Citrus Sinensis ID: 027250

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
MKMEWPNFQQGGEMERQFQQDGGDTSNGLCVKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQNEIAGMRMGNPYFDPFVASGSQKLTARQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQNRRARLKRKQSGVVPNNAESEAETVTHAESRKQNPESIQSLEDSAPPPRDEDIYPQSPDLGNKFFCFNVLLNKYKLIFSHM
cccccccccccHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccEEEEccccHHHHHHHHccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccHHHHHHccccccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHccccccccccccHHHcccccccccccccHHccccccccccEEcc
mkmewpnfqqggemerqfqqdggdtsnglCVKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQNEiagmrmgnpyfdpfvasgsqkltarqrwtptpaqlQILEHVYdeckgtprkqKIQDMTAELAKhgqisetnvYNWFQNRRARLkrkqsgvvpnnaeseaetvthaesrkqnpesiqsledsappprdediypqspdlgnkfFCFNVLLNKYKLIFSHM
mkmewpnfqQGGEMERQFQQDGGDTSNGLCVKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQNEIAGMRMGNPYFDPFVASGSQKLTARQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAkhgqisetnvyNWFQNRRARLkrkqsgvvpnnaeseaetvthaesrkqnpesiqsledsapppRDEDIYPQSPDLGNKFFCFNVLLNKYKLIFSHM
MKMEWPNFQQGGEMERQFQQDGGDTSNGLCVKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQNEIAGMRMGNPYFDPFVASGSQKLTARQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQNRRARLKRKQSGVVPNNAESEAETVTHAESRKQNPESIQSLEDSAPPPRDEDIYPQSPDLGNKFFCFNVLLNKYKLIFSHM
***************************GLCVKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQNEIAGMRMGNPYFDPFVASGSQKLTARQRWTPTPAQLQILEHVYDECKG**************AKHGQISETNVYNWFQN**********************************************************LGNKFFCFNVLLNKYKLIF***
*****************************CVKVMTDEQMELLRKQIAVYAMICE********************************************TPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQN*****************************************************************************S**
********QQGGEMERQFQQDGGDTSNGLCVKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQNEIAGMRMGNPYFDPFVASGSQKLTARQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQNRRAR*******************************************RDEDIYPQSPDLGNKFFCFNVLLNKYKLIFSHM
************************TSNGLCVKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQNEIAGMRMGNPYFDPFVAS******ARQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQNRRARLKR****************************************RDEDIYPQSPDLGNKFFCFNVLLNKYKLIFSHM
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKMEWPNFQQGGEMERQFQQDGGDTSNGLCVKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQNEIAGMRMGNPYFDPFVASGSQKLTARQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQNRRARLKRKQSGVVPNNAESEAETVTHAESRKQNPESIQSLEDSAPPPRDEDIYPQSPDLGNKFFCFNVLLNKYKLIFSHM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query226 2.2.26 [Sep-21-2011]
Q5QMM3267 WUSCHEL-related homeobox yes no 0.579 0.490 0.706 2e-51
O81788268 WUSCHEL-related homeobox yes no 0.827 0.697 0.502 1e-50
Q9LM84211 WUSCHEL-related homeobox no no 0.738 0.791 0.511 5e-42
Q9LM83197 Putative WUSCHEL-related no no 0.787 0.903 0.472 2e-31
Q9SIB4 244 WUSCHEL-related homeobox no no 0.283 0.262 0.484 4e-10
Q6X7K0 350 WUSCHEL-related homeobox no no 0.269 0.174 0.459 4e-10
Q6X7J5 325 WUSCHEL-related homeobox no no 0.274 0.190 0.403 1e-09
Q6X7J4 378 WUSCHEL-related homeobox no no 0.274 0.164 0.387 3e-09
Q5W7C3 286 Putative WUSCHEL-related no no 0.265 0.209 0.466 3e-09
A2XZR3 286 Putative WUSCHEL-related N/A no 0.265 0.209 0.466 3e-09
>sp|Q5QMM3|WOX8_ORYSJ WUSCHEL-related homeobox 8 OS=Oryza sativa subsp. japonica GN=WOX8 PE=2 SV=1 Back     alignment and function desciption
 Score =  202 bits (514), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 94/133 (70%), Positives = 114/133 (85%), Gaps = 2/133 (1%)

Query: 31  VKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQ-NEIAGMRMGNPYFDPFVASGSQK 89
           VKVMTDEQME+LRKQI++YA ICEQLV+MH+  +AQ + IAGMR+GN Y DP +  G  K
Sbjct: 27  VKVMTDEQMEVLRKQISIYATICEQLVEMHRALTAQQDSIAGMRLGNLYCDPLMVPGGHK 86

Query: 90  LTARQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQNRRA 149
           +TARQRWTPTP QLQILE+++D+  GTP KQKI+D+TAEL++HGQISETNVYNWFQNRRA
Sbjct: 87  ITARQRWTPTPMQLQILENIFDQGNGTPSKQKIKDITAELSQHGQISETNVYNWFQNRRA 146

Query: 150 RLKRKQSGVVPNN 162
           R KRKQ+  +PNN
Sbjct: 147 RSKRKQAA-LPNN 158
Transcription factor which may be involved in developmental processes.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|O81788|WOX13_ARATH WUSCHEL-related homeobox 13 OS=Arabidopsis thaliana GN=WOX13 PE=2 SV=1 Back     alignment and function description
>sp|Q9LM84|WOX14_ARATH WUSCHEL-related homeobox 14 OS=Arabidopsis thaliana GN=WOX14 PE=2 SV=1 Back     alignment and function description
>sp|Q9LM83|WOX10_ARATH Putative WUSCHEL-related homeobox 10 OS=Arabidopsis thaliana GN=WOX10 PE=3 SV=1 Back     alignment and function description
>sp|Q9SIB4|WOX3_ARATH WUSCHEL-related homeobox 3 OS=Arabidopsis thaliana GN=WOX3 PE=2 SV=1 Back     alignment and function description
>sp|Q6X7K0|WOX1_ARATH WUSCHEL-related homeobox 1 OS=Arabidopsis thaliana GN=WOX1 PE=2 SV=2 Back     alignment and function description
>sp|Q6X7J5|WOX8_ARATH WUSCHEL-related homeobox 8 OS=Arabidopsis thaliana GN=WOX8 PE=2 SV=1 Back     alignment and function description
>sp|Q6X7J4|WOX9_ARATH WUSCHEL-related homeobox 9 OS=Arabidopsis thaliana GN=WOX9 PE=2 SV=1 Back     alignment and function description
>sp|Q5W7C3|WOX2_ORYSJ Putative WUSCHEL-related homeobox 2 OS=Oryza sativa subsp. japonica GN=WOX2 PE=3 SV=1 Back     alignment and function description
>sp|A2XZR3|WOX2_ORYSI Putative WUSCHEL-related homeobox 2 OS=Oryza sativa subsp. indica GN=WOX2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query226
225457574279 PREDICTED: WUSCHEL-related homeobox 8 [V 0.853 0.691 0.602 2e-61
449455611269 PREDICTED: WUSCHEL-related homeobox 13-l 0.898 0.754 0.570 7e-60
147865345243 hypothetical protein VITISV_018997 [Viti 0.831 0.773 0.596 1e-59
224065679215 predicted protein [Populus trichocarpa] 0.858 0.902 0.582 8e-59
40233067217 homeodomain protein HB1 [Populus tomento 0.858 0.894 0.582 1e-58
3955019217 HB1 homeodomain protein [Populus tremula 0.858 0.894 0.582 1e-58
224081491248 predicted protein [Populus trichocarpa] 0.787 0.717 0.618 2e-58
3955021261 HB2 homeodomain protein [Populus tremula 0.787 0.681 0.618 3e-58
40233087257 homeodomain protein HB2 [Populus tomento 0.787 0.692 0.613 7e-58
224083324216 predicted protein [Populus trichocarpa] 0.800 0.837 0.597 1e-57
>gi|225457574|ref|XP_002272420.1| PREDICTED: WUSCHEL-related homeobox 8 [Vitis vinifera] gi|297745565|emb|CBI40730.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 151/196 (77%), Gaps = 3/196 (1%)

Query: 29  LCVKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQNEIAGMRMGNPYFDPFVASGSQ 88
           L VKVMTDEQMELLR+QI+VYA ICEQLV+MHK  + Q ++AGMR+GN Y DP +AS   
Sbjct: 32  LYVKVMTDEQMELLRRQISVYATICEQLVEMHKAITTQQDLAGMRLGNIYCDPLMASAGH 91

Query: 89  KLTARQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQNRR 148
           K+++RQRWTPTP QLQILE ++D+  GTP KQKI+++T EL +HGQISETNVYNWFQNRR
Sbjct: 92  KISSRQRWTPTPVQLQILERIFDQGNGTPSKQKIKEITTELTQHGQISETNVYNWFQNRR 151

Query: 149 ARLKRKQSGVVPNNAESEAET-VTHAESRKQNPESIQSLEDSAPPPRDEDIYPQSPDLGN 207
           AR KRKQS  +PNNA+SE ET V   + +K  P++IQS E+SA     E+IY QSP++G+
Sbjct: 152 ARSKRKQSVPLPNNADSEVETDVESPKEKKTKPDNIQSHENSA--LGTENIYFQSPEMGS 209

Query: 208 KFFCFNVLLNKYKLIF 223
           +  C +   NK + +F
Sbjct: 210 EMHCLDTQPNKGEPMF 225

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449455611|ref|XP_004145546.1| PREDICTED: WUSCHEL-related homeobox 13-like [Cucumis sativus] gi|449519581|ref|XP_004166813.1| PREDICTED: WUSCHEL-related homeobox 13-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147865345|emb|CAN84082.1| hypothetical protein VITISV_018997 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224065679|ref|XP_002301917.1| predicted protein [Populus trichocarpa] gi|222843643|gb|EEE81190.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|40233067|gb|AAR83340.1| homeodomain protein HB1 [Populus tomentosa] gi|40233103|gb|AAR83342.1| homeodomain protein HB1 [Populus tomentosa] Back     alignment and taxonomy information
>gi|3955019|emb|CAA09366.1| HB1 homeodomain protein [Populus tremula x Populus tremuloides] Back     alignment and taxonomy information
>gi|224081491|ref|XP_002306432.1| predicted protein [Populus trichocarpa] gi|222855881|gb|EEE93428.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|3955021|emb|CAA09367.1| HB2 homeodomain protein [Populus tremula x Populus tremuloides] Back     alignment and taxonomy information
>gi|40233087|gb|AAR83341.1| homeodomain protein HB2 [Populus tomentosa] Back     alignment and taxonomy information
>gi|224083324|ref|XP_002306983.1| predicted protein [Populus trichocarpa] gi|222856432|gb|EEE93979.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query226
TAIR|locus:2127968268 WOX13 "AT4G35550" [Arabidopsis 0.823 0.694 0.561 9.5e-50
TAIR|locus:2030467211 WOX14 "AT1G20700" [Arabidopsis 0.823 0.881 0.474 1.4e-39
TAIR|locus:2030487197 WOX10 "AT1G20710" [Arabidopsis 0.796 0.913 0.461 5.7e-36
UNIPROTKB|Q33DK1203 WOX3 "WUSCHEL-related homeobox 0.283 0.315 0.468 3.5e-11
TAIR|locus:2088550 350 WOX1 "WUSCHEL related homeobox 0.362 0.234 0.4 2.9e-10
TAIR|locus:2065484 244 PRS "PRESSED FLOWER" [Arabidop 0.278 0.258 0.492 8.8e-10
TAIR|locus:2096429 297 WOX11 "AT3G03660" [Arabidopsis 0.402 0.306 0.369 1.6e-09
TAIR|locus:2825767251 WOX4 "WUSCHEL related homeobox 0.269 0.243 0.459 4.2e-09
TAIR|locus:2060902 292 WUS "AT2G17950" [Arabidopsis t 0.424 0.328 0.362 7.8e-09
TAIR|locus:2049547271 PFS2 "PRETTY FEW SEEDS 2" [Ara 0.283 0.236 0.439 8e-09
TAIR|locus:2127968 WOX13 "AT4G35550" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 518 (187.4 bits), Expect = 9.5e-50, P = 9.5e-50
 Identities = 110/196 (56%), Positives = 130/196 (66%)

Query:     3 MEWPN-FQQGGEMERQFQQ---DGGD-TSNGLCVKVMTDEQMELLRKQIAVYAMICEQLV 57
             MEW N  Q         Q    +GG     G+ VKVMTDEQ E LRKQIA+Y  ICE+LV
Sbjct:     2 MEWDNQLQPNNHHSSNLQGIDVNGGSGAGGGMYVKVMTDEQYETLRKQIAIYGTICERLV 61

Query:    58 QMHKVFSAQNEIAGMRMGNPYFDPFVASGSQKLTARQRWTPTPAQLQILEHVYDECKGTP 117
             +MHK  +AQ ++AG RMG  Y DP ++S   K+TARQRWTPTP QLQILE ++D+  GTP
Sbjct:    62 EMHKTLTAQQDLAGGRMGGLYADPMMSSLGHKMTARQRWTPTPVQLQILERIFDQGTGTP 121

Query:   118 RKQKIQDMTAELAKHGQISETNVYNWFQNRRARLKRKQSGVVP---NNAESEAETVTHA- 173
              KQKI+D+T EL++HGQI+E NVYNWFQNRRAR KRKQ G      NN ESE ET   A 
Sbjct:   122 SKQKIKDITEELSQHGQIAEQNVYNWFQNRRARSKRKQHGGGSSGNNNGESEVETEVEAL 181

Query:   174 -ESRKQNPESIQSLED 188
              E R   PES+  L D
Sbjct:   182 NEKRVVRPESLLGLPD 197
GO:0003677 "DNA binding" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
TAIR|locus:2030467 WOX14 "AT1G20700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030487 WOX10 "AT1G20710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q33DK1 WOX3 "WUSCHEL-related homeobox 3" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2088550 WOX1 "WUSCHEL related homeobox 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065484 PRS "PRESSED FLOWER" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096429 WOX11 "AT3G03660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825767 WOX4 "WUSCHEL related homeobox 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060902 WUS "AT2G17950" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2049547 PFS2 "PRETTY FEW SEEDS 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O81788WOX13_ARATHNo assigned EC number0.50230.82740.6977yesno
Q5QMM3WOX8_ORYSJNo assigned EC number0.70670.57960.4906yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00002895001
SubName- Full=Chromosome chr18 scaffold_137, whole genome shotgun sequence; (278 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
pfam0004657 pfam00046, Homeobox, Homeobox domain 2e-14
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 2e-11
smart0038957 smart00389, HOX, Homeodomain 2e-10
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 4e-04
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 64.8 bits (159), Expect = 2e-14
 Identities = 25/61 (40%), Positives = 37/61 (60%), Gaps = 5/61 (8%)

Query: 93  RQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQNRRARLK 152
           R+R T TP QL+ LE  +++ +  P  ++ +    ELAK   ++E  V  WFQNRRA+ K
Sbjct: 2   RKRTTFTPEQLEELEKEFEKNR-YPSAEERE----ELAKKLGLTERQVKVWFQNRRAKWK 56

Query: 153 R 153
           R
Sbjct: 57  R 57

Length = 57
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 226
KOG3802398 consensus Transcription factor OCT-1, contains POU 99.98
KOG0488309 consensus Transcription factor BarH and related HO 99.75
KOG0489261 consensus Transcription factor zerknullt and relat 99.74
KOG0484125 consensus Transcription factor PHOX2/ARIX, contain 99.74
KOG0850245 consensus Transcription factor DLX and related pro 99.7
KOG1168385 consensus Transcription factor ACJ6/BRN-3, contain 99.69
KOG0842307 consensus Transcription factor tinman/NKX2-3, cont 99.69
KOG2251228 consensus Homeobox transcription factor [Transcrip 99.69
KOG0843197 consensus Transcription factor EMX1 and related HO 99.69
KOG4577383 consensus Transcription factor LIM3, contains LIM 99.67
KOG0487308 consensus Transcription factor Abd-B, contains HOX 99.66
KOG0485268 consensus Transcription factor NKX-5.1/HMX1, conta 99.65
KOG0492246 consensus Transcription factor MSH, contains HOX d 99.64
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.63
KOG0494332 consensus Transcription factor CHX10 and related H 99.61
KOG0848317 consensus Transcription factor Caudal, contains HO 99.54
KOG0491194 consensus Transcription factor BSH, contains HOX d 99.52
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.49
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.48
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.48
KOG0847288 consensus Transcription factor, contains HOX domai 99.46
KOG0493342 consensus Transcription factor Engrailed, contains 99.45
KOG0844408 consensus Transcription factor EVX1, contains HOX 99.43
COG5576156 Homeodomain-containing transcription factor [Trans 99.42
KOG0486 351 consensus Transcription factor PTX1, contains HOX 99.41
KOG0483198 consensus Transcription factor HEX, contains HOX a 99.39
KOG0490235 consensus Transcription factor, contains HOX domai 99.31
KOG0849354 consensus Transcription factor PRD and related pro 99.01
PF0015775 Pou: Pou domain - N-terminal to homeobox domain; I 98.8
KOG0775304 consensus Transcription factor SIX and related HOX 98.75
KOG0774334 consensus Transcription factor PBX and related HOX 98.56
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.17
KOG0490235 consensus Transcription factor, contains HOX domai 98.02
smart0035275 POU Found in Pit-Oct-Unc transcription factors. 97.93
KOG2252558 consensus CCAAT displacement protein and related h 97.82
KOG1146 1406 consensus Homeobox protein [General function predi 97.22
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 96.18
KOG0773342 consensus Transcription factor MEIS1 and related H 94.72
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 93.91
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 89.09
PF0888037 QLQ: QLQ; InterPro: IPR014978 QLQ is named after t 88.6
>KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] Back     alignment and domain information 
Probab=99.98  E-value=1.3e-33  Score=255.05  Aligned_cols=141  Identities=18%  Similarity=0.195  Sum_probs=123.7

Q ss_pred             CCcccchhhhhhhccCCCCCCCcccccCCHHHHHHHHHHHHHHHHHHHHHHHhhhhhccccccccCCCCCCCCCCcccCC
Q 027250            7 NFQQGGEMERQFQQDGGDTSNGLCVKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQNEIAGMRMGNPYFDPFVASG   86 (226)
Q Consensus         7 ~~~~~~~~~~~~q~~~~~~~g~~~~~~~t~~~~~~lr~qi~~~~~ic~q~~~~~~~l~~~~~~~~~~~~~~~~~p~~~~~   86 (226)
                      .|+|++++.+++|+|||+|+|++||+||||++||||+++.++|++||+..+++.|||.+++..... .+..+.+.+.   
T Consensus       214 ~FKqRRIkLGfTQaDVGlALG~lyGn~FSQTTIcRFEALqLSFKNMCKLKPLL~KWLeEAes~~~~-~~~~~~e~i~---  289 (398)
T KOG3802|consen  214 TFKQRRIKLGFTQADVGLALGALYGNVFSQTTICRFEALQLSFKNMCKLKPLLEKWLEEAESREST-GSPNSIEKIG---  289 (398)
T ss_pred             HHHhheeccccchhHHHHHHHhhhCcccchhhhhHhHhhccCHHHHhhhHHHHHHHHHHHhccccc-CCCCCHHHhh---
Confidence            589999999999999999999999999999999999999999999999999999999999863111 1122222222   


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHhhcCCCCCHHHHHHHHHHHHhhCCCcccccccchhhhHHHHHHhhc
Q 027250           87 SQKLTARQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQNRRARLKRKQS  156 (226)
Q Consensus        87 ~~~~~rr~Rt~~s~~Ql~~Le~~F~~~~~~p~~~~r~~LA~~L~~~~~ls~~~V~vWFQNRRak~Kr~~~  156 (226)
                      ...++|++||.+....+..||+.|.+| +.|+..+|..||.+|    +|+..+|+|||||||.|+||...
T Consensus       290 a~~RkRKKRTSie~~vr~aLE~~F~~n-pKPt~qEIt~iA~~L----~leKEVVRVWFCNRRQkeKR~~~  354 (398)
T KOG3802|consen  290 AQSRKRKKRTSIEVNVRGALEKHFLKN-PKPTSQEITHIAESL----QLEKEVVRVWFCNRRQKEKRITP  354 (398)
T ss_pred             ccccccccccceeHHHHHHHHHHHHhC-CCCCHHHHHHHHHHh----ccccceEEEEeeccccccccCCC
Confidence            222688899999999999999999999 899999999999999    99999999999999999999666

>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] Back     alignment and domain information
>KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] Back     alignment and domain information
>KOG2251 consensus Homeobox transcription factor [Transcription] Back     alignment and domain information
>KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0485 consensus Transcription factor NKX-5 Back     alignment and domain information
>KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0847 consensus Transcription factor, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] Back     alignment and domain information
>PF00157 Pou: Pou domain - N-terminal to homeobox domain; InterPro: IPR000327 POU proteins are eukaryotic transcription factors containing a bipartite DNA binding domain referred to as the POU domain Back     alignment and domain information
>KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>smart00352 POU Found in Pit-Oct-Unc transcription factors Back     alignment and domain information
>KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF08880 QLQ: QLQ; InterPro: IPR014978 QLQ is named after the conserved Gln, Leu, Gln motif Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 1e-15
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 6e-11
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 3e-10
1lfb_A99 Liver transcription factor (LFB1); transcription r 4e-09
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 9e-09
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 1e-08
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 1e-08
2xsd_C164 POU domain, class 3, transcription factor 1; trans 2e-08
1uhs_A72 HOP, homeodomain only protein; structural genomics 7e-08
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 1e-07
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 3e-07
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 4e-07
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 9e-07
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 9e-07
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 2e-06
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 2e-06
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 2e-06
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 3e-06
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 3e-06
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 4e-06
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 5e-06
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 6e-06
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 1e-05
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 1e-05
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 1e-05
3d1n_I151 POU domain, class 6, transcription factor 1; prote 1e-05
1e3o_C160 Octamer-binding transcription factor 1; transcript 2e-05
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 2e-05
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 2e-05
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 2e-05
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 3e-05
3a02_A60 Homeobox protein aristaless; homeodomain, developm 3e-05
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 3e-05
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 4e-05
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 4e-05
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 4e-05
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 4e-05
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 7e-05
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 8e-05
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 9e-05
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 9e-05
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 1e-04
3a01_A93 Homeodomain-containing protein; homeodomain, prote 1e-04
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 2e-04
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 2e-04
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 2e-04
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 2e-04
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 3e-04
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 4e-04
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 6e-04
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 8e-04
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
 Score = 68.9 bits (168), Expect = 1e-15
 Identities = 19/88 (21%), Positives = 40/88 (45%), Gaps = 14/88 (15%)

Query: 93  RQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAE-----------LAKHGQISETNVY 141
             R+T     L ++E  ++E +  P + K +++              L+   +++   VY
Sbjct: 9   GSRFTWRKECLAVMESYFNENQ-YPDEAKREEIANACNAVIQKPGKKLSDLERVTSLKVY 67

Query: 142 NWFQNRRARLKRKQ--SGVVPNNAESEA 167
           NWF NRR  +KR+   + ++ ++  S  
Sbjct: 68  NWFANRRKEIKRRANIAAILESSGPSSG 95
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query226
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.95
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.95
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.95
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.94
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.94
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.81
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.8
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.8
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.79
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.79
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.79
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.78
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.78
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.78
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.78
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.78
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.78
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.78
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.78
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.78
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.78
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.78
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.78
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.77
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.77
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.77
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.77
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.77
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.77
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.77
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.77
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.76
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.76
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.76
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.76
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.76
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.76
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.76
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.75
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.75
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.75
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.75
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.74
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.74
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.74
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.74
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.74
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.73
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.73
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.73
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.73
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.72
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.72
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.72
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.71
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.69
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.69
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.69
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.69
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.69
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.68
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.68
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.68
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.68
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.67
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.66
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.65
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.65
2e19_A64 Transcription factor 8; homeobox domain, structura 99.64
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.63
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.59
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.59
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.53
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.43
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.39
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.29
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.22
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.71
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 93.84
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
Probab=99.95  E-value=7.6e-30  Score=205.17  Aligned_cols=134  Identities=20%  Similarity=0.263  Sum_probs=112.6

Q ss_pred             CcccchhhhhhhccCCCCCCCcccccCCHHHHHHHHHHHHHHHHHHHHHHHhhhhhccccccccCCCCCCCCCCcccCCC
Q 027250            8 FQQGGEMERQFQQDGGDTSNGLCVKVMTDEQMELLRKQIAVYAMICEQLVQMHKVFSAQNEIAGMRMGNPYFDPFVASGS   87 (226)
Q Consensus         8 ~~~~~~~~~~~q~~~~~~~g~~~~~~~t~~~~~~lr~qi~~~~~ic~q~~~~~~~l~~~~~~~~~~~~~~~~~p~~~~~~   87 (226)
                      |++.++..+..|+|||.++|.+||+++|+++||+|+++.+++.++|+..+.+.+|+.+.+...+.        +....+.
T Consensus        12 ~k~~ri~lg~tQ~~vg~al~~l~g~~~Sqtti~rfe~l~ls~knm~kLkPlL~~wl~e~e~~~~~--------~~~~~~~   83 (146)
T 1au7_A           12 FKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGAL--------YNEKVGA   83 (146)
T ss_dssp             HHHHHHHHTCCHHHHHHHHHHTTSSCCCHHHHHHHHTTCSBHHHHHHHHHHHHHHHHHCCC-------------------
T ss_pred             HHHHHHhccCcHHhhhhhcchhccCCCCcchHHHHhccCCChHHHHhcchHHHHHHHHhhcccCc--------cCcccCC
Confidence            45667888999999999999999999999999999999999999999999999999998653221        1112233


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHhhcCCCCCHHHHHHHHHHHHhhCCCcccccccchhhhHHHHHHh
Q 027250           88 QKLTARQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQNRRARLKRK  154 (226)
Q Consensus        88 ~~~~rr~Rt~~s~~Ql~~Le~~F~~~~~~p~~~~r~~LA~~L~~~~~ls~~~V~vWFQNRRak~Kr~  154 (226)
                      .+++||.|+.|+..|+.+||..|..+ +||+..+|..||..|    ||++++|+|||||||+|+||+
T Consensus        84 ~~~~rr~Rt~ft~~Q~~~Le~~F~~~-~yp~~~~r~~LA~~l----~L~~~qV~vWFqNRR~k~kr~  145 (146)
T 1au7_A           84 NERKRKRRTTISIAAKDALERHFGEH-SKPSSQEIMRMAEEL----NLEKEVVRVWFCNRRQREKRV  145 (146)
T ss_dssp             -----CCCCCCCHHHHHHHHHHHHHC-SSCCHHHHHHHHHHH----TCCHHHHHHHHHHHHHHTTSC
T ss_pred             CCCCCCCCcCccHHHHHHHHHHHHHc-CCCCHHHHHHHHHHh----CCChhhchhhhHhhhhhhhcc
Confidence            45678899999999999999999999 999999999999999    999999999999999999985
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 226
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 3e-11
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 3e-11
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 4e-11
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 5e-11
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 2e-10
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 4e-10
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 5e-10
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 6e-10
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 1e-09
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 1e-09
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 2e-09
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 2e-09
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 3e-09
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 3e-09
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 3e-09
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 4e-09
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 6e-09
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 6e-09
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 9e-09
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 1e-08
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 1e-08
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 1e-08
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 2e-08
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 5e-08
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 5e-08
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 6e-08
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 6e-08
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 1e-07
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 2e-07
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 7e-07
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 3e-06
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 4e-05
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: pbx1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 55.4 bits (133), Expect = 3e-11
 Identities = 18/63 (28%), Positives = 27/63 (42%), Gaps = 2/63 (3%)

Query: 93  RQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQNRRARLK 152
           R+R        +IL   +      P   +  +   ELAK   I+ + V NWF N+R R K
Sbjct: 3   RKRRNFNKQATEILNEYFYSHLSNPYPSE--EAKEELAKKCGITVSQVSNWFGNKRIRYK 60

Query: 153 RKQ 155
           +  
Sbjct: 61  KNI 63
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query226
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.82
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.82
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.82
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.82
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.82
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.81
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.81
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.8
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.8
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.8
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.8
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.79
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.79
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.78
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.78
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.76
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.76
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.75
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.74
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.74
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.72
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.72
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.71
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.67
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.66
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.65
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.64
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.63
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.59
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.54
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.5
d1e3oc275 Oct-1 {Human (Homo sapiens) [TaxId: 9606]} 99.1
d1au7a272 Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.07
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 80.07
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.82  E-value=1.8e-21  Score=131.42  Aligned_cols=57  Identities=32%  Similarity=0.463  Sum_probs=54.9

Q ss_pred             CCCCCCCCHHHHHHHHHHHhhcCCCCCHHHHHHHHHHHHhhCCCcccccccchhhhHHHHHH
Q 027250           92 ARQRWTPTPAQLQILEHVYDECKGTPRKQKIQDMTAELAKHGQISETNVYNWFQNRRARLKR  153 (226)
Q Consensus        92 rr~Rt~~s~~Ql~~Le~~F~~~~~~p~~~~r~~LA~~L~~~~~ls~~~V~vWFQNRRak~Kr  153 (226)
                      |+.|+.||+.|+.+||..|..+ +||+..++++||..|    ||++.+|+|||||||+|+||
T Consensus         2 rr~Rt~ft~~Q~~~Le~~F~~~-~yp~~~~r~~LA~~l----~l~~~qV~vWFqNrR~k~kk   58 (58)
T d2craa1           2 RKKRIPYSKGQLRELEREYAAN-KFITKDKRRKISAAT----SLSERQITIWFQNRRVKEKK   58 (58)
T ss_dssp             CCSCCCSCHHHHHHHHHHHHHC-SSCCHHHHHHHHHHT----CCCHHHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCCHHHHHHHHHHHhhc-CCCCHHHHHHHHHHc----CCCHHHeeecccchhhhccC
Confidence            6778999999999999999999 999999999999999    99999999999999999875
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc2 a.35.1.1 (C:1-75) Oct-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a2 a.35.1.1 (A:5-76) Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure