Citrus Sinensis ID: 027304


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
MTMELLRNLIPLMSLCFLVVFVQCKSSLLGVHPLDEKYFSKEVIKCKDGSKSFTRDRLNDNFCDCIDGTDEPGTSACPAGKFYCGNVGSTPQFIFSSRVNDRICDCCDGSDEYDSSIKCPNTCVMGGNIEYKAQSYISTINDAGSIDARGAKIPVNKEDLIERLGVLFVHNRYAPVKLKSLRDLSFSLVFADVKMVVILQSFVIIFLVFLWIMHHSVRSKRRHSR
ccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEcccccEEccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHccccccEEEccccEEEcHHHcccccccccccccccccccccccEEEEEcccccccEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccccc
MTMELLRNLIPLMSLCFLVVFVQCKssllgvhpldekyfskevikckdgsksftrdrlndnfcdcidgtdepgtsacpagkfycgnvgstpqfifssrvndricdccdgsdeydssikcpntcvmggnieYKAQSYISTindagsidargakipvnkedLIERLGVlfvhnryapvklkslrDLSFSLVFADVKMVVILQSFVIIFLVFLWIMHHSVRSKRRHSR
MTMELLRNLIPLMSLCFLVVFVQCKSSLLGVHPLDEKYFSKEVikckdgsksftrdrlnDNFCDCIDGTDEPGTSACPAGKFYCGNVGSTPQFIFSSRVNDRICDCCDGSDEYDSSIKCPNTCVMGGNIEYKAQSYISTINDAGSIDARGAKIPVNKEDLIERLGVLFVHNRYAPVKLKSLRDLSFSLVFADVKMVVILQSFVIIFLVFLWIMHHsvrskrrhsr
MTMELLRNLIPLMSLCFLVVFVQCKSSLLGVHPLDEKYFSKEVIKCKDGSKSFTRDRLNDNFCDCIDGTDEPGTSACPAGKFYCGNVGSTPQFIFSSRVNDRICDCCDGSDEYDSSIKCPNTCVMGGNIEYKAQSYISTINDAGSIDARGAKIPVNKEDLIERLGVLFVHNRYAPVKLKSLRDLSFSLVFADVKMVVILQSFVIIFLVFLWIMhhsvrskrrhsr
****LLRNLIPLMSLCFLVVFVQCKSSLLGVHPLDEKYFSKEVIKCKDGSKSFTRDRLNDNFCDCIDGTDEPGTSACPAGKFYCGNVGSTPQFIFSSRVNDRICDCC*************NTCVMGGNIEYKAQSYISTINDAGSIDARGAKIPVNKEDLIERLGVLFVHNRYAPVKLKSLRDLSFSLVFADVKMVVILQSFVIIFLVFLWIMHH**********
******R**IPLMSLCFLVVFVQCKSSLLGVHPLDEKYFSKEVIKCKDGSKSFTRDRLNDNFCDCIDGTDEPGTSACPAGKFYCGNVGSTPQFIFSSRVNDRICDCCDGSDEYDSSIKCPNTCVMGGNIEYKAQSYIST*********************************************************VILQSFVIIFLVFLWIMHH**********
MTMELLRNLIPLMSLCFLVVFVQCKSSLLGVHPLDEKYFSKEVIKCKDGSKSFTRDRLNDNFCDCIDGTDEPGTSACPAGKFYCGNVGSTPQFIFSSRVNDRICDCCDGSDEYDSSIKCPNTCVMGGNIEYKAQSYISTINDAGSIDARGAKIPVNKEDLIERLGVLFVHNRYAPVKLKSLRDLSFSLVFADVKMVVILQSFVIIFLVFLWIMHH**********
MTMELLRNLIPLMSLCFLVVFVQCKSSLLGVHPLDEKYFSKEVIKCKDGSKSFTRDRLNDNFCDCIDGTDEPGTSACPAGKFYCGNVGSTPQFIFSSRVNDRICDCCDGSDEYDSSIKCPNTCVMGGNIEYKAQSYISTINDAGSIDARGAKIPVNKEDLIERLGVLFVHNRYAPVKLKSLRDLSFSLVFADVKMVVILQSFVIIFLVFLWIMHHSVR*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
iiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
SSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTMELLRNLIPLMSLCFLVVFVQCKSSLLGVHPLDEKYFSKEVIKCKDGSKSFTRDRLNDNFCDCIDGTDEPGTSACPAGKFYCGNVGSTPQFIFSSRVNDRICDCCDGSDEYDSSIKCPNTCVMGGNIEYKAQSYISTINDAGSIDARGAKIPVNKEDLIERLGVLFVHNRYAPVKLKSLRDLSFSLVFADVKMVVILQSFVIIFLVFLWIMHHSVRSKRRHSR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query225 2.2.26 [Sep-21-2011]
O08795 521 Glucosidase 2 subunit bet yes no 0.56 0.241 0.418 5e-26
P14314 528 Glucosidase 2 subunit bet yes no 0.564 0.240 0.415 8e-26
Q28034 533 Glucosidase 2 subunit bet yes no 0.564 0.238 0.415 5e-24
Q9USH8 506 Glucosidase 2 subunit bet yes no 0.448 0.199 0.486 1e-23
Q04924 702 Glucosidase 2 subunit bet yes no 0.248 0.079 0.485 1e-10
Q7TQH7 713 Low-density lipoprotein r no no 0.28 0.088 0.373 3e-05
>sp|O08795|GLU2B_MOUSE Glucosidase 2 subunit beta OS=Mus musculus GN=Prkcsh PE=1 SV=1 Back     alignment and function desciption
 Score =  117 bits (294), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 54/129 (41%), Positives = 76/129 (58%), Gaps = 3/129 (2%)

Query: 16  CFLVVFVQCKSSLLGVHPLDEKYFSKEVIKCKDGSKSFTRDRLNDNFCDCIDGTDEPGTS 75
           C+ V   + +   L  H     Y   +   C DG+ +   D++ND++CDC DG+DEPGT+
Sbjct: 12  CWAVEVKRPRGVSLSNHHF---YEESKPFTCLDGTATIPFDQVNDDYCDCKDGSDEPGTA 68

Query: 76  ACPAGKFYCGNVGSTPQFIFSSRVNDRICDCCDGSDEYDSSIKCPNTCVMGGNIEYKAQS 135
           ACP G F+C N G  P +I SSRVND +CDCCDG+DEY+S   C NTC   G  E ++  
Sbjct: 69  ACPNGSFHCTNTGYKPLYILSSRVNDGVCDCCDGTDEYNSGTVCENTCREKGRKEKESLQ 128

Query: 136 YISTINDAG 144
            ++ +   G
Sbjct: 129 QLAEVTREG 137




Regulatory subunit of glucosidase II.
Mus musculus (taxid: 10090)
>sp|P14314|GLU2B_HUMAN Glucosidase 2 subunit beta OS=Homo sapiens GN=PRKCSH PE=1 SV=2 Back     alignment and function description
>sp|Q28034|GLU2B_BOVIN Glucosidase 2 subunit beta OS=Bos taurus GN=PRKCSH PE=2 SV=1 Back     alignment and function description
>sp|Q9USH8|GLU2B_SCHPO Glucosidase 2 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gtb1 PE=1 SV=1 Back     alignment and function description
>sp|Q04924|GLU2B_YEAST Glucosidase 2 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GTB1 PE=1 SV=1 Back     alignment and function description
>sp|Q7TQH7|LRP10_MOUSE Low-density lipoprotein receptor-related protein 10 OS=Mus musculus GN=Lrp10 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
224122030213 predicted protein [Populus trichocarpa] 0.817 0.863 0.548 9e-57
449453541199 PREDICTED: uncharacterized protein LOC10 0.826 0.934 0.546 1e-56
255568349210 glucosidase II beta subunit, putative [R 0.675 0.723 0.681 2e-55
302143378205 unnamed protein product [Vitis vinifera] 0.724 0.795 0.615 3e-54
225446519197 PREDICTED: glucosidase 2 subunit beta-li 0.724 0.827 0.615 3e-54
18405960212 protein kinase C substrate, heavy chain- 0.831 0.882 0.535 4e-53
297827917211 hypothetical protein ARALYDRAFT_903594 [ 0.813 0.867 0.502 2e-51
297788944211 predicted protein [Arabidopsis lyrata su 0.813 0.867 0.502 2e-51
224146511136 predicted protein [Populus trichocarpa] 0.546 0.904 0.790 5e-51
357474521225 Glucosidase 2 subunit beta [Medicago tru 0.866 0.866 0.551 2e-48
>gi|224122030|ref|XP_002330713.1| predicted protein [Populus trichocarpa] gi|222872317|gb|EEF09448.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  225 bits (574), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 119/217 (54%), Positives = 145/217 (66%), Gaps = 33/217 (15%)

Query: 8   NLIP-LMSLCFLVVFVQCKSSLLGVHPLDEKYFSKEVIKCKDGSKSFTRDRLNDNFCDCI 66
           NLIP ++SL FLV  V   S LLG+HPLDEKYF  +VIKCKDGSKSF+RDRLNDNFCDC+
Sbjct: 27  NLIPFIISLYFLVPSVHSFSPLLGIHPLDEKYFGSQVIKCKDGSKSFSRDRLNDNFCDCL 86

Query: 67  DGTDEPGTSACPAGKFYCGNVGSTPQFIFSSRVNDRICDCCDGSDEYDSSIKCPNTCVMG 126
           DGTDEPGTSACP GKFYC N GSTP FIFSSRVND+ICDCCDGSDEYDS I CP TCVMG
Sbjct: 87  DGTDEPGTSACPRGKFYCRNAGSTPNFIFSSRVNDQICDCCDGSDEYDSGINCPRTCVMG 146

Query: 127 GNIEYKAQSYISTINDAGSIDARGAKIPVNKEDLIERLGVLFVHNRYAPVKLKSLRDLSF 186
           GN+EY+A +YIS       ID + +K  +  E+L+++   L                   
Sbjct: 147 GNLEYRAGNYIS------RIDLKESKKGLISEELLQKARGL------------------- 181

Query: 187 SLVFADVKMVVILQSFVIIFLVFLWIMHHSVRSKRRH 223
                  K+++ILQ  +   +V   I +  ++SK+R 
Sbjct: 182 -------KVIIILQVVIFGCVVIYRIFNRRIKSKKRR 211




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449453541|ref|XP_004144515.1| PREDICTED: uncharacterized protein LOC101205514 [Cucumis sativus] gi|449517285|ref|XP_004165676.1| PREDICTED: uncharacterized protein LOC101230880 [Cucumis sativus] Back     alignment and taxonomy information
>gi|255568349|ref|XP_002525149.1| glucosidase II beta subunit, putative [Ricinus communis] gi|223535608|gb|EEF37276.1| glucosidase II beta subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|302143378|emb|CBI21939.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225446519|ref|XP_002278847.1| PREDICTED: glucosidase 2 subunit beta-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|18405960|ref|NP_565971.1| protein kinase C substrate, heavy chain-like protein [Arabidopsis thaliana] gi|20197489|gb|AAD23722.2| expressed protein [Arabidopsis thaliana] gi|21618247|gb|AAM67297.1| unknown [Arabidopsis thaliana] gi|30793891|gb|AAP40398.1| unknown protein [Arabidopsis thaliana] gi|30794054|gb|AAP40472.1| unknown protein [Arabidopsis thaliana] gi|110739276|dbj|BAF01551.1| hypothetical protein [Arabidopsis thaliana] gi|330255021|gb|AEC10115.1| protein kinase C substrate, heavy chain-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297827917|ref|XP_002881841.1| hypothetical protein ARALYDRAFT_903594 [Arabidopsis lyrata subsp. lyrata] gi|297327680|gb|EFH58100.1| hypothetical protein ARALYDRAFT_903594 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|297788944|ref|XP_002862496.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297308050|gb|EFH38754.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224146511|ref|XP_002326032.1| predicted protein [Populus trichocarpa] gi|222862907|gb|EEF00414.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357474521|ref|XP_003607545.1| Glucosidase 2 subunit beta [Medicago truncatula] gi|358347205|ref|XP_003637650.1| Glucosidase 2 subunit beta [Medicago truncatula] gi|355503585|gb|AES84788.1| Glucosidase 2 subunit beta [Medicago truncatula] gi|355508600|gb|AES89742.1| Glucosidase 2 subunit beta [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
TAIR|locus:2053771212 AT2G42390 "AT2G42390" [Arabido 0.711 0.754 0.615 1.1e-56
TAIR|locus:2161078 647 PSL4 "PRIORITY IN SWEET LIFE 4 0.48 0.166 0.631 5.7e-37
UNIPROTKB|K7EJ70144 PRKCSH "Glucosidase 2 subunit 0.604 0.944 0.432 2.2e-27
UNIPROTKB|K7EKX1140 PRKCSH "Glucosidase 2 subunit 0.604 0.971 0.432 2.2e-27
UNIPROTKB|K7EPW7168 PRKCSH "Glucosidase 2 subunit 0.604 0.809 0.432 2.2e-27
ZFIN|ZDB-GENE-040426-770 529 prkcsh "protein kinase C subst 0.506 0.215 0.512 4.4e-27
MGI|MGI:107877 521 Prkcsh "protein kinase C subst 0.608 0.262 0.428 5.2e-27
RGD|1309628 525 Prkcsh "protein kinase C subst 0.586 0.251 0.445 7e-27
UNIPROTKB|P14314 528 PRKCSH "Glucosidase 2 subunit 0.604 0.257 0.432 7.2e-27
UNIPROTKB|K7ELL7 535 PRKCSH "Glucosidase 2 subunit 0.604 0.254 0.432 7.7e-27
TAIR|locus:2053771 AT2G42390 "AT2G42390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 552 (199.4 bits), Expect = 1.1e-56, Sum P(2) = 1.1e-56
 Identities = 101/164 (61%), Positives = 127/164 (77%)

Query:     5 LLRNLIPLMSLCFLVVFVQCKSSLLGVHPLDEKYFSKEVIKCKDGSKSFTRDRLNDNFCD 64
             LL+ ++   SL  +V+ V   S L+GVHPLDEKYF  +VIKCKDGSKSFTRDRLNDNFCD
Sbjct:     2 LLQCVVLCSSLAVVVISVASTSPLVGVHPLDEKYFDSDVIKCKDGSKSFTRDRLNDNFCD 61

Query:    65 CIDGTDEPGTSACPAGKFYCGNVGSTPQFIFSSRVNDRICDCCDGSDEYDSSIKCPNTCV 124
             C+DGTDEPGTSACP GKFYC N+GS+P+F++SSRVNDRICDCCDGSDEY+SSI CPNTC+
Sbjct:    62 CLDGTDEPGTSACPNGKFYCRNIGSSPKFVYSSRVNDRICDCCDGSDEYESSIHCPNTCI 121

Query:   125 MGGNIEY--KAQSYISTIN-DAGSIDARGAKIPV-NKEDLIERL 164
             MGGN+ Y  K ++ + +I+   GS         + N +D+++ L
Sbjct:   122 MGGNVNYIYKPRANLKSIHLQLGSTPHPKEFYTIGNLQDMVKNL 165


GO:0003674 "molecular_function" evidence=ND
GO:0005576 "extracellular region" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2161078 PSL4 "PRIORITY IN SWEET LIFE 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|K7EJ70 PRKCSH "Glucosidase 2 subunit beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|K7EKX1 PRKCSH "Glucosidase 2 subunit beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|K7EPW7 PRKCSH "Glucosidase 2 subunit beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-770 prkcsh "protein kinase C substrate 80K-H" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:107877 Prkcsh "protein kinase C substrate 80K-H" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309628 Prkcsh "protein kinase C substrate 80K-H" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P14314 PRKCSH "Glucosidase 2 subunit beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|K7ELL7 PRKCSH "Glucosidase 2 subunit beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
pfam12999176 pfam12999, PRKCSH-like, Glucosidase II beta subuni 2e-31
>gnl|CDD|193472 pfam12999, PRKCSH-like, Glucosidase II beta subunit-like Back     alignment and domain information
 Score =  112 bits (283), Expect = 2e-31
 Identities = 62/162 (38%), Positives = 87/162 (53%), Gaps = 24/162 (14%)

Query: 9   LIPLMSLCFLVVFVQCKSSLLGVHPLDEKYFSKEV---IKCKDGSK---SFTRDRLNDNF 62
           L PL+++  LV        L GV P +   +  +     KC + S+   SF  D++ND++
Sbjct: 2   LQPLLAISLLVA--IALGKLRGVSPDNLHLYQPDENGNWKCLNHSEIKLSF--DQVNDDY 57

Query: 63  CDCIDGTDEPGTSACPAGKFYCGNVGSTPQFIFSSRVNDRICD---CCDGSDEYDSSIKC 119
           CDC DG+DEPGT+AC  GKFYC N G  P +I S +V+D +CD   CCDGSDE  +  KC
Sbjct: 58  CDCPDGSDEPGTNACSNGKFYCANEGFIPGYIPSFKVDDGVCDYDICCDGSDE--ALGKC 115

Query: 120 PNTCVMGGNIEYKAQSYISTINDAGSIDARGAKIPVNKEDLI 161
           PN C         A+ +   + +  +    G KI   KE L+
Sbjct: 116 PNKCGE------IARQFEEYLTEHNNSVKNGLKI---KEGLL 148


The sequences found in this family are similar to a region found in the beta-subunit of glucosidase II, which is also known as protein kinase C substrate 80K-H (PRKCSH). The enzyme catalyzes the sequential removal of two alpha-1,3-linked glucose residues in the second step of N-linked oligosaccharide processing. The beta subunit is required for the solubility and stability of the heterodimeric enzyme, and is involved in retaining the enzyme within the endoplasmic reticulum. Length = 176

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 225
PF12999176 PRKCSH-like: Glucosidase II beta subunit-like 99.96
KOG2397 480 consensus Protein kinase C substrate, 80 KD protei 99.8
PF0005737 Ldl_recept_a: Low-density lipoprotein receptor dom 98.96
cd0011235 LDLa Low Density Lipoprotein Receptor Class A doma 98.92
cd0011235 LDLa Low Density Lipoprotein Receptor Class A doma 98.92
PF0005737 Ldl_recept_a: Low-density lipoprotein receptor dom 98.91
smart0019233 LDLa Low-density lipoprotein receptor domain class 98.81
smart0019233 LDLa Low-density lipoprotein receptor domain class 98.69
KOG1215 877 consensus Low-density lipoprotein receptors contai 98.06
KOG1215 877 consensus Low-density lipoprotein receptors contai 98.01
PF12999176 PRKCSH-like: Glucosidase II beta subunit-like 97.87
KOG3509 964 consensus Basement membrane-specific heparan sulfa 93.94
KOG2397 480 consensus Protein kinase C substrate, 80 KD protei 93.51
KOG1219 4289 consensus Uncharacterized conserved protein, conta 86.06
>PF12999 PRKCSH-like: Glucosidase II beta subunit-like Back     alignment and domain information
Probab=99.96  E-value=2.1e-30  Score=220.99  Aligned_cols=121  Identities=52%  Similarity=0.976  Sum_probs=109.0

Q ss_pred             HHHHHHHHHHHhhhcccCccccCCCCCCCCCCC---CceecCCCCce-ecCCCCCCCCCCCCCCCCCCCCCCCCCCeeec
Q 027304            9 LIPLMSLCFLVVFVQCKSSLLGVHPLDEKYFSK---EVIKCKDGSKS-FTRDRLNDNFCDCIDGTDEPGTSACPAGKFYC   84 (225)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~~~~Gv~p~~~~~~~p---~~F~C~dGs~C-Ip~s~vCDG~~DC~DGSDE~~c~~C~~~~F~C   84 (225)
                      ++|++++.++++.+  .+.++||+|+.+++|.|   +.|.|.+|++- |+.++++|+++||+|||||++|++|+.+.|||
T Consensus         2 ~~~~~~~~~~~~~~--~~~~~GV~p~~~~~Y~~~~~~~f~Cl~~~~~~I~~~~iNDdyCDC~DGSDEPGTsAC~~~~FyC   79 (176)
T PF12999_consen    2 LLPLIALSLLSASA--SSRIRGVSPSDQHLYEPSENGKFTCLDGSKIVIPFSQINDDYCDCPDGSDEPGTSACSNGKFYC   79 (176)
T ss_pred             cHHHHHHHHHHHhc--cCCCCCCCHHHHHHcCCCCCCceEecCCCCceecHHHccCcceeCCCCCCccccccCcCceEee
Confidence            67888777776665  56899999999999986   48999999877 99999999999999999999999999999999


Q ss_pred             CCCCCCcccccCCCccCCCCC---CCCCCCCCCCCCCCCCccccCCcchhhc
Q 027304           85 GNVGSTPQFIFSSRVNDRICD---CCDGSDEYDSSIKCPNTCVMGGNIEYKA  133 (225)
Q Consensus        85 ~Ngg~~~~CI~~s~VCDGv~D---C~DGSDE~~~~~~Cpn~C~~~g~~~~~~  133 (225)
                      .|.||.|..|+.++|.||++|   |+|||||  +...|||+|...++.+...
T Consensus        80 ~N~g~~p~~i~~s~VnDGICDy~~CCDGSDE--~~~~C~N~C~e~~~~~~~~  129 (176)
T PF12999_consen   80 ENKGHIPRYIPSSRVNDGICDYDICCDGSDE--SGGKCPNTCAELGKEYREE  129 (176)
T ss_pred             ccCCCCCceeehhhhcCCcCcccccCCCCCC--CCCCCccHHHHHHHHHHHH
Confidence            999999999999999999999   9999999  4568999999999866544



>KOG2397 consensus Protein kinase C substrate, 80 KD protein, heavy chain [Signal transduction mechanisms] Back     alignment and domain information
>PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>smart00192 LDLa Low-density lipoprotein receptor domain class A Back     alignment and domain information
>smart00192 LDLa Low-density lipoprotein receptor domain class A Back     alignment and domain information
>KOG1215 consensus Low-density lipoprotein receptors containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1215 consensus Low-density lipoprotein receptors containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>PF12999 PRKCSH-like: Glucosidase II beta subunit-like Back     alignment and domain information
>KOG3509 consensus Basement membrane-specific heparan sulfate proteoglycan (HSPG) core protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2397 consensus Protein kinase C substrate, 80 KD protein, heavy chain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 6e-06
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 8e-06
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 3e-05
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 6e-05
2fyj_A82 Low-density lipoprotein receptor-related protein 1 1e-05
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 1e-05
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 1e-05
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 3e-05
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 1e-04
2xrc_A 565 Human complement factor I; immune system, hydrolas 2e-05
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 1e-04
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 3e-04
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
 Score = 45.6 bits (107), Expect = 6e-06
 Identities = 21/68 (30%), Positives = 27/68 (39%), Gaps = 10/68 (14%)

Query: 60  DNFCDCIDGTDEPGTS----ACPAGKFYCGNVGSTPQFIFSSRVNDRICDCCDGSDEYDS 115
           D   +C DG+DE   +     C +G F CG      + I      D   DC +GSDE   
Sbjct: 44  DGSAECQDGSDESQETCLSVTCKSGDFSCGG--RVNRCIPQFWRCDGQVDCDNGSDEQG- 100

Query: 116 SIKCPNTC 123
              CP   
Sbjct: 101 ---CPPKT 105


>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
2fyj_A82 Low-density lipoprotein receptor-related protein 1 99.85
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 99.84
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 99.62
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 99.61
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 99.58
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 99.53
2xrc_A 565 Human complement factor I; immune system, hydrolas 99.52
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 99.05
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 99.05
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 99.04
1cr8_A42 Protein (LOW density lipoprotein receptor related 99.03
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 99.03
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 99.03
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 99.02
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 99.0
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 99.0
2knx_A50 Prolow-density lipoprotein receptor-related prote; 98.99
3a7q_B44 Low-density lipoprotein receptor-related protein; 98.98
2m0p_A52 Low-density lipoprotein receptor-related protein; 98.98
1j8e_A44 Low-density lipoprotein receptor-related protein 1 98.98
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 98.98
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 98.98
1cr8_A42 Protein (LOW density lipoprotein receptor related 98.98
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 98.98
3a7q_B44 Low-density lipoprotein receptor-related protein; 98.97
2i1p_A48 Low-density lipoprotein receptor-related protein 2 98.95
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 98.95
2m0p_A52 Low-density lipoprotein receptor-related protein; 98.95
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 98.94
2knx_A50 Prolow-density lipoprotein receptor-related prote; 98.91
2i1p_A48 Low-density lipoprotein receptor-related protein 2 98.88
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 98.86
2fyj_A82 Low-density lipoprotein receptor-related protein 1 98.83
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 98.83
1j8e_A44 Low-density lipoprotein receptor-related protein 1 98.78
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 98.73
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 98.69
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 98.69
2xrc_A 565 Human complement factor I; immune system, hydrolas 98.59
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 98.51
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 98.51
3ojy_B 537 Complement component C8 beta chain; macpf, lipocal 98.28
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 98.28
3ojy_A 554 Complement component C8 alpha chain; macpf, lipoca 98.25
3ojy_B 537 Complement component C8 beta chain; macpf, lipocal 98.15
3ojy_A 554 Complement component C8 alpha chain; macpf, lipoca 97.99
3t5o_A 913 Complement component C6; macpf, MAC, membrane atta 97.39
3t5o_A 913 Complement component C6; macpf, MAC, membrane atta 97.32
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Back     alignment and structure
Probab=99.85  E-value=1.3e-21  Score=146.09  Aligned_cols=71  Identities=28%  Similarity=0.398  Sum_probs=64.1

Q ss_pred             CCCCceecCCCCceecCCCCCCCCCCCCCCCCC-CCCC--CCCC-CeeecCCCCCCcccccCCCccCCCCCCCCCCCCCC
Q 027304           39 FSKEVIKCKDGSKSFTRDRLNDNFCDCIDGTDE-PGTS--ACPA-GKFYCGNVGSTPQFIFSSRVNDRICDCCDGSDEYD  114 (225)
Q Consensus        39 ~~p~~F~C~dGs~CIp~s~vCDG~~DC~DGSDE-~~c~--~C~~-~~F~C~Ngg~~~~CI~~s~VCDGv~DC~DGSDE~~  114 (225)
                      ..+++|+|.+| +|||..|+|||..||.||||| .+|.  .|.+ .+|+|.|+    .||+..|+|||+.||.|||||.+
T Consensus         5 C~~~~f~C~~g-~Ci~~~~~CDg~~DC~DgsDE~~~C~~~~C~~~~~f~C~~g----~CI~~~~~CDG~~DC~DgSDE~~   79 (82)
T 2fyj_A            5 CPPNQFSCASG-RCIPISWTCDLDDDCGDRSDESASCAYPTCFPLTQFTCNNG----RCININWRCDNDNDCGDNSDEAG   79 (82)
T ss_dssp             SCTTEEETTSS-CEEETTSSSSCSSSSCSTTTTTSSCCCSSSCSSSEEECTTS----CEEETTCBSSSSBCCSSSSSCSC
T ss_pred             CCCCceEeCCC-CEEeccccCCCcccCCCccccccccccccCCCCCceECCCC----CeEcHHHccCCCCcCCCCccccC
Confidence            34689999998 799999999999999999999 6764  6854 99999988    79999999999999999999984



>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Back     alignment and structure
>2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Back     alignment and structure
>2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 225
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-06
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 7e-04
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 0.001
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 0.001
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 0.002
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 0.002
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 0.003
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 0.004
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 0.004
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure

class: Small proteins
fold: LDL receptor-like module
superfamily: LDL receptor-like module
family: LDL receptor-like module
domain: Ligand-binding domain of low-density lipoprotein receptor
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 40.9 bits (96), Expect = 3e-06
 Identities = 14/49 (28%), Positives = 21/49 (42%), Gaps = 6/49 (12%)

Query: 73  GTSACPAGKFYCGNVGSTPQFIFSSRVNDRICDCCDGSDEYDSSIKCPN 121
           G+ +C + +F C +     + I      D   DC D SDE  +   C N
Sbjct: 1   GSHSCSSTQFKCNS----GRCIPEHWTCDGDNDCGDYSDETHA--NCTN 43


>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
d2fcwb139 Ligand-binding domain of low-density lipoprotein r 99.09
d1f8za_39 Ligand-binding domain of low-density lipoprotein r 99.09
d2fcwb139 Ligand-binding domain of low-density lipoprotein r 99.06
d1ajja_37 Ligand-binding domain of low-density lipoprotein r 99.05
d1f8za_39 Ligand-binding domain of low-density lipoprotein r 99.03
d1v9u5_39 Very low-density lipoprotein receptor {Human (Homo 99.03
d1f5ya241 Ligand-binding domain of low-density lipoprotein r 99.03
d1v9u5_39 Very low-density lipoprotein receptor {Human (Homo 99.02
d1cr8a_42 Ligand-binding domain of low-density lipoprotein r 99.02
d1f5ya144 Ligand-binding domain of low-density lipoprotein r 99.01
d1ajja_37 Ligand-binding domain of low-density lipoprotein r 99.01
d1d2la_45 Ligand-binding domain of low-density lipoprotein r 99.0
d1f5ya144 Ligand-binding domain of low-density lipoprotein r 99.0
d2fcwb239 Ligand-binding domain of low-density lipoprotein r 98.99
d1j8ea_44 Ligand-binding domain of low-density lipoprotein r 98.99
d1f5ya241 Ligand-binding domain of low-density lipoprotein r 98.99
d1cr8a_42 Ligand-binding domain of low-density lipoprotein r 98.98
d2gtlm242 Hemoglobin linker chain l1 {Common earthworm (Lumb 98.97
d1d2la_45 Ligand-binding domain of low-density lipoprotein r 98.95
d2gtln241 Extracellular hemoglobin linker l2 subunit {Common 98.94
d1xfea244 Ligand-binding domain of low-density lipoprotein r 98.93
d1xfea244 Ligand-binding domain of low-density lipoprotein r 98.92
d2gtlm242 Hemoglobin linker chain l1 {Common earthworm (Lumb 98.9
d2fcwb239 Ligand-binding domain of low-density lipoprotein r 98.9
d1k7ba_42 soluble Tva ectodomain, sTva47 {Quail (Coturnix co 98.89
d2gtlo241 Extracellular hemoglobin linker l3 subunit {Common 98.89
d2gtlo241 Extracellular hemoglobin linker l3 subunit {Common 98.89
d1k7ba_42 soluble Tva ectodomain, sTva47 {Quail (Coturnix co 98.87
d2gtln241 Extracellular hemoglobin linker l2 subunit {Common 98.83
d1j8ea_44 Ligand-binding domain of low-density lipoprotein r 98.78
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: LDL receptor-like module
superfamily: LDL receptor-like module
family: LDL receptor-like module
domain: Ligand-binding domain of low-density lipoprotein receptor
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.09  E-value=1.3e-11  Score=79.70  Aligned_cols=35  Identities=37%  Similarity=0.589  Sum_probs=32.6

Q ss_pred             CCCCCeeecCCCCCCcccccCCCccCCCCCCCCCCCCCC
Q 027304           76 ACPAGKFYCGNVGSTPQFIFSSRVNDRICDCCDGSDEYD  114 (225)
Q Consensus        76 ~C~~~~F~C~Ngg~~~~CI~~s~VCDGv~DC~DGSDE~~  114 (225)
                      .|+.++|+|.+|    .||+.+|+|||..||.|||||.+
T Consensus         2 tC~~~~f~C~~g----~CI~~~~~CDg~~DC~DgsDE~~   36 (39)
T d2fcwb1           2 TCSQAEFRCHDG----KCISRQFVCDSDRDCLDGSDEAS   36 (39)
T ss_dssp             CCCTTEEECTTS----CEEEGGGTTSSSCCSTTCTTTTT
T ss_pred             cCCCCCEEcCCC----CEEcchhcCcCcCcCcCCchhcC
Confidence            488999999988    79999999999999999999973



>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure