Citrus Sinensis ID: 027227

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
MNVLWKQEQKVRTGLEGPGLTNAQKIWYCIATVGGQYLWARLQSFSAFRRWGDSEQRPLARRAWILIQRIEALYKAASFGNLLIFLYTGRYRNLIERALRARLVYGTPNMNRAVSFEYMNRQLVWNEFSEMLLLLLPLLNSSTVKGLFGPFSKDKSSSSEEDVTTCPICQASPTTPFLALPCQHRYCYYCLRTRCAASPSFRCSRCNEPVIAMQRHGVINPKISSQ
cccEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccc
cccEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccccccccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEHEHHHHHHcccccccccccccHHHEEEccccccccccc
MNVLWKQEQKvrtglegpgltnaqKIWYCIATVGGQYLWARLQSFSAFrrwgdseqrpLARRAWILIQRIEALYKAASFGNLLIFLYTGRYRNLIERALRARLvygtpnmnravSFEYMNRQLVWNEFSEMLLLLLPllnsstvkglfgpfskdksssseedvttcpicqaspttpflalpcqhrycyyclrtrcaaspsfrcsrcnepviamqrhgvinpkissq
mnvlwkqeqkvrtglegpgltnaQKIWYCIATVGGQYLWARLQSFSAFRRWGDSEQRPLARRAWILIQRIEALYKAASFGNLLIFLYTGRYRNLIERALRARLVYGTPNMNRAVSFEYMNRQLVWNEFSEMLLLLLPLLNSSTVKGLFGPFSKDKSSSSEEDVTTCPIcqaspttpflalPCQHRYCYYCLRTRCAASPSFRCSRCNEPviamqrhgvinpkissq
MNVLWKQEQKVRTGLEGPGLTNAQKIWYCIATVGGQYLWARLQSFSAFRRWGDSEQRPLARRAWILIQRIEALYKAASFGNLLIFLYTGRYRNLIERALRARLVYGTPNMNRAVSFEYMNRQLVWNEFSEMlllllpllNSSTVKGLFGPFskdksssseedVTTCPICQASPTTPFLALPCQHRYCYYCLRTRCAASPSFRCSRCNEPVIAMQRHGVINPKISSQ
**************LEGPGLTNAQKIWYCIATVGGQYLWARLQSFSAFRRWGDSEQRPLARRAWILIQRIEALYKAASFGNLLIFLYTGRYRNLIERALRARLVYGTPNMNRAVSFEYMNRQLVWNEFSEMLLLLLPLLNSSTVKGLFG**************TTCPICQASPTTPFLALPCQHRYCYYCLRTRCAASPSFRCSRCNEPVIAMQRHGV********
MNVLWK*EQK*********LTNAQKIWYCIATVGGQYLWARLQSFSAFRR******RPLARRAWILIQRIEALYKAASFGNLLIFLYTGRYRNLIERALRARLVYGTPNMNRAVSFEYMNRQLVWNEFSEMLLLLLPLLNSSTVKGLFGPFSKDKSSSSEEDVTTCPICQASPTTPFLALPCQHRYCYYCLRTRCAASPSFRCSRCNEPVIAMQ************
MNVLWKQEQKVRTGLEGPGLTNAQKIWYCIATVGGQYLWARLQSFSAFRRWGDSEQRPLARRAWILIQRIEALYKAASFGNLLIFLYTGRYRNLIERALRARLVYGTPNMNRAVSFEYMNRQLVWNEFSEMLLLLLPLLNSSTVKGLFGPF*************TCPICQASPTTPFLALPCQHRYCYYCLRTRCAASPSFRCSRCNEPVIAMQRHGVINPKISSQ
*NVLWKQEQKVRTGLEGPGLTNAQKIWYCIATVGGQYLWARLQSFSAFRRWGDSEQRPLARRAWILIQRIEALYKAASFGNLLIFLYTGRYRNLIERALRARLVYGTPNMNRAVSFEYMNRQLVWNEFSEMLLLLLPLLNSSTVKGLFGPFSKDKSSSS**DVTTCPICQASPTTPFLALPCQHRYCYYCLRTRCAASPSFRCSRCNEPVIAMQRHGVI*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNVLWKQEQKVRTGLEGPGLTNAQKIWYCIATVGGQYLWARLQSFSAFRRWGDSEQRPLARRAWILIQRIEALYKAASFGNLLIFLYTGRYRNLIERALRARLVYGTPNMNRAVSFEYMNRQLVWNEFSEMLLLLLPLLNSSTVKGLFGPFSKDKSSSSEEDVTTCPICQASPTTPFLALPCQHRYCYYCLRTRCAASPSFRCSRCNEPVIAMQRHGVINPKISSQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query226 2.2.26 [Sep-21-2011]
Q9CA86333 Peroxisome biogenesis pro yes no 0.982 0.666 0.743 4e-96
Q75JQ3423 Peroxisome biogenesis fac yes no 0.960 0.513 0.288 7e-32
P51021554 Peroxisomal biogenesis fa yes no 0.827 0.337 0.327 1e-25
P24392305 Peroxisome biogenesis fac yes no 0.898 0.665 0.310 3e-23
P55098305 Peroxisome biogenesis fac no no 0.805 0.596 0.326 1e-22
P28328305 Peroxisome biogenesis fac yes no 0.792 0.586 0.311 1e-21
Q06438304 Peroxisome biogenesis fac yes no 0.898 0.667 0.297 4e-21
Q99155381 Peroxisomal biogenesis fa yes no 0.805 0.477 0.320 4e-21
Q01964461 Peroxisomal biogenesis fa yes no 0.623 0.305 0.264 1e-07
P32800271 Peroxisomal biogenesis fa yes no 0.314 0.261 0.363 0.0003
>sp|Q9CA86|PEX2_ARATH Peroxisome biogenesis protein 2 OS=Arabidopsis thaliana GN=PEX2 PE=1 SV=1 Back     alignment and function desciption
 Score =  350 bits (899), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 171/230 (74%), Positives = 198/230 (86%), Gaps = 8/230 (3%)

Query: 1   MNVLWKQEQ--------KVRTGLEGPGLTNAQKIWYCIATVGGQYLWARLQSFSAFRRWG 52
           MN+ ++ E+        KVRTGLEGPGLT+ QKIWYC+A+VGGQYL++RLQSFSAFRRWG
Sbjct: 104 MNLRYRDERGVVAQHLGKVRTGLEGPGLTSPQKIWYCVASVGGQYLFSRLQSFSAFRRWG 163

Query: 53  DSEQRPLARRAWILIQRIEALYKAASFGNLLIFLYTGRYRNLIERALRARLVYGTPNMNR 112
           DSEQRPLARR W L+QRIE +YKAASF NLL FLYTGRYRNLIE+AL+ARLVY +P+MNR
Sbjct: 164 DSEQRPLARRLWTLVQRIEGIYKAASFLNLLSFLYTGRYRNLIEKALKARLVYRSPHMNR 223

Query: 113 AVSFEYMNRQLVWNEFSEMLLLLLPLLNSSTVKGLFGPFSKDKSSSSEEDVTTCPICQAS 172
           +VSFEYMNRQLVWNEFSEMLLLLLPLLNSS VK +  PF+KDKSSS++ED  TCPICQ  
Sbjct: 224 SVSFEYMNRQLVWNEFSEMLLLLLPLLNSSAVKNILSPFAKDKSSSTKEDTVTCPICQVD 283

Query: 173 PTTPFLALPCQHRYCYYCLRTRCAASPSFRCSRCNEPVIAMQRHGVINPK 222
           P  PF+ALPCQHRYCYYC+RTRCA++ SFRC RCNEPV+A+QR GV + K
Sbjct: 284 PAIPFIALPCQHRYCYYCIRTRCASAASFRCLRCNEPVVAIQREGVSSGK 333
Might act directly in a photomorphogenetic pathway negatively regulated by DET1, which is involved in peroxisome assembly and matrix protein import. Could be part of a complex responsible for the monoubiquitination of PEX5.
Arabidopsis thaliana (taxid: 3702)
>sp|Q75JQ3|PEX2_DICDI Peroxisome biogenesis factor 2 OS=Dictyostelium discoideum GN=pex2 PE=3 SV=1 Back     alignment and function description
>sp|P51021|PEX2_PODAS Peroxisomal biogenesis factor 2 OS=Podospora anserina GN=PEX2 PE=3 SV=1 Back     alignment and function description
>sp|P24392|PEX2_RAT Peroxisome biogenesis factor 2 OS=Rattus norvegicus GN=Pex2 PE=2 SV=1 Back     alignment and function description
>sp|P55098|PEX2_MOUSE Peroxisome biogenesis factor 2 OS=Mus musculus GN=Pex2 PE=2 SV=1 Back     alignment and function description
>sp|P28328|PEX2_HUMAN Peroxisome biogenesis factor 2 OS=Homo sapiens GN=PEX2 PE=1 SV=2 Back     alignment and function description
>sp|Q06438|PEX2_CRIGR Peroxisome biogenesis factor 2 OS=Cricetulus griseus GN=PEX2 PE=1 SV=1 Back     alignment and function description
>sp|Q99155|PEX2_YARLI Peroxisomal biogenesis factor 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PEX2 PE=3 SV=2 Back     alignment and function description
>sp|Q01964|PEX2_PICPA Peroxisomal biogenesis factor 2 OS=Komagataella pastoris GN=PEX2 PE=3 SV=1 Back     alignment and function description
>sp|P32800|PEX2_YEAST Peroxisomal biogenesis factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query226
357513377 438 Peroxisome assembly protein [Medicago tr 0.973 0.502 0.823 1e-102
356526111 330 PREDICTED: peroxisome biogenesis protein 0.969 0.663 0.822 1e-101
356523018 331 PREDICTED: peroxisome biogenesis protein 0.969 0.661 0.817 1e-100
356523016 333 PREDICTED: peroxisome biogenesis protein 0.946 0.642 0.841 1e-100
225442563 346 PREDICTED: peroxisome biogenesis protein 0.955 0.624 0.815 3e-99
449524581 360 PREDICTED: peroxisome biogenesis protein 0.955 0.6 0.788 3e-96
224074005 340 predicted protein [Populus trichocarpa] 0.920 0.611 0.889 5e-96
18412518 333 peroxin-2 [Arabidopsis thaliana] gi|3409 0.982 0.666 0.743 2e-94
42572185282 peroxin-2 [Arabidopsis thaliana] gi|3321 0.982 0.787 0.743 6e-94
21537047 333 putative RING finger protein [Arabidopsi 0.982 0.666 0.739 2e-93
>gi|357513377|ref|XP_003626977.1| Peroxisome assembly protein [Medicago truncatula] gi|355520999|gb|AET01453.1| Peroxisome assembly protein [Medicago truncatula] Back     alignment and taxonomy information
 Score =  375 bits (962), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 186/226 (82%), Positives = 203/226 (89%), Gaps = 6/226 (2%)

Query: 1   MNVLWKQEQ------KVRTGLEGPGLTNAQKIWYCIATVGGQYLWARLQSFSAFRRWGDS 54
           MN+ ++ E+      KVRTGLEGPGLT AQK+WYCIATVGGQY+WARLQSFSAFRRWGD+
Sbjct: 211 MNLRYRDERAVESRDKVRTGLEGPGLTVAQKLWYCIATVGGQYIWARLQSFSAFRRWGDT 270

Query: 55  EQRPLARRAWILIQRIEALYKAASFGNLLIFLYTGRYRNLIERALRARLVYGTPNMNRAV 114
           EQRPLARR WILIQRIE +Y+AASFGNLLIFL TGRYRNLIER LRARLVYG+PNMNRAV
Sbjct: 271 EQRPLARRLWILIQRIEGIYRAASFGNLLIFLCTGRYRNLIERVLRARLVYGSPNMNRAV 330

Query: 115 SFEYMNRQLVWNEFSEMLLLLLPLLNSSTVKGLFGPFSKDKSSSSEEDVTTCPICQASPT 174
           SFEYMNRQLVWNEFSEMLLLLLPLLNSS+VK L  PFSKDKSSSS ED T CPICQA+P 
Sbjct: 331 SFEYMNRQLVWNEFSEMLLLLLPLLNSSSVKNLLRPFSKDKSSSSGEDSTACPICQATPI 390

Query: 175 TPFLALPCQHRYCYYCLRTRCAASPSFRCSRCNEPVIAMQRHGVIN 220
            PF+ALPCQHRYCYYCLRTRCAA+PSFRC RCNEPV+AMQRHG ++
Sbjct: 391 IPFVALPCQHRYCYYCLRTRCAAAPSFRCLRCNEPVVAMQRHGGVS 436

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356526111|ref|XP_003531663.1| PREDICTED: peroxisome biogenesis protein 2-like [Glycine max] Back     alignment and taxonomy information
>gi|356523018|ref|XP_003530139.1| PREDICTED: peroxisome biogenesis protein 2-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356523016|ref|XP_003530138.1| PREDICTED: peroxisome biogenesis protein 2-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|225442563|ref|XP_002279072.1| PREDICTED: peroxisome biogenesis protein 2 [Vitis vinifera] gi|297743241|emb|CBI36108.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449524581|ref|XP_004169300.1| PREDICTED: peroxisome biogenesis protein 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224074005|ref|XP_002304212.1| predicted protein [Populus trichocarpa] gi|222841644|gb|EEE79191.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|18412518|ref|NP_565222.1| peroxin-2 [Arabidopsis thaliana] gi|34098692|sp|Q9CA86.1|PEX2_ARATH RecName: Full=Peroxisome biogenesis protein 2; AltName: Full=E3 ubiquitin-protein ligase PEX2; AltName: Full=Peroxin-2; Short=AtPEX2; Short=AthPEX2; AltName: Full=Pex2p gi|12324593|gb|AAG52254.1|AC011717_22 putative RING finger protein; 84236-82024 [Arabidopsis thaliana] gi|17381214|gb|AAL36419.1| unknown protein [Arabidopsis thaliana] gi|20465819|gb|AAM20014.1| unknown protein [Arabidopsis thaliana] gi|332198180|gb|AEE36301.1| peroxin-2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42572185|ref|NP_974183.1| peroxin-2 [Arabidopsis thaliana] gi|332198181|gb|AEE36302.1| peroxin-2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21537047|gb|AAM61388.1| putative RING finger protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query226
TAIR|locus:2017804333 TED3 "REVERSAL OF THE DET PHEN 0.942 0.639 0.713 9.1e-84
DICTYBASE|DDB_G0272234423 pex2 "peroxisomal biogenesis f 0.553 0.295 0.354 2e-30
ZFIN|ZDB-GENE-070530-2312 pex2 "peroxisomal biogenesis f 0.800 0.580 0.321 2.6e-22
UNIPROTKB|F1RWL5305 PEX2 "Uncharacterized protein" 0.907 0.672 0.290 1.5e-21
ASPGD|ASPL0000018227444 pexB [Emericella nidulans (tax 0.486 0.247 0.427 2.2e-21
UNIPROTKB|F6R7C3305 PEX2 "Uncharacterized protein" 0.942 0.698 0.273 3e-21
UNIPROTKB|G4NB15 498 MGG_00655 "Peroxisomal biogene 0.473 0.214 0.4 6.4e-21
UNIPROTKB|E2R4P2305 PEX2 "Uncharacterized protein" 0.898 0.665 0.283 1.7e-20
RGD|61814305 Pex2 "peroxisomal biogenesis f 0.898 0.665 0.274 5.1e-19
UNIPROTKB|Q06438304 PEX2 "Peroxisome biogenesis fa 0.898 0.667 0.270 6.5e-19
TAIR|locus:2017804 TED3 "REVERSAL OF THE DET PHENOTYPE 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 839 (300.4 bits), Expect = 9.1e-84, P = 9.1e-84
 Identities = 152/213 (71%), Positives = 172/213 (80%)

Query:    10 KVRTGLEGPGLTNAQKIWYCIATVGGQYLWARLQSFSAFRRWGDSEQRPLARRAWILIQR 69
             KVRTGLEGPGLT+ QKIWYC+A+VGGQYL++RLQSFSAFRRWGDSEQRPLARR W L+QR
Sbjct:   121 KVRTGLEGPGLTSPQKIWYCVASVGGQYLFSRLQSFSAFRRWGDSEQRPLARRLWTLVQR 180

Query:    70 IEALYKAASFGNLLIFLYTGRYRNLIERALRARLVYGTPNMNRAVSFEYMNRQLVWNEFS 129
             IE +YKAASF NLL FLYTGRYRNLIE+AL+ARLVY +P+MNR+VSFEYMNRQLVWNEFS
Sbjct:   181 IEGIYKAASFLNLLSFLYTGRYRNLIEKALKARLVYRSPHMNRSVSFEYMNRQLVWNEFS 240

Query:   130 EMXXXXXXXXNSSTVKGLFGPFXXXXXXXXXXXVTTCPICQASPTTPFLALPCQHRYCYY 189
             EM        NSS VK +  PF             TCPICQ  P  PF+ALPCQHRYCYY
Sbjct:   241 EMLLLLLPLLNSSAVKNILSPFAKDKSSSTKEDTVTCPICQVDPAIPFIALPCQHRYCYY 300

Query:   190 CLRTRCAASPSFRCSRCNEPVIAMQRHGVINPK 222
             C+RTRCA++ SFRC RCNEPV+A+QR GV + K
Sbjct:   301 CIRTRCASAASFRCLRCNEPVVAIQREGVSSGK 333
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0005777 "peroxisome" evidence=IDA
GO:0007031 "peroxisome organization" evidence=IMP
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0006635 "fatty acid beta-oxidation" evidence=RCA;IMP
GO:0016558 "protein import into peroxisome matrix" evidence=RCA;IMP
GO:0009506 "plasmodesma" evidence=IDA
GO:0006869 "lipid transport" evidence=RCA
GO:0006888 "ER to Golgi vesicle-mediated transport" evidence=RCA
GO:0006891 "intra-Golgi vesicle-mediated transport" evidence=RCA
GO:0010351 "lithium ion transport" evidence=RCA
GO:0044265 "cellular macromolecule catabolic process" evidence=RCA
GO:0009640 "photomorphogenesis" evidence=IMP
DICTYBASE|DDB_G0272234 pex2 "peroxisomal biogenesis factor 2" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070530-2 pex2 "peroxisomal biogenesis factor 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RWL5 PEX2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ASPGD|ASPL0000018227 pexB [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|F6R7C3 PEX2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G4NB15 MGG_00655 "Peroxisomal biogenesis factor 2" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4P2 PEX2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|61814 Pex2 "peroxisomal biogenesis factor 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q06438 PEX2 "Peroxisome biogenesis factor 2" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9CA86PEX2_ARATHNo assigned EC number0.74340.98230.6666yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00034358001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (346 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00032261001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (400 aa)
    • • 0.463
GSVIVG00032871001
SubName- Full=Chromosome undetermined scaffold_62, whole genome shotgun sequence; (393 aa)
      • 0.455

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
pfam04757215 pfam04757, Pex2_Pex12, Pex2 / Pex12 amino terminal 6e-27
cd0016245 cd00162, RING, RING-finger (Really Interesting New 1e-07
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 1e-06
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-05
smart0018440 smart00184, RING, Ring finger 1e-04
>gnl|CDD|218247 pfam04757, Pex2_Pex12, Pex2 / Pex12 amino terminal region Back     alignment and domain information 
 Score =  102 bits (256), Expect = 6e-27
 Identities = 46/148 (31%), Positives = 71/148 (47%), Gaps = 9/148 (6%)

Query: 9   QKVRTGLEGPGLTNAQKIWYCIATVGGQYLWARLQSFSAFRRWGDSEQRP--------LA 60
           ++V    EG  L+  Q++   +  V G YL  +L S        D E           L 
Sbjct: 60  KRVNEDDEGRLLSRKQRLLSLLLLVLGPYLLRKLDSLLERLLEEDLENSLLRQSRLSRLK 119

Query: 61  RRAWILIQRIEALYKAASFGNLLIFLYTGRYRNLIERALRARLVYGTPN-MNRAVSFEYM 119
           RR   L   + AL +  +  + L+FL+ G Y +L +R L  R V    + + R VS+E++
Sbjct: 120 RRLLKLYPALNALLELLNLLHFLLFLFGGTYYSLSKRLLGIRYVRLNQSDLERNVSYEFL 179

Query: 120 NRQLVWNEFSEMLLLLLPLLNSSTVKGL 147
            R L+W  F E+LL LLPLL  +++  L
Sbjct: 180 GRLLLWQLFVELLLFLLPLLLPASLFFL 207

This region is found at the N terminal of a number of known and predicted peroxins including Pex2, Pex10 and Pex12. This conserved region is usually associated with a C terminal ring finger (pfam00097) domain. Length = 215
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 226
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.88
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 99.83
PF04757229 Pex2_Pex12: Pex2 / Pex12 amino terminal region; In 99.82
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.24
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.2
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.15
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.06
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.98
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.98
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.97
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.95
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.87
PHA02929238 N1R/p28-like protein; Provisional 98.84
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.8
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.79
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.75
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.71
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.69
PHA02926242 zinc finger-like protein; Provisional 98.69
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.64
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.63
PF1463444 zf-RING_5: zinc-RING finger domain 98.59
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.58
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.55
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.52
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.51
KOG1002 791 consensus Nucleotide excision repair protein RAD16 98.38
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.33
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.3
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.27
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 98.26
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.22
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 98.17
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 98.13
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 98.11
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.0
COG5222427 Uncharacterized conserved protein, contains RING Z 97.81
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 97.8
COG5152259 Uncharacterized conserved protein, contains RING a 97.78
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.74
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 97.72
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.71
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.7
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.67
KOG2660 331 consensus Locus-specific chromosome binding protei 97.65
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.62
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.61
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.52
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 97.33
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.32
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.07
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 96.88
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 96.85
KOG1941518 consensus Acetylcholine receptor-associated protei 96.85
KOG3039303 consensus Uncharacterized conserved protein [Funct 96.84
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.54
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 96.52
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 96.51
PF04641260 Rtf2: Rtf2 RING-finger 96.44
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 96.35
KOG4367 699 consensus Predicted Zn-finger protein [Function un 96.08
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 96.06
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 96.02
KOG4739 233 consensus Uncharacterized protein involved in syna 96.01
COG52191525 Uncharacterized conserved protein, contains RING Z 95.98
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 95.89
KOG0825 1134 consensus PHD Zn-finger protein [General function 95.7
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 95.69
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.56
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 94.88
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 94.38
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 94.35
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 94.3
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 94.23
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 93.98
KOG149384 consensus Anaphase-promoting complex (APC), subuni 93.77
COG5175 480 MOT2 Transcriptional repressor [Transcription] 93.38
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 93.14
KOG3039 303 consensus Uncharacterized conserved protein [Funct 92.64
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 92.41
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 92.24
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 91.99
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 91.94
PHA02825162 LAP/PHD finger-like protein; Provisional 91.78
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 91.23
KOG3002 299 consensus Zn finger protein [General function pred 90.88
PHA03096284 p28-like protein; Provisional 90.67
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 90.46
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 90.46
KOG3579352 consensus Predicted E3 ubiquitin ligase [Posttrans 89.92
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 89.91
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 89.3
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 87.54
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 87.38
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 86.82
PHA02862156 5L protein; Provisional 86.09
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 84.99
PRK04023 1121 DNA polymerase II large subunit; Validated 84.67
PF0797551 C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al 83.93
KOG4445 368 consensus Uncharacterized conserved protein, conta 83.89
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 83.83
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 83.56
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 82.9
PLN02638 1079 cellulose synthase A (UDP-forming), catalytic subu 82.22
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 81.53
PF10497105 zf-4CXXC_R1: Zinc-finger domain of monoamine-oxida 81.38
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 80.28
KOG2979262 consensus Protein involved in DNA repair [General 80.23
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-34  Score=238.63  Aligned_cols=211  Identities=36%  Similarity=0.632  Sum_probs=170.7

Q ss_pred             CCccccccccccccCCCCCCChhHHHHHHHHHHHHHHHHHHHHhHHhhhhcCCCCCchHHHHHHHHHHHHHHHHHHHHHH
Q 027227            1 MNVLWKQEQKVRTGLEGPGLTNAQKIWYCIATVGGQYLWARLQSFSAFRRWGDSEQRPLARRAWILIQRIEALYKAASFG   80 (226)
Q Consensus         1 ~~~~~~~~~~~~~~~~g~~Ls~~~r~~~~l~~v~~pYl~~Kl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~   80 (226)
                      |||.|+.|.....-.-+++     ++++.+.++++.|+.++.+ ....++|.++    .-.+++..+.+++.++.+..+.
T Consensus        81 l~v~y~~ek~~~~r~~l~g-----~IW~~v~sig~~~~~~r~q-m~l~r~~~~~----~~~~~~~~v~~ve~i~~~~~~~  150 (298)
T KOG2879|consen   81 LNVAYIFEKLPVLRVVLEG-----KIWTHVFSIGGSWLEERNQ-MDLFRAGWVN----LTPKLITSVFMVEGILKALGML  150 (298)
T ss_pred             hhHHhhhccCceEEEeecc-----eEEEEeccccCCchhhhhH-HHHHHhhhhh----HHHHHHHHHHHHHHHHHHHHHH
Confidence            5777777765222221121     5666678899999999976 2223333332    2233677788999999999999


Q ss_pred             HHHHHhhcCCcCcHHHHHhhceeeecCCCCCcccchhhhhhHHHHHHHHHHHHHHhhcccchhhhhhccCCCCC------
Q 027227           81 NLLIFLYTGRYRNLIERALRARLVYGTPNMNRAVSFEYMNRQLVWNEFSEMLLLLLPLLNSSTVKGLFGPFSKD------  154 (226)
Q Consensus        81 ~~l~Fl~~g~y~sl~~rll~lr~~~~~~~~~~~~~~~~~~r~l~~~~~~e~l~~~lp~~~~~~~~~~l~~~~~~------  154 (226)
                      |++.||..|+++++.++++|++++...+...|+++|||+||||+|++++|++.+++|+++++++++.++++..+      
T Consensus       151 n~l~fL~~gr~~tlie~il~~~si~~~~~~~R~ig~eY~NReLlW~~F~e~ll~~lp~I~~~k~r~~l~sw~~~l~~ap~  230 (298)
T KOG2879|consen  151 NLLSFLYRGRMYTLIEAILGLGSILHFPYFNRSIGYEYQNRELLWNAFREVLLLTLPFINFRKLRRVLKSWKLDLDRAPK  230 (298)
T ss_pred             HHHHHHHhhhhhHHHHHHhccchhhhcccccchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999998866554433      


Q ss_pred             CCCCCCcCcccccccCCCCCCCCeecCCCCcccHHHHHHHHhcCCCCCCCCCCccccccccccccCC
Q 027227          155 KSSSSEEDVTTCPICQASPTTPFLALPCQHRYCYYCLRTRCAASPSFRCSRCNEPVIAMQRHGVINP  221 (226)
Q Consensus       155 ~~~~~~~~~~~C~iC~~~~~~p~~~~~CgH~fC~~Ci~~~~~~~~~~~CP~Cr~~~~~~~~~~~~~~  221 (226)
                      ...+..+++.+|++|.+.+++|++..+|||+|||+|+.+....+..+.||.|++++..++..||..|
T Consensus       231 ~sss~~t~~~~C~~Cg~~PtiP~~~~~C~HiyCY~Ci~ts~~~~asf~Cp~Cg~~~~~lq~sgv~~~  297 (298)
T KOG2879|consen  231 FSSSTGTSDTECPVCGEPPTIPHVIGKCGHIYCYYCIATSRLWDASFTCPLCGENVEPLQASGVKSP  297 (298)
T ss_pred             cccccccCCceeeccCCCCCCCeeeccccceeehhhhhhhhcchhhcccCccCCCCcchhhccCCCC
Confidence            2334557889999999999999988889999999999998877667999999999998887777655

>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04757 Pex2_Pex12: Pex2 / Pex12 amino terminal region; InterPro: IPR006845 This region is the N-terminal part of a number of peroxisomal biogenesis proteins, including Pex2, Pex10 and Pex12, which contain two predicted transmembrane segments Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04023 DNA polymerase II large subunit; Validated Back     alignment and domain information
>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF10497 zf-4CXXC_R1: Zinc-finger domain of monoamine-oxidase A repressor R1; InterPro: IPR018866 R1 is a transcription factor repressor that inhibits monoamine oxidase A gene expression Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>KOG2979 consensus Protein involved in DNA repair [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
1chc_A68 Structure Of The C3hc4 Domain By 1h-Nuclear Magneti 2e-04
>pdb|1CHC|A Chain A, Structure Of The C3hc4 Domain By 1h-Nuclear Magnetic Resonance Spectroscopy; A New Structural Class Of Zinc- Finger Length = 68 Back     alignment and structure 
Iteration: 1

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 2/45 (4%)
Query: 166 CPICQASPTTPFLALPCQHRYCYYCLRTRCAASPSFRCSRCNEPV 210
           CPIC   P+   +ALPC H +CY C+      +P+  C  C  PV
Sbjct: 8   CPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPT--CPLCKVPV 50

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 3e-08
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 2e-07
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 2e-07
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 9e-07
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 2e-06
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 2e-06
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 2e-06
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 2e-06
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 3e-06
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 4e-06
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 4e-06
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 6e-06
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 7e-06
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 8e-06
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 2e-05
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 3e-05
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 3e-05
1z6u_A150 NP95-like ring finger protein isoform B; structura 3e-05
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 3e-05
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 3e-05
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 4e-05
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 5e-05
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 6e-05
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 6e-05
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 2e-04
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 2e-04
2ysl_A73 Tripartite motif-containing protein 31; ring-type 2e-04
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-04
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 2e-04
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 3e-04
3nw0_A238 Non-structural maintenance of chromosomes element 5e-04
2ecw_A85 Tripartite motif-containing protein 30; metal bind 5e-04
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 6e-04
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 7e-04
2ysj_A63 Tripartite motif-containing protein 31; ring-type 9e-04
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
 Score = 48.7 bits (116), Expect = 3e-08
 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 9/69 (13%)

Query: 154 DKSSSSEEDVT-TCPICQASPTTPFLALPCQHRYCYYCLRTRCAASPSFRCSRCNEPVIA 212
               S EE++   C IC+ +   P +   C+H +C  C      A+P  RC  C++P   
Sbjct: 5   SSGGSEEEEIPFRCFICRQAFQNPVV-TKCRHYFCESCALEHFRATP--RCYICDQPT-- 59

Query: 213 MQRHGVINP 221
               G+ NP
Sbjct: 60  ---GGIFNP 65
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query226
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.41
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.36
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.35
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.33
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.29
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.29
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.27
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.27
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.26
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.23
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.23
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.23
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.22
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.22
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.21
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.21
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.21
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.21
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.2
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.18
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.18
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.18
2ect_A78 Ring finger protein 126; metal binding protein, st 99.15
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.15
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.14
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.13
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.13
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.13
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.12
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.12
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.12
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.12
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.1
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.1
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.09
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.08
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.08
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.08
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.07
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.06
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.05
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.04
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.03
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.03
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.02
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.01
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.0
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.0
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.98
2ea5_A68 Cell growth regulator with ring finger domain prot 98.96
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.95
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.94
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.92
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.91
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.88
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.88
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.87
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.87
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.86
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.78
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.75
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.64
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.62
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.56
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.53
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.53
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.53
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.49
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.22
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.68
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.37
3nw0_A238 Non-structural maintenance of chromosomes element 97.05
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.74
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 93.64
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 93.62
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 93.49
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 93.23
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 89.54
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 88.99
3o36_A 184 Transcription intermediary factor 1-alpha; TRIM24, 86.79
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 82.64
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 82.03
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
Probab=99.41  E-value=4.2e-13  Score=91.82  Aligned_cols=56  Identities=27%  Similarity=0.623  Sum_probs=47.2

Q ss_pred             CCCcCcccccccCCCCCCCCeecC-CCCcccHHHHHHHHhcCCCCCCCCCCccccccc
Q 027227          158 SSEEDVTTCPICQASPTTPFLALP-CQHRYCYYCLRTRCAASPSFRCSRCNEPVIAMQ  214 (226)
Q Consensus       158 ~~~~~~~~C~iC~~~~~~p~~~~~-CgH~fC~~Ci~~~~~~~~~~~CP~Cr~~~~~~~  214 (226)
                      ....++..|+||.+.+.+| +.++ |||.||..||..|+...+...||+||+++...+
T Consensus        10 ~~~~~~~~C~IC~~~~~~p-~~~~~CgH~fC~~Ci~~~~~~~~~~~CP~Cr~~~~~~~   66 (74)
T 2yur_A           10 DPIPDELLCLICKDIMTDA-VVIPCCGNSYCDECIRTALLESDEHTCPTCHQNDVSPD   66 (74)
T ss_dssp             CCSCGGGSCSSSCCCCTTC-EECSSSCCEECTTHHHHHHHHSSSSCCSSSCCSSCCTT
T ss_pred             ccCCCCCCCcCCChHHhCC-eEcCCCCCHHHHHHHHHHHHhcCCCcCCCCCCcCCCcc
Confidence            3456789999999999999 6788 999999999999998654578999999765433
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 226
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 4e-06
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 3e-05
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 3e-05
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 1e-04
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 1e-04
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 1e-04
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 4e-04
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 6e-04
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 0.004
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Immediate early protein, IEEHV
species: Equine herpesvirus 1 [TaxId: 10326]

 Score = 41.1 bits (96), Expect = 4e-06
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 156 SSSSEEDVTTCPICQASPTTPFLALPCQHRYCYYCLRTRCAASPSFRCSRCNEPV 210
           ++ +E     CPIC   P+   +ALPC H +CY C+      +P+  C  C  PV
Sbjct: 2   ATVAER----CPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPT--CPLCKVPV 50
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query226
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.35
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.31
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.25
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.25
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.24
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.21
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.11
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.11
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.09
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.08
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.01
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.87
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.79
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.72
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.69
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.09
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 94.3
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 89.95
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 87.43
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.35  E-value=1.8e-13  Score=94.66  Aligned_cols=49  Identities=22%  Similarity=0.653  Sum_probs=43.1

Q ss_pred             CcccccccCCCCCCCCeecCCCCcccHHHHHHHHhcCCCCCCCCCCccccc
Q 027227          162 DVTTCPICQASPTTPFLALPCQHRYCYYCLRTRCAASPSFRCSRCNEPVIA  212 (226)
Q Consensus       162 ~~~~C~iC~~~~~~p~~~~~CgH~fC~~Ci~~~~~~~~~~~CP~Cr~~~~~  212 (226)
                      ++..|+||.+.+.+| ++++|||.||+.||..|++.+ ...||.||.++..
T Consensus        22 ~~l~C~IC~~~~~~p-v~~~CgH~FC~~Ci~~~~~~~-~~~CP~Cr~p~~~   70 (86)
T d1rmda2          22 KSISCQICEHILADP-VETSCKHLFCRICILRCLKVM-GSYCPSCRYPCFP   70 (86)
T ss_dssp             HHTBCTTTCSBCSSE-EECTTSCEEEHHHHHHHHHHT-CSBCTTTCCBCCG
T ss_pred             cCcCCccCCcchhcc-eecCCCChhhHHHHHHHHhhC-CCcCcccCCCCCh
Confidence            567899999999999 789999999999999999753 4579999998763
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure