha	97.85
3t6p_A		345	Baculoviral IAP repeat-containing protein 2; ring,	97.71
2bay_A		61	PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l	97.51
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	97.46
3nw0_A		238	Non-structural maintenance of chromosomes element	96.06
2lbm_A		142	Transcriptional regulator ATRX; metal binding prot	91.25
2ko5_A		99	Ring finger protein Z; lassa fever virus-Z, negati	91.21
2jrp_A		81	Putative cytoplasmic protein; two-zinc binding pro	90.18
2jun_A		101	Midline-1; B-BOX, TRIM, ring finger, alternative s	88.67
2ysm_A		111	Myeloid/lymphoid or mixed-lineage leukemia protein	83.4
3v43_A		112	Histone acetyltransferase KAT6A; MOZ, PHD finger,	81.73

>2dkt_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.89.1.1 g.93.1.1 PDB: 2k2c_A	Back alignment and structure

Probab=100.00  E-value=5.7e-57  Score=368.39  Aligned_cols=139  Identities=42%  Similarity=1.050  Sum_probs=131.9

Q ss_pred             CCccccccCCCCccCcccccccceeecCCCCCcccChhhHHhhhcCCCCCCCCccccccccceeEeCCCCccccccccCC
Q 027217            3 GSANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSVCDTEQPVAQVCT   82 (226)
Q Consensus         3 ~~~~~~~~~~~~~~gC~HY~r~c~l~~pCC~~~y~Cr~CHde~~~h~~~~~~~H~~~r~~~~~v~Cg~C~~~q~v~~~C~   82 (226)
                      ++....+|++++++||+||+|+|+||||||++|||||+||||++        +|+++|+++++|+||+|+++|++++.|+
T Consensus         4 ~~~~~~~~~~~~~~gC~HY~r~~~lr~pCC~k~y~Cr~CHde~~--------dH~l~r~~~~~vlCg~C~~~q~~~~~C~   75 (143)
T 2dkt_A            4 GSSGGVRNLAQGPRGCEHYDRACLLKAPCCDKLYTCRLCHDTNE--------DHQLDRFKVKEVQCINCEKLQHAQQTCE   75 (143)
T ss_dssp             CCCCCCCCCCCCSSSCSSCCCSEEEEETTTTEEESSHHHHHHTS--------SSCCCSSSCCCEEESSSCCEECSCSBCS
T ss_pred             CCCCcccccccCcCCCcccCCCeeEECCCCCCccchhhhhcccc--------ccccchhccceeeecccCccccccCcCC
Confidence            45556789999999999999999999999999999999999974        6999999999999999999999999999


Q ss_pred             CCCCCcceeecCccccccCCCCCCeeccCCCCcceeCCccceeeccccCccccccccCcceeecCCCCC
Q 027217           83 NCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHH  151 (226)
Q Consensus        83 ~Cg~~f~~Y~C~~C~l~dd~~~k~~yHC~~CgiCR~G~~~~~fHC~~C~~C~s~~l~~~H~C~e~~~~~  151 (226)
                      +||+.||+|||+||||||  ++|+||||++|||||||+++|||||++||+|||++|+++|+|+|+++++
T Consensus        76 ~Cg~~f~~Y~C~~C~l~d--~~k~~yHC~~CgiCR~G~~~~ffHC~~C~~C~s~~l~~~H~C~e~~~~s  142 (143)
T 2dkt_A           76 DCSTLFGEYYCSICHLFD--KDKRQYHCESCGICRIGPKEDFFHCLKCNLCLTTNLRGKHKCIESGPSS  142 (143)
T ss_dssp             SSCCBSCSEECSSSCCEE--CSSSEEEETTTTEEEESCGGGEEEETTTTEEEEGGGSSSSCCSCCCSCC
T ss_pred             CCCccceeeEeceeeccc--CCCceecCCCCCceeccCCcCcEECCcCCeeeccccCcCcccCccCccC
Confidence            999999999999999997  4699999999999999999999999999999999999999999999865

PyMOL of 2dkt

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1	Back alignment and structure

>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1	Back alignment and structure

>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens}	Back alignment and structure

>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus}	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens}	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens}	Back alignment and structure

>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens}	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens}	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens}	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B	Back alignment and structure

>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus}	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens}	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens}	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens}	Back alignment and structure

>2k2d_A Ring finger and CHY zinc finger domain- containing protein 1; zinc-binding protein, cytoplasm, metal-binding, nucleus, metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens}	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A	Back alignment and structure

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B*	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens}	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens}	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A*	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus}	Back alignment and structure

>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3	Back alignment and structure

>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B	Back alignment and structure

>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2	Back alignment and structure

>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A	Back alignment and structure

>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster}	Back alignment and structure

>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae}	Back alignment and structure

>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C	Back alignment and structure

>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B	Back alignment and structure

>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus}	Back alignment and structure

>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens}	Back alignment and structure

>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A	Back alignment and structure

>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2}	Back alignment and structure

>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens}	Back alignment and structure

>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens}	Back alignment and structure

>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		226
d2dkta2		56	g.93.1.1 (A:82-137) RING finger and CHY zinc finge	1e-20
d2dkta1		74	g.89.1.1 (A:8-81) RING finger and CHY zinc finger	2e-11
d1fbva4		79	g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta	9e-05
d1ur6b_		52	g.44.1.1 (B:) Not-4 N-terminal RING finger domain	0.001
d1iyma_		55	g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati	0.004
d1rmda2		86	g.44.1.1 (A:1-86) V(D)J recombination activating p	0.004

>d2dkta2 g.93.1.1 (A:82-137) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 56	Back information, alignment and structure


class: Small proteins
fold: Zinc hairpin stack
superfamily: Zinc hairpin stack
family: Zinc hairpin stack
domain: RING finger and CHY zinc finger domain-containing protein 1
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 79.4 bits (196), Expect = 1e-20
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 2/58 (3%)

Query: 89  GEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIE 146
           GEY+C IC  +D D  K Q+HC+ CGICRIG +E++FHC +C  C +T+LR  H CIE
Sbjct: 1   GEYYCSICHLFDKD--KRQYHCESCGICRIGPKEDFFHCLKCNLCLTTNLRGKHKCIE 56

PyMOL of d2dkta2

>d2dkta1 g.89.1.1 (A:8-81) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 74	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		226
d2dkta2		56	RING finger and CHY zinc finger domain-containing	99.96
d2dkta1		74	RING finger and CHY zinc finger domain-containing	99.73
d1ur6b_		52	Not-4 N-terminal RING finger domain {Human (Homo s	99.5
d1iyma_		55	EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45	99.45
d1g25a_		65	TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9	99.4
d1chca_		68	Immediate early protein, IEEHV {Equine herpesvirus	99.38
d1v87a_		114	Deltex protein 2 RING-H2 domain {Mouse (Mus muscul	99.33
d1fbva4		79	CBL {Human (Homo sapiens) [TaxId: 9606]}	99.28
d3dplr1		88	RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase	99.26
d1jm7a_		103	brca1 RING domain {Human (Homo sapiens) [TaxId: 96	98.95
d1rmda2		86	V(D)J recombination activating protein 1 (RAG1), d	98.95
d1vyxa_		60	IE1B protein (ORF K3), N-terminal domain {Kaposi's	98.93
d2baya1		56	Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac	98.91
d1bora_		56	Acute promyelocytic leukaemia proto-oncoprotein PM	98.78
d2c2la2		80	STIP1 homology and U box-containing protein 1, STU	98.76
d1jm7b_		97	bard1 RING domain {Human (Homo sapiens) [TaxId: 96	98.75
d1t1ha_		78	E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi	98.69
d1wima_		94	UbcM4-interacting protein 4 (KIAA0161) {Human (Hom	98.58
d1wgma_		98	Ubiquitin conjugation factor E4A {Human (Homo sapi	97.7
d2dkta2		56	RING finger and CHY zinc finger domain-containing	87.5
d1we9a_		64	PHD finger protein At5g26210 {Thale cress (Arabido	82.82
d2jnea1		71	Hypothetical protein YfgJ {Escherichia coli [TaxId	82.27
d2fcwb1		39	Ligand-binding domain of low-density lipoprotein r	81.36

>d2dkta2 g.93.1.1 (A:82-137) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

class: Small proteins
fold: Zinc hairpin stack
superfamily: Zinc hairpin stack
family: Zinc hairpin stack
domain: RING finger and CHY zinc finger domain-containing protein 1
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.96  E-value=1.7e-30  Score=178.97  Aligned_cols=56  Identities=57%  Similarity=1.450  Sum_probs=54.0

Q ss_pred             ceeecCccccccCCCCCCeeccCCCCcceeCCccceeeccccCccccccccCcceeec
Q 027217           89 GEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIE  146 (226)
Q Consensus        89 ~~Y~C~~C~l~dd~~~k~~yHC~~CgiCR~G~~~~~fHC~~C~~C~s~~l~~~H~C~e  146 (226)
                      |+|||+||||||||  |++|||++|||||||+++|||||++||+|+|++|+++|+|+|
T Consensus         1 G~YfC~iC~l~ddd--k~~yHC~~CgiCRvG~~~~ffHC~~C~~C~~~~l~~~H~CiE   56 (56)
T d2dkta2           1 GEYYCSICHLFDKD--KRQYHCESCGICRIGPKEDFFHCLKCNLCLTTNLRGKHKCIE   56 (56)
T ss_dssp             CSEECSSSCCEECS--SSEEEETTTTEEEESCGGGEEEETTTTEEEEGGGSSSSCCSC
T ss_pred             CceECCcCCcccCC--CCcccCCCCCceeecCCccccccCccccccCcccCCCccccC
Confidence            68999999999885  899999999999999999999999999999999999999997

PyMOL of d2dkta2

>d2dkta1 g.89.1.1 (A:8-81) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}	Back information, alignment and structure

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]}	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dkta2 g.93.1.1 (A:82-137) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure