Citrus Sinensis ID: 027369
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 224 | ||||||
| 225450883 | 220 | PREDICTED: germin-like protein subfamily | 0.973 | 0.990 | 0.776 | 2e-92 | |
| 359487505 | 221 | PREDICTED: germin-like protein subfamily | 0.977 | 0.990 | 0.762 | 1e-91 | |
| 225450885 | 220 | PREDICTED: germin-like protein subfamily | 0.973 | 0.990 | 0.762 | 5e-91 | |
| 119067548 | 220 | germin-like protein 4 [Vitis vinifera] | 0.968 | 0.986 | 0.761 | 6e-91 | |
| 296089653 | 220 | unnamed protein product [Vitis vinifera] | 0.973 | 0.990 | 0.753 | 2e-90 | |
| 225450881 | 220 | PREDICTED: germin-like protein subfamily | 0.973 | 0.990 | 0.757 | 6e-90 | |
| 359487764 | 220 | PREDICTED: germin-like protein 4 [Vitis | 0.973 | 0.990 | 0.753 | 6e-90 | |
| 225450892 | 220 | PREDICTED: germin-like protein subfamily | 0.973 | 0.990 | 0.757 | 6e-90 | |
| 296088367 | 447 | unnamed protein product [Vitis vinifera] | 0.973 | 0.487 | 0.748 | 8e-90 | |
| 225450890 | 220 | PREDICTED: germin-like protein subfamily | 0.973 | 0.990 | 0.748 | 1e-89 |
| >gi|225450883|ref|XP_002284334.1| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera] gi|296088371|emb|CBI36816.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 344 bits (882), Expect = 2e-92, Method: Compositional matrix adjust.
Identities = 170/219 (77%), Positives = 185/219 (84%), Gaps = 1/219 (0%)
Query: 2 KGVQLLLGFALLILASSLASAYDPSPLQDICVAIDEPKNAVFVNGKFCKDPKLAKPEDFF 61
KGV L+ AL+ L SSLASA DPSPLQD CVAIDEPK+AVFVNGKFCKDPKL EDFF
Sbjct: 3 KGVSFLVTVALVALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTVAEDFF 62
Query: 62 FSGLDQPGDTANRLGFKVTTVNVEQIPGLNTLGVSAARIDFAPYGQNPPHTHPRATEILV 121
FSGLD+PG+T+N + VTTVNVEQI GLNTLG+S RID+ PYGQNPPHTHPRATEIL
Sbjct: 63 FSGLDKPGNTSNAVASNVTTVNVEQIKGLNTLGISMVRIDYEPYGQNPPHTHPRATEILT 122
Query: 122 VLEGTLYVGFVTSNQLNNTLIAKVLNKGDVFVFPIGMIHFQFNIGKTNAVAFAGFGSQNP 181
VLEGTLYVGFVTSN N LI+KVLNKGDVFVFPIG+IHFQFNIGKTNAVA A SQNP
Sbjct: 123 VLEGTLYVGFVTSNT-ENRLISKVLNKGDVFVFPIGLIHFQFNIGKTNAVAIAALSSQNP 181
Query: 182 GVITIANTVFGADPPINPDFLGKAFQLDPQVVKDLQNKF 220
GVITIAN VFG+DPPINPD L +AFQLD VVK LQ++F
Sbjct: 182 GVITIANAVFGSDPPINPDVLTRAFQLDKSVVKYLQSRF 220
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359487505|ref|XP_002284300.2| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225450885|ref|XP_002284343.1| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera] gi|296088370|emb|CBI36815.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|119067548|gb|ABL60873.1| germin-like protein 4 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296089653|emb|CBI39472.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225450881|ref|XP_002284320.1| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera] gi|296088372|emb|CBI36817.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359487764|ref|XP_003633647.1| PREDICTED: germin-like protein 4 [Vitis vinifera] gi|296088366|emb|CBI36811.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225450892|ref|XP_002284382.1| PREDICTED: germin-like protein subfamily 1 member 13 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296088367|emb|CBI36812.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225450890|ref|XP_002284371.1| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 224 | ||||||
| TAIR|locus:2177157 | 221 | AT5G39120 [Arabidopsis thalian | 0.892 | 0.904 | 0.785 | 7.4e-82 | |
| TAIR|locus:2177187 | 221 | AT5G39150 [Arabidopsis thalian | 0.892 | 0.904 | 0.785 | 7.4e-82 | |
| TAIR|locus:2157220 | 221 | AT5G39180 [Arabidopsis thalian | 0.892 | 0.904 | 0.78 | 3.2e-81 | |
| TAIR|locus:2177147 | 222 | AT5G39110 [Arabidopsis thalian | 0.888 | 0.896 | 0.773 | 4.7e-80 | |
| TAIR|locus:2157200 | 222 | AT5G39160 [Arabidopsis thalian | 0.879 | 0.887 | 0.727 | 6.3e-76 | |
| TAIR|locus:2157230 | 222 | GER2 "germin-like protein 2" [ | 0.879 | 0.887 | 0.727 | 1e-75 | |
| TAIR|locus:2177167 | 222 | AT5G39130 [Arabidopsis thalian | 0.879 | 0.887 | 0.722 | 2.1e-75 | |
| TAIR|locus:2074514 | 229 | AT3G05950 [Arabidopsis thalian | 0.879 | 0.860 | 0.732 | 5.1e-74 | |
| TAIR|locus:2130020 | 222 | GLP9 "germin-like protein 9" [ | 0.879 | 0.887 | 0.639 | 3.1e-67 | |
| TAIR|locus:2152267 | 223 | AT5G38940 [Arabidopsis thalian | 0.875 | 0.878 | 0.680 | 2.2e-66 |
| TAIR|locus:2177157 AT5G39120 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 821 (294.1 bits), Expect = 7.4e-82, P = 7.4e-82
Identities = 157/200 (78%), Positives = 171/200 (85%)
Query: 23 YDPSPLQDICVAIDEPKNAVFVNGKFCKDPKLAKPEDFFFSGLDQPGDTANRLGFKVTTV 82
YDPSPLQD CVAID+PKN VFVNGKFCKDPK AK EDFF SGL+Q G T N++ VTTV
Sbjct: 22 YDPSPLQDFCVAIDDPKNGVFVNGKFCKDPKQAKAEDFFSSGLNQAGITNNKVKSNVTTV 81
Query: 83 NVEQIPGLNTLGVSAARIDFAPYGQNPPHTHPRATEILVVLEGTLYVGFVTSNQLNNTLI 142
NV+QIPGLNTLG+S RID+APYGQNPPHTHPRATEILV++EGTLYVGFV+SNQ NN L
Sbjct: 82 NVDQIPGLNTLGISLVRIDYAPYGQNPPHTHPRATEILVLVEGTLYVGFVSSNQDNNRLF 141
Query: 143 AKVLNKGDVFVFPIGMIHFQFNIGKTNAVAFAGFGSQNPGVITIANTVFGADPPINPDFL 202
AKVLN GDVFVFPIGMIHFQ NIGKT AVAFAG SQN GVITIA+TVFG+ PPINPD L
Sbjct: 142 AKVLNPGDVFVFPIGMIHFQVNIGKTPAVAFAGLSSQNAGVITIADTVFGSTPPINPDIL 201
Query: 203 GKAFQLDPQVVKDLQNKFMN 222
+AFQLD VVKDL+ KF N
Sbjct: 202 AQAFQLDVNVVKDLEAKFKN 221
|
|
| TAIR|locus:2177187 AT5G39150 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2157220 AT5G39180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2177147 AT5G39110 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2157200 AT5G39160 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2157230 GER2 "germin-like protein 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2177167 AT5G39130 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2074514 AT3G05950 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130020 GLP9 "germin-like protein 9" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152267 AT5G38940 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 224 | |||
| pfam00190 | 139 | pfam00190, Cupin_1, Cupin | 3e-37 | |
| smart00835 | 146 | smart00835, Cupin_1, Cupin | 4e-36 | |
| COG1917 | 131 | COG1917, COG1917, Uncharacterized conserved protei | 1e-09 | |
| pfam07883 | 70 | pfam07883, Cupin_2, Cupin domain | 1e-06 | |
| COG0662 | 127 | COG0662, {ManC}, Mannose-6-phosphate isomerase [Ca | 4e-05 |
| >gnl|CDD|215780 pfam00190, Cupin_1, Cupin | Back alignment and domain information |
|---|
Score = 126 bits (319), Expect = 3e-37
Identities = 51/153 (33%), Positives = 67/153 (43%), Gaps = 15/153 (9%)
Query: 63 SGLDQPGDTANRLGFKVTTVNVEQIPGLNTLGVSAARIDF-APYGQNPPHTHPRATEILV 121
L +P N G ++ T N +PGL L SA R D P G PH HP ATEIL
Sbjct: 1 FNLLEPSPVFNSEGGRLETANPNNLPGLLGLAGSAVRRDLIEPGGLLLPHYHPNATEILY 60
Query: 122 VLEGTLYVGFVTSNQLNNTLIAKVLNKGDVFVFPIGMIHFQFNIGKTNAVAFAGFGSQNP 181
VL+G VGFV + + L +GDVFV P G H+Q+N G + F + NP
Sbjct: 61 VLQGRGRVGFVVPGC-GFRVFHQKLREGDVFVVPAGFAHWQYNSG-DPGLELVAFDTNNP 118
Query: 182 GVITIANTVFGADPPINPDFLGKAFQLDPQVVK 214
+ + L +AF L +
Sbjct: 119 ANQ------------LPREVLARAFFLAGNEAR 139
|
This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel). This family contains 11S and 7S plant seed storage proteins, and germins. Plant seed storage proteins provide the major nitrogen source for the developing plant. Length = 139 |
| >gnl|CDD|214845 smart00835, Cupin_1, Cupin | Back alignment and domain information |
|---|
| >gnl|CDD|224829 COG1917, COG1917, Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|219618 pfam07883, Cupin_2, Cupin domain | Back alignment and domain information |
|---|
| >gnl|CDD|223734 COG0662, {ManC}, Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 224 | |||
| TIGR03404 | 367 | bicupin_oxalic bicupin, oxalate decarboxylase fami | 99.96 | |
| PLN00212 | 493 | glutelin; Provisional | 99.93 | |
| TIGR03404 | 367 | bicupin_oxalic bicupin, oxalate decarboxylase fami | 99.91 | |
| PF00190 | 144 | Cupin_1: Cupin; InterPro: IPR006045 This family re | 99.91 | |
| smart00835 | 146 | Cupin_1 Cupin. This family represents the conserve | 99.86 | |
| PLN00212 | 493 | glutelin; Provisional | 99.85 | |
| COG2140 | 209 | Thermophilic glucose-6-phosphate isomerase and rel | 99.78 | |
| PF07883 | 71 | Cupin_2: Cupin domain; InterPro: IPR013096 This fa | 99.46 | |
| COG1917 | 131 | Uncharacterized conserved protein, contains double | 99.39 | |
| PRK13290 | 125 | ectC L-ectoine synthase; Reviewed | 99.34 | |
| COG0662 | 127 | {ManC} Mannose-6-phosphate isomerase [Carbohydrate | 99.33 | |
| PRK04190 | 191 | glucose-6-phosphate isomerase; Provisional | 99.3 | |
| COG3837 | 161 | Uncharacterized conserved protein, contains double | 99.18 | |
| PRK11171 | 266 | hypothetical protein; Provisional | 99.11 | |
| TIGR01479 | 468 | GMP_PMI mannose-1-phosphate guanylyltransferase/ma | 99.1 | |
| PRK09943 | 185 | DNA-binding transcriptional repressor PuuR; Provis | 99.09 | |
| COG4101 | 142 | Predicted mannose-6-phosphate isomerase [Carbohydr | 99.06 | |
| PRK15460 | 478 | cpsB mannose-1-phosphate guanyltransferase; Provis | 99.06 | |
| PF01050 | 151 | MannoseP_isomer: Mannose-6-phosphate isomerase; In | 98.97 | |
| TIGR03214 | 260 | ura-cupin putative allantoin catabolism protein. T | 98.92 | |
| TIGR03214 | 260 | ura-cupin putative allantoin catabolism protein. T | 98.89 | |
| PRK11171 | 266 | hypothetical protein; Provisional | 98.84 | |
| PF02041 | 167 | Auxin_BP: Auxin binding protein; InterPro: IPR0005 | 98.71 | |
| PF06560 | 182 | GPI: Glucose-6-phosphate isomerase (GPI); InterPro | 98.63 | |
| PF11699 | 85 | CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B. | 98.54 | |
| TIGR03037 | 159 | anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | 98.52 | |
| PRK13264 | 177 | 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | 98.52 | |
| TIGR02451 | 215 | anti_sig_ChrR anti-sigma factor, putative, ChrR fa | 98.43 | |
| PF12973 | 91 | Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ | 98.43 | |
| PF02311 | 136 | AraC_binding: AraC-like ligand binding domain; Int | 98.32 | |
| PF03079 | 157 | ARD: ARD/ARD' family; InterPro: IPR004313 The two | 98.25 | |
| PRK15457 | 233 | ethanolamine utilization protein EutQ; Provisional | 98.18 | |
| TIGR02272 | 335 | gentisate_1_2 gentisate 1,2-dioxygenase. This fami | 98.1 | |
| PRK10371 | 302 | DNA-binding transcriptional regulator MelR; Provis | 98.05 | |
| COG3435 | 351 | Gentisate 1,2-dioxygenase [Secondary metabolites b | 97.99 | |
| PF05899 | 74 | Cupin_3: Protein of unknown function (DUF861); Int | 97.88 | |
| COG1791 | 181 | Uncharacterized conserved protein, contains double | 97.88 | |
| PF14499 | 251 | DUF4437: Domain of unknown function (DUF4437); PDB | 97.88 | |
| PRK10296 | 278 | DNA-binding transcriptional regulator ChbR; Provis | 97.88 | |
| PF05523 | 131 | FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 | 97.86 | |
| PRK13501 | 290 | transcriptional activator RhaR; Provisional | 97.78 | |
| PRK13500 | 312 | transcriptional activator RhaR; Provisional | 97.77 | |
| TIGR02297 | 287 | HpaA 4-hydroxyphenylacetate catabolism regulatory | 97.76 | |
| COG4297 | 163 | Uncharacterized protein containing double-stranded | 97.75 | |
| KOG2107 | 179 | consensus Uncharacterized conserved protein, conta | 97.66 | |
| COG3257 | 264 | GlxB Uncharacterized protein, possibly involved in | 97.58 | |
| PF06339 | 126 | Ectoine_synth: Ectoine synthase; InterPro: IPR0104 | 97.55 | |
| TIGR02272 | 335 | gentisate_1_2 gentisate 1,2-dioxygenase. This fami | 97.52 | |
| PRK13502 | 282 | transcriptional activator RhaR; Provisional | 97.51 | |
| PF06052 | 151 | 3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte | 97.5 | |
| PRK13503 | 278 | transcriptional activator RhaS; Provisional | 97.47 | |
| PF06249 | 152 | EutQ: Ethanolamine utilisation protein EutQ; Inter | 97.16 | |
| COG1898 | 173 | RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and rela | 97.1 | |
| PF05995 | 175 | CDO_I: Cysteine dioxygenase type I; InterPro: IPR0 | 97.08 | |
| COG4766 | 176 | EutQ Ethanolamine utilization protein [Amino acid | 96.92 | |
| COG3450 | 116 | Predicted enzyme of the cupin superfamily [General | 96.76 | |
| TIGR01221 | 176 | rmlC dTDP-4-dehydrorhamnose 3,5-epimerase. This en | 96.66 | |
| PF00908 | 176 | dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimer | 96.65 | |
| PF13621 | 251 | Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU | 96.49 | |
| PF08007 | 319 | Cupin_4: Cupin superfamily protein; InterPro: IPR0 | 95.62 | |
| COG3435 | 351 | Gentisate 1,2-dioxygenase [Secondary metabolites b | 95.61 | |
| PF02678 | 107 | Pirin: Pirin; InterPro: IPR003829 This entry repre | 95.57 | |
| PF07385 | 225 | DUF1498: Protein of unknown function (DUF1498); In | 95.46 | |
| PF04209 | 424 | HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR | 95.41 | |
| PF13759 | 101 | 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB | 95.24 | |
| PF14499 | 251 | DUF4437: Domain of unknown function (DUF4437); PDB | 95.07 | |
| COG1741 | 276 | Pirin-related protein [General function prediction | 94.95 | |
| PF12852 | 186 | Cupin_6: Cupin | 94.92 | |
| PRK05341 | 438 | homogentisate 1,2-dioxygenase; Provisional | 94.73 | |
| TIGR01015 | 429 | hmgA homogentisate 1,2-dioxygenase. Missing in hum | 94.47 | |
| PLN02658 | 435 | homogentisate 1,2-dioxygenase | 94.37 | |
| PF02373 | 114 | JmjC: JmjC domain, hydroxylase; InterPro: IPR01312 | 94.11 | |
| TIGR02466 | 201 | conserved hypothetical protein. This family consis | 94.06 | |
| PF05118 | 163 | Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxyl | 93.79 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 93.71 | |
| COG3806 | 216 | ChrR Transcriptional activator [Transcription] | 93.59 | |
| PRK10572 | 290 | DNA-binding transcriptional regulator AraC; Provis | 93.48 | |
| KOG3706 | 629 | consensus Uncharacterized conserved protein [Funct | 92.63 | |
| PF06865 | 94 | DUF1255: Protein of unknown function (DUF1255); In | 92.24 | |
| PF07847 | 200 | DUF1637: Protein of unknown function (DUF1637); In | 92.15 | |
| PRK09685 | 302 | DNA-binding transcriptional activator FeaR; Provis | 91.84 | |
| COG3822 | 225 | ABC-type sugar transport system, auxiliary compone | 91.82 | |
| COG3508 | 427 | HmgA Homogentisate 1,2-dioxygenase [Secondary meta | 91.67 | |
| COG5553 | 191 | Predicted metal-dependent enzyme of the double-str | 91.61 | |
| PRK10579 | 94 | hypothetical protein; Provisional | 91.57 | |
| KOG3995 | 279 | consensus 3-hydroxyanthranilate oxygenase HAAO [Am | 91.25 | |
| PRK00924 | 276 | 5-keto-4-deoxyuronate isomerase; Provisional | 90.9 | |
| PF05726 | 104 | Pirin_C: Pirin C-terminal cupin domain; InterPro: | 89.73 | |
| KOG2757 | 411 | consensus Mannose-6-phosphate isomerase [Carbohydr | 89.59 | |
| PRK15131 | 389 | mannose-6-phosphate isomerase; Provisional | 89.53 | |
| PF09313 | 82 | DUF1971: Domain of unknown function (DUF1971); Int | 89.27 | |
| PF11142 | 63 | DUF2917: Protein of unknown function (DUF2917); In | 87.62 | |
| PF04962 | 261 | KduI: KduI/IolB family; InterPro: IPR021120 The Kd | 87.26 | |
| TIGR00218 | 302 | manA mannose-6-phosphate isomerase, class I. The n | 86.94 | |
| PRK11753 | 211 | DNA-binding transcriptional dual regulator Crp; Pr | 86.31 | |
| PRK09391 | 230 | fixK transcriptional regulator FixK; Provisional | 86.22 | |
| PLN02288 | 394 | mannose-6-phosphate isomerase | 86.15 | |
| PF00027 | 91 | cNMP_binding: Cyclic nucleotide-binding domain; In | 85.53 | |
| COG2850 | 383 | Uncharacterized conserved protein [Function unknow | 85.25 | |
| COG3257 | 264 | GlxB Uncharacterized protein, possibly involved in | 85.2 | |
| PF14525 | 172 | AraC_binding_2: AraC-binding-like domain | 82.69 | |
| PRK13918 | 202 | CRP/FNR family transcriptional regulator; Provisio | 81.51 | |
| smart00100 | 120 | cNMP Cyclic nucleotide-monophosphate binding domai | 80.76 |
| >TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family | Back alignment and domain information |
|---|
Probab=99.96 E-value=8.7e-28 Score=219.59 Aligned_cols=162 Identities=19% Similarity=0.242 Sum_probs=144.9
Q ss_pred cccCCCCCCCCCCeeeecCCCCCCccCCCCeEEEEecccCcCcccccceEEEEEEEcCCCcCCceeCCCCcEEEEEEecE
Q 027369 47 KFCKDPKLAKPEDFFFSGLDQPGDTANRLGFKVTTVNVEQIPGLNTLGVSAARIDFAPYGQNPPHTHPRATEILVVLEGT 126 (224)
Q Consensus 47 ~~ck~p~~v~~~df~f~~l~~~~~~~~~~g~~v~~~~~~~~P~L~~lgis~~rv~l~pgg~~ppH~Hp~a~Ei~yVl~G~ 126 (224)
.+-+.+..-.++.|+|+....++.. ..|++++.+++.+||+++ ++++++++++||++.++|||++++|+.||++|+
T Consensus 201 ~~~~~~~~~~~~~~~~~~~~~~p~~--~~gG~~~~~~~~~~p~~~--~~s~~~~~l~PG~~~~~H~H~~~~E~~yvl~G~ 276 (367)
T TIGR03404 201 EAVTGPAGEVPGPFTYHLSEQKPKQ--VPGGTVRIADSTNFPVSK--TIAAAIVTVEPGAMRELHWHPNADEWQYFIQGQ 276 (367)
T ss_pred ccCcCCCCCCCccEEEEhhhCCcee--cCCceEEEEChhhccCcc--eEEEEEEEECCCCccCCeeCcCCCeEEEEEEEE
Confidence 3445566666778999998887743 567789999999999988 589999999999999999999999999999999
Q ss_pred EEEEEEecCCCCCeeEEEEecCCCEEEEcCCCeeEEEeCCCCcEEEEEEEcCCCCceeeechhhhcCCCCCCHHHHHHhc
Q 027369 127 LYVGFVTSNQLNNTLIAKVLNKGDVFVFPIGMIHFQFNIGKTNAVAFAGFGSQNPGVITIANTVFGADPPINPDFLGKAF 206 (224)
Q Consensus 127 ~~v~~~~~~~~~~~~~~~~L~~GDv~v~P~G~~H~~~N~G~~~a~~i~~~~s~~pg~~~i~~~lf~~~p~~~~~vLa~af 206 (224)
+++++.+++ ++..++.+++||+++||+|..|+++|.|+++++++++|++..++.+.+++|+.. +|++||+++|
T Consensus 277 ~~~~v~d~~---g~~~~~~l~~GD~~~iP~g~~H~i~N~G~e~l~fL~if~s~~~~~i~l~~~l~~----~p~~vl~~~~ 349 (367)
T TIGR03404 277 ARMTVFAAG---GNARTFDYQAGDVGYVPRNMGHYVENTGDETLVFLEVFKADRFADVSLNQWLAL----TPPQLVAAHL 349 (367)
T ss_pred EEEEEEecC---CcEEEEEECCCCEEEECCCCeEEEEECCCCCEEEEEEECCCCCceeEHHHHHhh----CCHHHHHHHh
Confidence 999998776 455578999999999999999999999999999999999999999999999743 9999999999
Q ss_pred CCCHHHHHHHhhh
Q 027369 207 QLDPQVVKDLQNK 219 (224)
Q Consensus 207 ~~~~~~v~~l~~~ 219 (224)
+++++++++|++.
T Consensus 350 ~~~~~~~~~l~~~ 362 (367)
T TIGR03404 350 NLDDEVIDSLKKE 362 (367)
T ss_pred CcCHHHHHhcccc
Confidence 9999999999975
|
Members of this protein family are defined as bicupins as they have two copies of the cupin domain (pfam00190). Two different known activities for members of this family are oxalate decarboxylase (EC 4.1.1.2) and oxalate oxidase (EC 1.2.3.4), although the latter activity has more often been found in distantly related monocupin (germin) proteins. |
| >PLN00212 glutelin; Provisional | Back alignment and domain information |
|---|
| >TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family | Back alignment and domain information |
|---|
| >PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >smart00835 Cupin_1 Cupin | Back alignment and domain information |
|---|
| >PLN00212 glutelin; Provisional | Back alignment and domain information |
|---|
| >COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK13290 ectC L-ectoine synthase; Reviewed | Back alignment and domain information |
|---|
| >COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04190 glucose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK11171 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >PRK09943 DNA-binding transcriptional repressor PuuR; Provisional | Back alignment and domain information |
|---|
| >COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 | Back alignment and domain information |
|---|
| >TIGR03214 ura-cupin putative allantoin catabolism protein | Back alignment and domain information |
|---|
| >TIGR03214 ura-cupin putative allantoin catabolism protein | Back alignment and domain information |
|---|
| >PRK11171 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) | Back alignment and domain information |
|---|
| >PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 | Back alignment and domain information |
|---|
| >PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B | Back alignment and domain information |
|---|
| >TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | Back alignment and domain information |
|---|
| >PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family | Back alignment and domain information |
|---|
| >PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A | Back alignment and domain information |
|---|
| >PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC | Back alignment and domain information |
|---|
| >PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ [] | Back alignment and domain information |
|---|
| >PRK15457 ethanolamine utilization protein EutQ; Provisional | Back alignment and domain information |
|---|
| >TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PRK10371 DNA-binding transcriptional regulator MelR; Provisional | Back alignment and domain information |
|---|
| >COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown | Back alignment and domain information |
|---|
| >COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A | Back alignment and domain information |
|---|
| >PRK10296 DNA-binding transcriptional regulator ChbR; Provisional | Back alignment and domain information |
|---|
| >PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase [] | Back alignment and domain information |
|---|
| >PRK13501 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PRK13500 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA | Back alignment and domain information |
|---|
| >COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] | Back alignment and domain information |
|---|
| >PF06339 Ectoine_synth: Ectoine synthase; InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins | Back alignment and domain information |
|---|
| >TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PRK13502 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1 | Back alignment and domain information |
|---|
| >PRK13503 transcriptional activator RhaS; Provisional | Back alignment and domain information |
|---|
| >PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine | Back alignment and domain information |
|---|
| >COG1898 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF05995 CDO_I: Cysteine dioxygenase type I; InterPro: IPR010300 Cysteine dioxygenase type I (1 | Back alignment and domain information |
|---|
| >COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG3450 Predicted enzyme of the cupin superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01221 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase | Back alignment and domain information |
|---|
| >PF00908 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IPR000888 Deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-d-hexulose 3, 5-epimerase (RmlC, 5 | Back alignment and domain information |
|---|
| >PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A | Back alignment and domain information |
|---|
| >PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors | Back alignment and domain information |
|---|
| >COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF02678 Pirin: Pirin; InterPro: IPR003829 This entry represents N-terminal domain of Pirin proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >PF07385 DUF1498: Protein of unknown function (DUF1498); InterPro: IPR010864 This family consists of several hypothetical bacterial proteins of around 225 residues in length | Back alignment and domain information |
|---|
| >PF04209 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR005708 Alkaptonuria (AKU), a rare hereditary disorder, was the first disease to be interpreted as an inborn error of metabolism | Back alignment and domain information |
|---|
| >PF13759 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB: 3BVC_B 2RG4_A | Back alignment and domain information |
|---|
| >PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A | Back alignment and domain information |
|---|
| >COG1741 Pirin-related protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12852 Cupin_6: Cupin | Back alignment and domain information |
|---|
| >PRK05341 homogentisate 1,2-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01015 hmgA homogentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PLN02658 homogentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PF02373 JmjC: JmjC domain, hydroxylase; InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice [] | Back alignment and domain information |
|---|
| >TIGR02466 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PF05118 Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxylase; InterPro: IPR007803 The alpha-ketoglutarate-dependent dioxygenase aspartyl (asparaginyl) beta-hydroxylase (1 | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >COG3806 ChrR Transcriptional activator [Transcription] | Back alignment and domain information |
|---|
| >PRK10572 DNA-binding transcriptional regulator AraC; Provisional | Back alignment and domain information |
|---|
| >KOG3706 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06865 DUF1255: Protein of unknown function (DUF1255); InterPro: IPR009664 This family consists of several conserved hypothetical bacterial proteins of around 95 residues in length | Back alignment and domain information |
|---|
| >PF07847 DUF1637: Protein of unknown function (DUF1637); InterPro: IPR012864 This entry represents cysteamine dioxygenase, which is a non-heme iron protein that is involved in the biosynthesis of taurine | Back alignment and domain information |
|---|
| >PRK09685 DNA-binding transcriptional activator FeaR; Provisional | Back alignment and domain information |
|---|
| >COG3822 ABC-type sugar transport system, auxiliary component [General function prediction only] | Back alignment and domain information |
|---|
| >COG3508 HmgA Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG5553 Predicted metal-dependent enzyme of the double-stranded beta helix superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10579 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3995 consensus 3-hydroxyanthranilate oxygenase HAAO [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00924 5-keto-4-deoxyuronate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF05726 Pirin_C: Pirin C-terminal cupin domain; InterPro: IPR008778 This entry represents C-terminal domain of Pirin proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >KOG2757 consensus Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15131 mannose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF09313 DUF1971: Domain of unknown function (DUF1971); InterPro: IPR015392 This uncharacterised domain is predominantly found in bacterial Tellurite resistance proteins | Back alignment and domain information |
|---|
| >PF11142 DUF2917: Protein of unknown function (DUF2917); InterPro: IPR021317 This bacterial family of proteins appears to be restricted to Proteobacteria | Back alignment and domain information |
|---|
| >PF04962 KduI: KduI/IolB family; InterPro: IPR021120 The KduI/IolB family of enzymes includes 5-keto 4-deoxyuronate isomerase (KduI) and 5-deoxy-glucuronate isomerase (IolB) | Back alignment and domain information |
|---|
| >TIGR00218 manA mannose-6-phosphate isomerase, class I | Back alignment and domain information |
|---|
| >PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional | Back alignment and domain information |
|---|
| >PRK09391 fixK transcriptional regulator FixK; Provisional | Back alignment and domain information |
|---|
| >PLN02288 mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] | Back alignment and domain information |
|---|
| >COG2850 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] | Back alignment and domain information |
|---|
| >PF14525 AraC_binding_2: AraC-binding-like domain | Back alignment and domain information |
|---|
| >PRK13918 CRP/FNR family transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >smart00100 cNMP Cyclic nucleotide-monophosphate binding domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 224 | ||||
| 2et7_A | 201 | Structural And Spectroscopic Insights Into The Mech | 2e-47 | ||
| 2ete_A | 201 | Recombinant Oxalate Oxidase In Complex With Glycola | 1e-46 | ||
| 1fi2_A | 201 | Crystal Structure Of Germin (Oxalate Oxidase) Lengt | 1e-46 |
| >pdb|2ET7|A Chain A, Structural And Spectroscopic Insights Into The Mechanism Of Oxalate Oxidase Length = 201 | Back alignment and structure |
|
| >pdb|2ETE|A Chain A, Recombinant Oxalate Oxidase In Complex With Glycolate Length = 201 | Back alignment and structure |
| >pdb|1FI2|A Chain A, Crystal Structure Of Germin (Oxalate Oxidase) Length = 201 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 224 | |||
| 1fi2_A | 201 | Oxalate oxidase, germin; beta-jellyroll, oxidoredu | 2e-72 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 3e-44 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 5e-07 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 5e-43 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 5e-06 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 2e-41 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 2e-39 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 7e-14 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 4e-39 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 1e-12 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 9e-39 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 1e-32 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 8e-37 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 2e-13 | |
| 2e9q_A | 459 | 11S globulin subunit beta; cucubitin, pumpkin SEED | 6e-35 | |
| 2e9q_A | 459 | 11S globulin subunit beta; cucubitin, pumpkin SEED | 5e-06 | |
| 3qac_A | 465 | 11S globulin SEED storage protein; 11S SEED storag | 2e-33 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 4e-33 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 7e-04 | |
| 3kgl_A | 466 | Cruciferin; 11S SEED globulin, rapeseed, SEED stor | 8e-32 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 1e-29 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 5e-21 | |
| 2phl_A | 397 | Phaseolin; plant SEED storage protein(vicilin); HE | 2e-19 | |
| 2phl_A | 397 | Phaseolin; plant SEED storage protein(vicilin); HE | 6e-06 | |
| 1dgw_A | 178 | Canavalin; duplicated swiss-roll beta barrels, loo | 1e-18 | |
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 3e-18 | |
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 2e-15 | |
| 1lr5_A | 163 | Auxin binding protein 1; beta jellyroll, double st | 5e-15 | |
| 3fz3_A | 531 | Prunin; TREE NUT allergen, allergy, amandin, almon | 6e-11 | |
| 3ibm_A | 167 | Cupin 2, conserved barrel domain protein; cupin 2 | 2e-08 | |
| 1o4t_A | 133 | Putative oxalate decarboxylase; double-stranded be | 2e-08 | |
| 1v70_A | 105 | Probable antibiotics synthesis protein; structural | 3e-08 | |
| 3ht1_A | 145 | REMF protein; cupin fold, Zn-binding, antibiotic b | 9e-08 | |
| 3d82_A | 102 | Cupin 2, conserved barrel domain protein; structur | 4e-07 | |
| 2i45_A | 107 | Hypothetical protein; neisseria meningitidis cupin | 6e-07 | |
| 1vj2_A | 126 | Novel manganese-containing cupin TM1459; structura | 6e-07 | |
| 3h8u_A | 125 | Uncharacterized conserved protein with double-STR | 8e-07 | |
| 2gu9_A | 113 | Tetracenomycin polyketide synthesis protein; X-RAY | 2e-06 | |
| 3cew_A | 125 | Uncharacterized cupin protein; all beta-protein, j | 3e-06 | |
| 1y3t_A | 337 | Hypothetical protein YXAG; BI cupin, dioxygenase, | 4e-06 | |
| 1y3t_A | 337 | Hypothetical protein YXAG; BI cupin, dioxygenase, | 6e-06 | |
| 1juh_A | 350 | Quercetin 2,3-dioxygenase; cupin, glycoprotein, be | 2e-05 | |
| 1juh_A | 350 | Quercetin 2,3-dioxygenase; cupin, glycoprotein, be | 3e-04 | |
| 1x82_A | 190 | Glucose-6-phosphate isomerase; cupin superfamily, | 2e-05 | |
| 2d40_A | 354 | Z3393, putative gentisate 1,2-dioxygenase; gentisi | 3e-05 | |
| 1dgw_X | 79 | Canavalin; duplicated swiss-roll beta barrels, loo | 4e-05 | |
| 3kgz_A | 156 | Cupin 2 conserved barrel domain protein; metallopr | 4e-05 | |
| 3jzv_A | 166 | Uncharacterized protein RRU_A2000; structural geno | 7e-05 | |
| 3h7j_A | 243 | Bacilysin biosynthesis protein BACB; YWFC, bacilys | 1e-04 | |
| 4e2g_A | 126 | Cupin 2 conserved barrel domain protein; MCSG, PSI | 1e-04 | |
| 3i7d_A | 163 | Sugar phosphate isomerase; YP_168127.1, structural | 2e-04 | |
| 2ozi_A | 98 | Hypothetical protein RPA4178; APC6210, putative pr | 4e-04 | |
| 2fqp_A | 97 | Hypothetical protein BP2299; double-stranded beta- | 5e-04 | |
| 3eqe_A | 171 | Putative cystein deoxygenase; YUBC, SR112, NESG, s | 5e-04 | |
| 2pfw_A | 116 | Cupin 2, conserved barrel domain protein; cupin do | 7e-04 |
| >1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Length = 201 | Back alignment and structure |
|---|
Score = 218 bits (555), Expect = 2e-72
Identities = 96/197 (48%), Positives = 126/197 (63%), Gaps = 1/197 (0%)
Query: 24 DPSPLQDICVAIDEPKNAVFVNGKFCKDPKLAKPEDFFFSGLDQPGDTANRLGFKVTTVN 83
DP PLQD CVA D AV VNG CK A + F S L + G+T+ G VT ++
Sbjct: 2 DPDPLQDFCVA-DLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELD 60
Query: 84 VEQIPGLNTLGVSAARIDFAPYGQNPPHTHPRATEILVVLEGTLYVGFVTSNQLNNTLIA 143
V + PG NTLGVS R+DFAP G NPPH HPRATEI +V++G L VG + S N L +
Sbjct: 61 VAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYS 120
Query: 144 KVLNKGDVFVFPIGMIHFQFNIGKTNAVAFAGFGSQNPGVITIANTVFGADPPINPDFLG 203
+V+ G+ FV P G++HFQFN+GKT A F SQNPG++ + T+FG+DPPI L
Sbjct: 121 RVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLT 180
Query: 204 KAFQLDPQVVKDLQNKF 220
KA +++ VV+ L++KF
Sbjct: 181 KALRVEAGVVELLKSKF 197
|
| >2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Length = 493 | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Length = 476 | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Length = 476 | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Length = 510 | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Length = 434 | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Length = 434 | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Length = 416 | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Length = 416 | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Length = 361 | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Length = 361 | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Length = 445 | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Length = 445 | Back alignment and structure |
|---|
| >2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Length = 459 | Back alignment and structure |
|---|
| >2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Length = 459 | Back alignment and structure |
|---|
| >3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Length = 465 | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Length = 496 | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Length = 496 | Back alignment and structure |
|---|
| >3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Length = 466 | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385 | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385 | Back alignment and structure |
|---|
| >2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Length = 397 | Back alignment and structure |
|---|
| >2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Length = 397 | Back alignment and structure |
|---|
| >1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Length = 178 | Back alignment and structure |
|---|
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Length = 418 | Back alignment and structure |
|---|
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Length = 418 | Back alignment and structure |
|---|
| >1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Length = 163 | Back alignment and structure |
|---|
| >3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Length = 531 | Back alignment and structure |
|---|
| >3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Length = 167 | Back alignment and structure |
|---|
| >1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Length = 133 | Back alignment and structure |
|---|
| >1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Length = 105 | Back alignment and structure |
|---|
| >3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Length = 145 | Back alignment and structure |
|---|
| >3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Length = 102 | Back alignment and structure |
|---|
| >2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Length = 107 | Back alignment and structure |
|---|
| >1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Length = 126 | Back alignment and structure |
|---|
| >3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Length = 125 | Back alignment and structure |
|---|
| >2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Length = 113 | Back alignment and structure |
|---|
| >3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Length = 125 | Back alignment and structure |
|---|
| >1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Length = 337 | Back alignment and structure |
|---|
| >1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Length = 337 | Back alignment and structure |
|---|
| >1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Length = 350 | Back alignment and structure |
|---|
| >1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Length = 350 | Back alignment and structure |
|---|
| >1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* Length = 190 | Back alignment and structure |
|---|
| >2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Length = 354 | Back alignment and structure |
|---|
| >1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X Length = 79 | Back alignment and structure |
|---|
| >3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Length = 156 | Back alignment and structure |
|---|
| >3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Length = 166 | Back alignment and structure |
|---|
| >3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Length = 243 | Back alignment and structure |
|---|
| >4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Length = 126 | Back alignment and structure |
|---|
| >3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Length = 163 | Back alignment and structure |
|---|
| >2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Length = 97 | Back alignment and structure |
|---|
| >3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} Length = 171 | Back alignment and structure |
|---|
| >2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Length = 116 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 224 | |||
| 1fi2_A | 201 | Oxalate oxidase, germin; beta-jellyroll, oxidoredu | 100.0 | |
| 3kgl_A | 466 | Cruciferin; 11S SEED globulin, rapeseed, SEED stor | 100.0 | |
| 3qac_A | 465 | 11S globulin SEED storage protein; 11S SEED storag | 100.0 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 100.0 | |
| 2e9q_A | 459 | 11S globulin subunit beta; cucubitin, pumpkin SEED | 99.97 | |
| 3fz3_A | 531 | Prunin; TREE NUT allergen, allergy, amandin, almon | 99.97 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 99.97 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 99.97 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 99.96 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 99.96 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 99.96 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 99.96 | |
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 99.96 | |
| 1dgw_A | 178 | Canavalin; duplicated swiss-roll beta barrels, loo | 99.95 | |
| 2phl_A | 397 | Phaseolin; plant SEED storage protein(vicilin); HE | 99.94 | |
| 2e9q_A | 459 | 11S globulin subunit beta; cucubitin, pumpkin SEED | 99.93 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 99.92 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 99.92 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 99.91 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 99.91 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 99.91 | |
| 3qac_A | 465 | 11S globulin SEED storage protein; 11S SEED storag | 99.91 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 99.91 | |
| 2phl_A | 397 | Phaseolin; plant SEED storage protein(vicilin); HE | 99.91 | |
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 99.91 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 99.89 | |
| 3kgl_A | 466 | Cruciferin; 11S SEED globulin, rapeseed, SEED stor | 99.88 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 99.88 | |
| 3fz3_A | 531 | Prunin; TREE NUT allergen, allergy, amandin, almon | 99.87 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 99.85 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 99.82 | |
| 1dgw_X | 79 | Canavalin; duplicated swiss-roll beta barrels, loo | 99.82 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 99.79 | |
| 3h8u_A | 125 | Uncharacterized conserved protein with double-STR | 99.54 | |
| 2xlg_A | 239 | SLL1785 protein, CUCA; metal binding protein, cupi | 99.51 | |
| 1lr5_A | 163 | Auxin binding protein 1; beta jellyroll, double st | 99.48 | |
| 3l2h_A | 162 | Putative sugar phosphate isomerase; AFE_0303, stru | 99.48 | |
| 2fqp_A | 97 | Hypothetical protein BP2299; double-stranded beta- | 99.45 | |
| 1v70_A | 105 | Probable antibiotics synthesis protein; structural | 99.45 | |
| 2oa2_A | 148 | BH2720 protein; 10175341, structural genomics, joi | 99.43 | |
| 3i7d_A | 163 | Sugar phosphate isomerase; YP_168127.1, structural | 99.42 | |
| 3ibm_A | 167 | Cupin 2, conserved barrel domain protein; cupin 2 | 99.4 | |
| 3es1_A | 172 | Cupin 2, conserved barrel domain protein; YP_00116 | 99.4 | |
| 1x82_A | 190 | Glucose-6-phosphate isomerase; cupin superfamily, | 99.39 | |
| 2gu9_A | 113 | Tetracenomycin polyketide synthesis protein; X-RAY | 99.38 | |
| 3ht1_A | 145 | REMF protein; cupin fold, Zn-binding, antibiotic b | 99.37 | |
| 3lag_A | 98 | Uncharacterized protein RPA4178; functionally unkn | 99.37 | |
| 4e2g_A | 126 | Cupin 2 conserved barrel domain protein; MCSG, PSI | 99.35 | |
| 1o4t_A | 133 | Putative oxalate decarboxylase; double-stranded be | 99.34 | |
| 2b8m_A | 117 | Hypothetical protein MJ0764; structural genomics, | 99.34 | |
| 3fjs_A | 114 | Uncharacterized protein with RMLC-like cupin fold; | 99.33 | |
| 3kgz_A | 156 | Cupin 2 conserved barrel domain protein; metallopr | 99.32 | |
| 2bnm_A | 198 | Epoxidase; oxidoreductase, cupin, HTH, cation-depe | 99.32 | |
| 3jzv_A | 166 | Uncharacterized protein RRU_A2000; structural geno | 99.29 | |
| 2pfw_A | 116 | Cupin 2, conserved barrel domain protein; cupin do | 99.29 | |
| 3cew_A | 125 | Uncharacterized cupin protein; all beta-protein, j | 99.29 | |
| 2f4p_A | 147 | Hypothetical protein TM1010; double-stranded beta- | 99.28 | |
| 2vpv_A | 166 | Protein MIF2, MIF2P; nucleus, mitosis, centromere, | 99.27 | |
| 1vj2_A | 126 | Novel manganese-containing cupin TM1459; structura | 99.27 | |
| 2o8q_A | 134 | Hypothetical protein; cpuin-like fold, structural | 99.27 | |
| 4i4a_A | 128 | Similar to unknown protein; structural genomics, P | 99.24 | |
| 1yhf_A | 115 | Hypothetical protein SPY1581; structural genomics, | 99.24 | |
| 2ozi_A | 98 | Hypothetical protein RPA4178; APC6210, putative pr | 99.23 | |
| 1rc6_A | 261 | Hypothetical protein YLBA; structural genomics, NY | 99.23 | |
| 1y9q_A | 192 | Transcriptional regulator, HTH_3 family; transcrip | 99.22 | |
| 3h7j_A | 243 | Bacilysin biosynthesis protein BACB; YWFC, bacilys | 99.18 | |
| 2q30_A | 110 | Uncharacterized protein; double-stranded beta-heli | 99.16 | |
| 2ozj_A | 114 | Cupin 2, conserved barrel; cupin superfamily prote | 99.14 | |
| 2d40_A | 354 | Z3393, putative gentisate 1,2-dioxygenase; gentisi | 99.14 | |
| 1y3t_A | 337 | Hypothetical protein YXAG; BI cupin, dioxygenase, | 99.13 | |
| 1sef_A | 274 | Conserved hypothetical protein; structural genomic | 99.12 | |
| 3lwc_A | 119 | Uncharacterized protein; structural genomics, unkn | 99.12 | |
| 2d40_A | 354 | Z3393, putative gentisate 1,2-dioxygenase; gentisi | 99.1 | |
| 1juh_A | 350 | Quercetin 2,3-dioxygenase; cupin, glycoprotein, be | 99.1 | |
| 3h7j_A | 243 | Bacilysin biosynthesis protein BACB; YWFC, bacilys | 99.07 | |
| 1y3t_A | 337 | Hypothetical protein YXAG; BI cupin, dioxygenase, | 99.05 | |
| 3d82_A | 102 | Cupin 2, conserved barrel domain protein; structur | 99.05 | |
| 1sq4_A | 278 | GLXB, glyoxylate-induced protein; structural genom | 99.03 | |
| 1sfn_A | 246 | Conserved hypothetical protein; structural genomic | 99.03 | |
| 2i45_A | 107 | Hypothetical protein; neisseria meningitidis cupin | 99.03 | |
| 4b29_A | 217 | Dimethylsulfoniopropionate lyase; hydrolase, dimet | 99.02 | |
| 1rc6_A | 261 | Hypothetical protein YLBA; structural genomics, NY | 99.02 | |
| 2pyt_A | 133 | Ethanolamine utilization protein EUTQ; structural | 99.01 | |
| 2opk_A | 112 | Hypothetical protein; putative mannose-6-phosphate | 99.0 | |
| 3bu7_A | 394 | Gentisate 1,2-dioxygenase; cupin domain, oxidoredu | 98.99 | |
| 4e2q_A | 266 | Ureidoglycine aminohydrolase; BI-cupin, manganese | 98.99 | |
| 3nw4_A | 368 | Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc | 98.98 | |
| 1sef_A | 274 | Conserved hypothetical protein; structural genomic | 98.98 | |
| 3rns_A | 227 | Cupin 2 conserved barrel domain protein; structura | 98.97 | |
| 3bu7_A | 394 | Gentisate 1,2-dioxygenase; cupin domain, oxidoredu | 98.95 | |
| 3rns_A | 227 | Cupin 2 conserved barrel domain protein; structura | 98.95 | |
| 4e2q_A | 266 | Ureidoglycine aminohydrolase; BI-cupin, manganese | 98.9 | |
| 1sq4_A | 278 | GLXB, glyoxylate-induced protein; structural genom | 98.87 | |
| 4axo_A | 151 | EUTQ, ethanolamine utilization protein; structural | 98.87 | |
| 4h7l_A | 157 | Uncharacterized protein; structural genomics, PSI- | 98.87 | |
| 1vr3_A | 191 | Acireductone dioxygenase; 13543033, structural gen | 98.85 | |
| 1dgw_Y | 93 | Canavalin; duplicated swiss-roll beta barrels, loo | 98.83 | |
| 2q1z_B | 195 | Anti-sigma factor CHRR, transcriptional activator; | 98.79 | |
| 3ebr_A | 159 | Uncharacterized RMLC-like cupin; structural genomi | 98.78 | |
| 1o5u_A | 101 | Novel thermotoga maritima enzyme TM1112; cupin, st | 98.72 | |
| 3cjx_A | 165 | Protein of unknown function with A cupin-like FOL; | 98.67 | |
| 1sfn_A | 246 | Conserved hypothetical protein; structural genomic | 98.67 | |
| 3eqe_A | 171 | Putative cystein deoxygenase; YUBC, SR112, NESG, s | 98.65 | |
| 1juh_A | 350 | Quercetin 2,3-dioxygenase; cupin, glycoprotein, be | 98.64 | |
| 2y0o_A | 175 | Probable D-lyxose ketol-isomerase; carbohydrate me | 98.63 | |
| 3bcw_A | 123 | Uncharacterized protein; structural genomics, join | 98.62 | |
| 2o1q_A | 145 | Putative acetyl/propionyl-COA carboxylase, alpha; | 98.61 | |
| 1zrr_A | 179 | E-2/E-2' protein; nickel, cupin, beta helix, methi | 98.61 | |
| 1yfu_A | 174 | 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid | 98.53 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 98.46 | |
| 3o14_A | 223 | Anti-ecfsigma factor, CHRR; cupin, structural geno | 98.43 | |
| 3d0j_A | 140 | Uncharacterized protein CA_C3497; beta-barrel, str | 98.42 | |
| 3nw4_A | 368 | Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc | 98.41 | |
| 2gm6_A | 208 | Cysteine dioxygenase type I; structural genomics, | 98.41 | |
| 3bal_A | 153 | Acetylacetone-cleaving enzyme; jelly roll, tetrame | 98.3 | |
| 3eln_A | 200 | Cysteine dioxygenase type 1; peroxysulfenate, non- | 98.29 | |
| 1zvf_A | 176 | 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b | 98.26 | |
| 2arc_A | 164 | ARAC, arabinose operon regulatory protein; transcr | 98.17 | |
| 2qnk_A | 286 | 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol | 98.07 | |
| 3myx_A | 238 | Uncharacterized protein pspto_0244; protein of unk | 97.95 | |
| 2pa7_A | 141 | DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug | 97.85 | |
| 3uss_A | 211 | Putative uncharacterized protein; cupin, three his | 97.83 | |
| 3ejk_A | 174 | DTDP sugar isomerase; YP_390184.1, structural geno | 97.78 | |
| 3es4_A | 116 | Uncharacterized protein DUF861 with A RMLC-like C; | 97.68 | |
| 3myx_A | 238 | Uncharacterized protein pspto_0244; protein of unk | 97.46 | |
| 3o14_A | 223 | Anti-ecfsigma factor, CHRR; cupin, structural geno | 97.28 | |
| 3gbg_A | 276 | TCP pilus virulence regulatory protein; cupin, hel | 97.24 | |
| 2vec_A | 256 | YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe | 97.18 | |
| 1tq5_A | 242 | Protein YHHW; bicupin, pirin, montreal-kingston ba | 96.95 | |
| 2ixk_A | 184 | DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l | 96.9 | |
| 1ep0_A | 185 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race | 96.84 | |
| 1yud_A | 170 | Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, p | 96.83 | |
| 1vrb_A | 342 | Putative asparaginyl hydroxylase; 2636534, structu | 96.82 | |
| 3ryk_A | 205 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 96.8 | |
| 4gjz_A | 235 | Lysine-specific demethylase 8; JMJC, beta barrel, | 96.7 | |
| 3kmh_A | 246 | D-lyxose isomerase; cupin beta-barrel, structural | 96.7 | |
| 1dzr_A | 183 | DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, | 96.56 | |
| 3bb6_A | 127 | Uncharacterized protein YEAR; structural genomics, | 96.56 | |
| 1wlt_A | 196 | 176AA long hypothetical DTDP-4-dehydrorhamnose 3, | 96.56 | |
| 1nxm_A | 197 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jell | 96.34 | |
| 1oi6_A | 205 | PCZA361.16; epimerase, vancomycin group antibiotic | 96.32 | |
| 3d8c_A | 349 | Hypoxia-inducible factor 1 alpha inhibitor; FIH, H | 96.31 | |
| 2c0z_A | 216 | NOVW; isomerase, epimerase, antibiotic biosynthesi | 96.27 | |
| 1upi_A | 225 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 96.16 | |
| 4hn1_A | 201 | Putative 3-epimerase in D-allose pathway; 3'-monoe | 95.95 | |
| 3al5_A | 338 | HTYW5, JMJC domain-containing protein C2ORF60; tRN | 95.66 | |
| 2xdv_A | 442 | MYC-induced nuclear antigen; ribosome biogenesis, | 95.62 | |
| 4diq_A | 489 | Lysine-specific demethylase NO66; structural genom | 95.46 | |
| 2p17_A | 277 | Pirin-like protein; GK1651, structural genomics, s | 95.41 | |
| 2qdr_A | 303 | Uncharacterized protein; double-stranded beta-heli | 95.29 | |
| 3k2o_A | 336 | Bifunctional arginine demethylase and lysyl-hydro | 95.09 | |
| 1j1l_A | 290 | Pirin; beta sandwich, cupin, iron, metatl binding | 95.02 | |
| 1eyb_A | 471 | Homogentisate 1,2-dioxygenase; jelly roll, beta sa | 94.74 | |
| 2qjv_A | 270 | Uncharacterized IOLB-like protein; structural geno | 94.67 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 94.51 | |
| 2yu1_A | 451 | JMJC domain-containing histone demethylation PROT; | 94.46 | |
| 1e5r_A | 290 | Proline oxidase; oxidoreductase, oxygenase, 2-oxog | 94.26 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 93.91 | |
| 3k3o_A | 371 | PHF8, PHD finger protein 8; histone demethylase, c | 93.41 | |
| 3rcq_A | 197 | Aspartyl/asparaginyl beta-hydroxylase; structural | 93.21 | |
| 3kv9_A | 397 | JMJC domain-containing histone demethylation prote | 93.08 | |
| 3pua_A | 392 | GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe | 92.15 | |
| 2oyz_A | 94 | UPF0345 protein VPA0057; unknown function, structu | 91.84 | |
| 2qnk_A | 286 | 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol | 91.73 | |
| 3hqx_A | 111 | UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MC | 91.08 | |
| 2rg4_A | 216 | Uncharacterized protein; rhodobacterales, oceanico | 90.82 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 90.77 | |
| 1pmi_A | 440 | PMI, phosphomannose isomerase; aldose-ketose isome | 90.19 | |
| 1xru_A | 282 | 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomer; | 89.66 | |
| 1ywk_A | 289 | 4-deoxy-L-threo-5-hexosulose-uronate ketol- isomer | 88.58 | |
| 3eo6_A | 106 | Protein of unknown function (DUF1255); AFE_2634, s | 87.56 | |
| 1qwr_A | 319 | Mannose-6-phosphate isomerase; structural genomics | 87.53 | |
| 2wfp_A | 394 | Mannose-6-phosphate isomerase; APO-structure, meta | 87.27 | |
| 2pqq_A | 149 | Putative transcriptional regulator; APC7345, strep | 86.21 | |
| 3mdp_A | 142 | Cyclic nucleotide-binding domain (CNMP-BD) protei; | 84.23 | |
| 3dl3_A | 119 | Tellurite resistance protein B; X-RAY NESG VFR98 Q | 83.93 | |
| 3dn7_A | 194 | Cyclic nucleotide binding regulatory protein; stru | 83.79 | |
| 1tq5_A | 242 | Protein YHHW; bicupin, pirin, montreal-kingston ba | 83.68 | |
| 2oz6_A | 207 | Virulence factor regulator; winged helix, helix-tu | 83.45 | |
| 1zx5_A | 300 | Mannosephosphate isomerase, putative; STRU genomic | 83.02 | |
| 4ev0_A | 216 | Transcription regulator, CRP family; CAMP binding, | 82.69 | |
| 3fx3_A | 237 | Cyclic nucleotide-binding protein; helix_TURN_heli | 82.41 | |
| 3ryp_A | 210 | Catabolite gene activator; CAMP receptor protein ( | 82.29 | |
| 3gyd_A | 187 | CNMP-BD protein, cyclic nucleotide-binding domain; | 82.09 | |
| 3e97_A | 231 | Transcriptional regulator, CRP/FNR family; YP_6044 | 81.95 | |
| 2ypd_A | 392 | Probable JMJC domain-containing histone demethyla | 81.67 | |
| 3iwz_A | 230 | CAP-like, catabolite activation-like protein; XCC, | 81.31 | |
| 3d0s_A | 227 | Transcriptional regulatory protein; CAMP receptor | 81.04 | |
| 3idb_B | 161 | CAMP-dependent protein kinase type II-beta regulat | 80.91 | |
| 1zyb_A | 232 | Transcription regulator, CRP family; NP_813211.1, | 80.23 |
| >1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A | Back alignment and structure |
|---|
Probab=100.00 E-value=2.9e-51 Score=343.82 Aligned_cols=198 Identities=49% Similarity=0.841 Sum_probs=185.8
Q ss_pred cCCCCCcceeeecCCCCCc-ceecCcccCCCCCCCCCCeeeec-CCCCCCccCCCCeEEEEecccCcCcccccceEEEEE
Q 027369 23 YDPSPLQDICVAIDEPKNA-VFVNGKFCKDPKLAKPEDFFFSG-LDQPGDTANRLGFKVTTVNVEQIPGLNTLGVSAARI 100 (224)
Q Consensus 23 ~d~~~~~dfcv~~~~~~~~-~~~~g~~ck~p~~v~~~df~f~~-l~~~~~~~~~~g~~v~~~~~~~~P~L~~lgis~~rv 100 (224)
+||||||||||| |++++ +++|||+|| |+.++++||+|++ +++++++.|..|+.++.++..++|+++++|+++.++
T Consensus 1 ~~~~~~~d~c~~--~~~~~~~~~~g~~c~-~~~~~~~df~~~~~~~~~~~~~~~~G~~v~~~~~~~~p~l~~~~~~~~~~ 77 (201)
T 1fi2_A 1 TDPDPLQDFCVA--DLDGKAVSVNGHTCK-PMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRV 77 (201)
T ss_dssp CCCCCSSSCCCB--CCCTTSCCCSSCCBC-CGGGCCSCTTCCCTTSSCCCCCSTTSEEEEEESTTTCGGGTTSSCEEEEE
T ss_pred CCCcccceeEEe--cCCCCcccccCcccc-cCcccccceEEeeeecCCCCccCCCCcEEEEEecccCCCcccCceEEEEE
Confidence 699999999999 98888 999999999 9999999999999 999998889999999999999999999999999999
Q ss_pred EEcCCCcCCceeCCCCcEEEEEEecEEEEEEEecCCCCCeeEEEEecCCCEEEEcCCCeeEEEeCCCCcEEEEEEEcCCC
Q 027369 101 DFAPYGQNPPHTHPRATEILVVLEGTLYVGFVTSNQLNNTLIAKVLNKGDVFVFPIGMIHFQFNIGKTNAVAFAGFGSQN 180 (224)
Q Consensus 101 ~l~pgg~~ppH~Hp~a~Ei~yVl~G~~~v~~~~~~~~~~~~~~~~L~~GDv~v~P~G~~H~~~N~G~~~a~~i~~~~s~~ 180 (224)
+++||++.++|||++++|++||++|++++++.+.++++++++++.|++||+++||+|.+|+++|.|++++++++++++++
T Consensus 78 ~l~pg~~~~~H~H~~~~E~~~Vl~G~~~v~~~~~~~~~~~~~~~~l~~GD~~~iP~g~~H~~~N~g~~~~~~l~v~~~~~ 157 (201)
T 1fi2_A 78 DFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQN 157 (201)
T ss_dssp EECTTCEEEEEECTTCCEEEEEEESEEEEEEECCGGGTTCEEEEEEETTCEEEECTTCCEEEEECSSSCEEEEEEESSSC
T ss_pred EECCCCCCCCeECCCCCEEEEEEeCEEEEEEEcCCCCCCeEEEEEECCCCEEEECCCCeEEEEeCCCCCEEEEEEECCCC
Confidence 99999999999999989999999999999997642101466679999999999999999999999999999999999999
Q ss_pred CceeeechhhhcCCCCCCHHHHHHhcCCCHHHHHHHhhhccCC
Q 027369 181 PGVITIANTVFGADPPINPDFLGKAFQLDPQVVKDLQNKFMNG 223 (224)
Q Consensus 181 pg~~~i~~~lf~~~p~~~~~vLa~af~~~~~~v~~l~~~~~~~ 223 (224)
|+.+.++.++|+.+|++++++|+++|+++++++++||++|+++
T Consensus 158 p~~~~~~~~~~~~~~~~~~~vl~~af~~~~~~v~~l~~~~~~~ 200 (201)
T 1fi2_A 158 PGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGG 200 (201)
T ss_dssp CCCEEHHHHHHHCSSCCCHHHHHHHHTSCHHHHHHHHHHSTTC
T ss_pred CCeEehhhHHhcCCCCCCHHHHHHHHCcCHHHHHHHHHhhcCC
Confidence 9999999999999888999999999999999999999999765
|
| >3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} | Back alignment and structure |
|---|
| >3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} | Back alignment and structure |
|---|
| >2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A | Back alignment and structure |
|---|
| >3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A | Back alignment and structure |
|---|
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A | Back alignment and structure |
|---|
| >1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A | Back alignment and structure |
|---|
| >2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* | Back alignment and structure |
|---|
| >2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A | Back alignment and structure |
|---|
| >3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* | Back alignment and structure |
|---|
| >2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* | Back alignment and structure |
|---|
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A | Back alignment and structure |
|---|
| >2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A | Back alignment and structure |
|---|
| >3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} | Back alignment and structure |
|---|
| >3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A | Back alignment and structure |
|---|
| >1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A | Back alignment and structure |
|---|
| >3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A | Back alignment and structure |
|---|
| >1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* | Back alignment and structure |
|---|
| >3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} | Back alignment and structure |
|---|
| >2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} | Back alignment and structure |
|---|
| >1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A | Back alignment and structure |
|---|
| >2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} | Back alignment and structure |
|---|
| >3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* | Back alignment and structure |
|---|
| >2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A | Back alignment and structure |
|---|
| >3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A | Back alignment and structure |
|---|
| >3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 | Back alignment and structure |
|---|
| >3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A | Back alignment and structure |
|---|
| >3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 | Back alignment and structure |
|---|
| >2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} | Back alignment and structure |
|---|
| >1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 | Back alignment and structure |
|---|
| >3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* | Back alignment and structure |
|---|
| >2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} | Back alignment and structure |
|---|
| >2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* | Back alignment and structure |
|---|
| >1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} | Back alignment and structure |
|---|
| >2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* | Back alignment and structure |
|---|
| >3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* | Back alignment and structure |
|---|
| >1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* | Back alignment and structure |
|---|
| >3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} | Back alignment and structure |
|---|
| >1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} | Back alignment and structure |
|---|
| >1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 | Back alignment and structure |
|---|
| >2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A | Back alignment and structure |
|---|
| >3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A | Back alignment and structure |
|---|
| >1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A | Back alignment and structure |
|---|
| >1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} | Back alignment and structure |
|---|
| >4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 | Back alignment and structure |
|---|
| >1dgw_Y Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_Y | Back alignment and structure |
|---|
| >3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A | Back alignment and structure |
|---|
| >3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* | Back alignment and structure |
|---|
| >2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 | Back alignment and structure |
|---|
| >1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A | Back alignment and structure |
|---|
| >1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A | Back alignment and structure |
|---|
| >2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii} | Back alignment and structure |
|---|
| >3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A | Back alignment and structure |
|---|
| >1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 | Back alignment and structure |
|---|
| >2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A | Back alignment and structure |
|---|
| >2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A | Back alignment and structure |
|---|
| >3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* | Back alignment and structure |
|---|
| >3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, JOIN for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12 | Back alignment and structure |
|---|
| >2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* | Back alignment and structure |
|---|
| >1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A* | Back alignment and structure |
|---|
| >1yud_A Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Shewanella oneidensis} SCOP: b.82.1.16 | Back alignment and structure |
|---|
| >1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 | Back alignment and structure |
|---|
| >3ryk_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, STRU genomics, infectious diseases; HET: TYD; 1.63A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* | Back alignment and structure |
|---|
| >3kmh_A D-lyxose isomerase; cupin beta-barrel, structural genomics, montreal-kingston BA structural genomics initiative, BSGI; 1.58A {Escherichia coli O157} PDB: 3mpb_A* | Back alignment and structure |
|---|
| >1dzr_A DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 3\,5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A* | Back alignment and structure |
|---|
| >3bb6_A Uncharacterized protein YEAR; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Escherichia coli} SCOP: b.82.2.13 | Back alignment and structure |
|---|
| >1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A | Back alignment and structure |
|---|
| >1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A* | Back alignment and structure |
|---|
| >1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A | Back alignment and structure |
|---|
| >3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... | Back alignment and structure |
|---|
| >2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1 | Back alignment and structure |
|---|
| >1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A* | Back alignment and structure |
|---|
| >4hn1_A Putative 3-epimerase in D-allose pathway; 3'-monoepimerase, natural product, deoxysugar, chalcomycin, mycinose, cupin fold; HET: TYD THM; 1.60A {Streptomyces bikiniensis} PDB: 4hmz_A* 4hn0_A | Back alignment and structure |
|---|
| >3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* | Back alignment and structure |
|---|
| >2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} | Back alignment and structure |
|---|
| >4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2p17_A Pirin-like protein; GK1651, structural genomics, south collaboratory for structural genomics, protein structure in secsg; 1.52A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >2qdr_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE EPE; 2.60A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* | Back alignment and structure |
|---|
| >1j1l_A Pirin; beta sandwich, cupin, iron, metatl binding protein; 2.10A {Homo sapiens} SCOP: b.82.1.12 PDB: 3acl_A* | Back alignment and structure |
|---|
| >1eyb_A Homogentisate 1,2-dioxygenase; jelly roll, beta sandwich, oxidoreductase; 1.90A {Homo sapiens} SCOP: b.82.1.4 PDB: 1ey2_A | Back alignment and structure |
|---|
| >2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A | Back alignment and structure |
|---|
| >1e5r_A Proline oxidase; oxidoreductase, oxygenase, 2-oxoglutarate dependent oxygenase; 2.30A {Streptomyces SP} SCOP: b.82.2.4 PDB: 1e5s_A | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A* | Back alignment and structure |
|---|
| >3rcq_A Aspartyl/asparaginyl beta-hydroxylase; structural genomics, structural genomics consortium, SGC, oxidoreductase, human; HET: OGA; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3kv9_A JMJC domain-containing histone demethylation protein 1D; jumonji domain lysine demethylase, metal-binding, zinc, zinc-finger; 2.29A {Homo sapiens} PDB: 3kva_A* 3kvb_A* 3u78_A* | Back alignment and structure |
|---|
| >3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* | Back alignment and structure |
|---|
| >2oyz_A UPF0345 protein VPA0057; unknown function, structural genomi 2, protein structure initiative, midwest center for structu genomics, MCSG; 1.71A {Vibrio parahaemolyticus} SCOP: b.82.1.22 | Back alignment and structure |
|---|
| >2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A | Back alignment and structure |
|---|
| >3hqx_A UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MCSG, structural genomics, protein STRU initiative, midwest center for structural genomics; 1.66A {Acinetobacter SP} SCOP: b.82.1.0 | Back alignment and structure |
|---|
| >2rg4_A Uncharacterized protein; rhodobacterales, oceanicola granulosus HTCC2516, Q2CBJ1_9RHO structural genomics, PSI-2; 1.90A {Oceanicola granulosus} PDB: 3bvc_A | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >1pmi_A PMI, phosphomannose isomerase; aldose-ketose isomerase; 1.70A {Candida albicans} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >1xru_A 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomer; beta barrel, cupin, isomerase; HET: 1PE; 1.94A {Escherichia coli} SCOP: b.82.1.13 PDB: 1x8m_A | Back alignment and structure |
|---|
| >1ywk_A 4-deoxy-L-threo-5-hexosulose-uronate ketol- isomerase 1; structural genomics, nysgxrc target T1814, PSI, protein structure initiative; 2.95A {Enterococcus faecalis} SCOP: b.82.1.13 | Back alignment and structure |
|---|
| >3eo6_A Protein of unknown function (DUF1255); AFE_2634, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 0.97A {Acidithiobacillus ferrooxidans ATCC23270} | Back alignment and structure |
|---|
| >1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >2wfp_A Mannose-6-phosphate isomerase; APO-structure, metal-binding; 1.67A {Salmonella typhimurium} PDB: 3h1w_A 3h1m_A 3h1y_A* | Back alignment and structure |
|---|
| >2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3dl3_A Tellurite resistance protein B; X-RAY NESG VFR98 Q5E3X2_VIBF1, structural genomics, PSI-2, protein structure initiative; 2.30A {Vibrio fischeri ES114} SCOP: b.82.2.13 | Back alignment and structure |
|---|
| >3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12 | Back alignment and structure |
|---|
| >2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >1zx5_A Mannosephosphate isomerase, putative; STRU genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; HET: LFR; 2.30A {Archaeoglobus fulgidus} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* | Back alignment and structure |
|---|
| >3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... | Back alignment and structure |
|---|
| >3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} | Back alignment and structure |
|---|
| >2ypd_A Probable JMJC domain-containing histone demethyla PROT EIN 2C; oxidoreductase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* | Back alignment and structure |
|---|
| >3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* | Back alignment and structure |
|---|
| >1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 224 | ||||
| d2et1a1 | 201 | b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare | 1e-80 | |
| d1fxza2 | 174 | b.82.1.2 (A:297-470) Seed storage 7S protein {Soyb | 7e-40 | |
| d1uika2 | 185 | b.82.1.2 (A:351-535) Seed storage 7S protein {Soyb | 5e-37 | |
| d1j58a_ | 372 | b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B | 1e-36 | |
| d1j58a_ | 372 | b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B | 1e-19 | |
| d1od5a2 | 173 | b.82.1.2 (A:321-493) Seed storage 7S protein {Soyb | 2e-35 | |
| g1dgw.1 | 168 | b.82.1.2 (X:,Y:) Seed storage 7S protein {Jack bea | 3e-34 | |
| d2phla2 | 162 | b.82.1.2 (A:220-381) Seed storage 7S protein {Fren | 4e-26 | |
| d1uija1 | 170 | b.82.1.2 (A:6-175) Seed storage 7S protein {Soybea | 8e-23 | |
| d1dgwa_ | 178 | b.82.1.2 (A:) Seed storage 7S protein {Jack bean ( | 3e-22 | |
| d1uika1 | 203 | b.82.1.2 (A:148-350) Seed storage 7S protein {Soyb | 6e-19 | |
| d2phla1 | 200 | b.82.1.2 (A:11-210) Seed storage 7S protein {Frenc | 2e-16 | |
| d1lr5a_ | 160 | b.82.1.2 (A:) Auxin binding protein {Maize (Zea ma | 9e-15 | |
| d1o4ta_ | 115 | b.82.1.9 (A:) Hypothetical protein TM1287 {Thermot | 2e-09 | |
| d1v70a_ | 105 | b.82.1.9 (A:) Hypothetical protein TTHA0104 {Therm | 2e-07 | |
| d1y3ta1 | 330 | b.82.1.5 (A:5-334) Hypothetical protein YxaG {Baci | 2e-07 | |
| d1y3ta1 | 330 | b.82.1.5 (A:5-334) Hypothetical protein YxaG {Baci | 7e-05 | |
| d1fxza1 | 239 | b.82.1.2 (A:10-248) Seed storage 7S protein {Soybe | 2e-06 | |
| d2d40a1 | 308 | b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Es | 4e-06 | |
| d2d40a1 | 308 | b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Es | 5e-05 | |
| d1od5a1 | 245 | b.82.1.2 (A:7-251) Seed storage 7S protein {Soybea | 5e-06 | |
| d1juha_ | 348 | b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergill | 5e-06 | |
| d1juha_ | 348 | b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergill | 1e-04 | |
| d2f4pa1 | 134 | b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Th | 1e-05 | |
| d1x82a_ | 190 | b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI { | 2e-05 | |
| d1zrra1 | 179 | b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebs | 3e-05 | |
| d1sefa_ | 250 | b.82.1.11 (A:) Hypothetical protein EF2996 {Entero | 8e-05 | |
| d1sefa_ | 250 | b.82.1.11 (A:) Hypothetical protein EF2996 {Entero | 6e-04 | |
| d1vj2a_ | 114 | b.82.1.10 (A:) Hypothetical protein TM1459 {Thermo | 9e-05 | |
| d3bu7a1 | 355 | b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Si | 2e-04 | |
| d1sq4a_ | 273 | b.82.1.11 (A:) Glyoxylate-induced protein PA1140 { | 4e-04 | |
| d1rc6a_ | 253 | b.82.1.11 (A:) Hypothetical protein YlbA {Escheric | 5e-04 | |
| d2phda1 | 351 | b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Ps | 8e-04 | |
| d2o1qa1 | 144 | b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA | 9e-04 | |
| d1yhfa1 | 112 | b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {S | 0.002 |
| >d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 201 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Double-stranded beta-helix superfamily: RmlC-like cupins family: Germin/Seed storage 7S protein domain: Germin species: Barley (Hordeum vulgare) [TaxId: 4513]
Score = 237 bits (607), Expect = 1e-80
Identities = 96/197 (48%), Positives = 126/197 (63%), Gaps = 1/197 (0%)
Query: 24 DPSPLQDICVAIDEPKNAVFVNGKFCKDPKLAKPEDFFFSGLDQPGDTANRLGFKVTTVN 83
DP PLQD CVA D AV VNG CK A + F S L + G+T+ G VT ++
Sbjct: 2 DPDPLQDFCVA-DLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELD 60
Query: 84 VEQIPGLNTLGVSAARIDFAPYGQNPPHTHPRATEILVVLEGTLYVGFVTSNQLNNTLIA 143
V + PG NTLGVS R+DFAP G NPPH HPRATEI +V++G L VG + S N L +
Sbjct: 61 VAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYS 120
Query: 144 KVLNKGDVFVFPIGMIHFQFNIGKTNAVAFAGFGSQNPGVITIANTVFGADPPINPDFLG 203
+V+ G+ FV P G++HFQFN+GKT A F SQNPG++ + T+FG+DPPI L
Sbjct: 121 RVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLT 180
Query: 204 KAFQLDPQVVKDLQNKF 220
KA +++ VV+ L++KF
Sbjct: 181 KALRVEAGVVELLKSKF 197
|
| >d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Length = 174 | Back information, alignment and structure |
|---|
| >d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 185 | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372 | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372 | Back information, alignment and structure |
|---|
| >d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Length = 173 | Back information, alignment and structure |
|---|
| >d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 162 | Back information, alignment and structure |
|---|
| >d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Length = 170 | Back information, alignment and structure |
|---|
| >d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Length = 178 | Back information, alignment and structure |
|---|
| >d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 203 | Back information, alignment and structure |
|---|
| >d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 200 | Back information, alignment and structure |
|---|
| >d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Length = 160 | Back information, alignment and structure |
|---|
| >d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Length = 115 | Back information, alignment and structure |
|---|
| >d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Length = 105 | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Length = 330 | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Length = 330 | Back information, alignment and structure |
|---|
| >d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Length = 239 | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Length = 308 | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Length = 308 | Back information, alignment and structure |
|---|
| >d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Length = 245 | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Length = 348 | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Length = 348 | Back information, alignment and structure |
|---|
| >d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Length = 134 | Back information, alignment and structure |
|---|
| >d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 190 | Back information, alignment and structure |
|---|
| >d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} Length = 179 | Back information, alignment and structure |
|---|
| >d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Length = 250 | Back information, alignment and structure |
|---|
| >d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Length = 250 | Back information, alignment and structure |
|---|
| >d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Length = 114 | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Length = 355 | Back information, alignment and structure |
|---|
| >d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Length = 273 | Back information, alignment and structure |
|---|
| >d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Length = 253 | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Length = 351 | Back information, alignment and structure |
|---|
| >d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} Length = 144 | Back information, alignment and structure |
|---|
| >d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Length = 112 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 224 | |||
| d2et1a1 | 201 | Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | 100.0 | |
| d1fxza2 | 174 | Seed storage 7S protein {Soybean (Glycine max), pr | 100.0 | |
| d1od5a2 | 173 | Seed storage 7S protein {Soybean (Glycine max), gl | 100.0 | |
| d1uika2 | 185 | Seed storage 7S protein {Soybean (Glycine max), be | 99.98 | |
| g1dgw.1 | 168 | Seed storage 7S protein {Jack bean (Canavalia ensi | 99.97 | |
| d1j58a_ | 372 | Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil | 99.96 | |
| d2phla2 | 162 | Seed storage 7S protein {French bean (Phaseolus vu | 99.94 | |
| d1uija1 | 170 | Seed storage 7S protein {Soybean (Glycine max), be | 99.91 | |
| d1dgwa_ | 178 | Seed storage 7S protein {Jack bean (Canavalia ensi | 99.91 | |
| d1j58a_ | 372 | Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil | 99.89 | |
| d1uika1 | 203 | Seed storage 7S protein {Soybean (Glycine max), be | 99.88 | |
| d2phla1 | 200 | Seed storage 7S protein {French bean (Phaseolus vu | 99.85 | |
| d1od5a1 | 245 | Seed storage 7S protein {Soybean (Glycine max), gl | 99.84 | |
| d1fxza1 | 239 | Seed storage 7S protein {Soybean (Glycine max), pr | 99.83 | |
| d1o4ta_ | 115 | Hypothetical protein TM1287 {Thermotoga maritima [ | 99.6 | |
| d1lr5a_ | 160 | Auxin binding protein {Maize (Zea mays) [TaxId: 45 | 99.57 | |
| d1v70a_ | 105 | Hypothetical protein TTHA0104 {Thermus thermophilu | 99.57 | |
| d2b8ma1 | 108 | Hypothetical protein MJ0764 {Archaeon Methanococcu | 99.56 | |
| d1y9qa2 | 99 | Probable transcriptional regulator VC1968, C-termi | 99.48 | |
| d1vj2a_ | 114 | Hypothetical protein TM1459 {Thermotoga maritima [ | 99.47 | |
| d2f4pa1 | 134 | Hypothetical protein TM1010 {Thermotoga maritima [ | 99.41 | |
| d1x82a_ | 190 | Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc | 99.31 | |
| d1yhfa1 | 112 | Hypothetical protein SPy1581 {Streptococcus pyogen | 99.24 | |
| d2d40a1 | 308 | Gentisate 1,2-dioxygenase {Escherichia coli [TaxId | 99.22 | |
| d2bnma2 | 122 | Hydroxypropylphosphonic acid epoxidase Fom4, C-ter | 99.2 | |
| d1juha_ | 348 | Quercetin 2,3-dioxygenase {Aspergillus japonicus [ | 99.18 | |
| d1sfna_ | 245 | Hypothetical protein DR1152 {Deinococcus radiodura | 99.13 | |
| d1y3ta1 | 330 | Hypothetical protein YxaG {Bacillus subtilis [TaxI | 99.13 | |
| d1sefa_ | 250 | Hypothetical protein EF2996 {Enterococcus faecalis | 99.12 | |
| d1juha_ | 348 | Quercetin 2,3-dioxygenase {Aspergillus japonicus [ | 99.11 | |
| d1y3ta1 | 330 | Hypothetical protein YxaG {Bacillus subtilis [TaxI | 99.11 | |
| d1rc6a_ | 253 | Hypothetical protein YlbA {Escherichia coli [TaxId | 99.1 | |
| d1sq4a_ | 273 | Glyoxylate-induced protein PA1140 {Pseudomonas aer | 99.09 | |
| d1sefa_ | 250 | Hypothetical protein EF2996 {Enterococcus faecalis | 99.07 | |
| d2phda1 | 351 | Gentisate 1,2-dioxygenase {Pseudaminobacter salicy | 99.05 | |
| d1sq4a_ | 273 | Glyoxylate-induced protein PA1140 {Pseudomonas aer | 99.0 | |
| d2pyta1 | 128 | Ethanolamine utilization protein EutQ {Salmonella | 98.97 | |
| d3bu7a1 | 355 | Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ | 98.96 | |
| d1rc6a_ | 253 | Hypothetical protein YlbA {Escherichia coli [TaxId | 98.93 | |
| d1sfna_ | 245 | Hypothetical protein DR1152 {Deinococcus radiodura | 98.79 | |
| d3bu7a1 | 355 | Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ | 98.78 | |
| d2d40a1 | 308 | Gentisate 1,2-dioxygenase {Escherichia coli [TaxId | 98.76 | |
| d2phda1 | 351 | Gentisate 1,2-dioxygenase {Pseudaminobacter salicy | 98.75 | |
| d1zrra1 | 179 | Acireductone dioxygenase {Klebsiella pneumoniae [T | 98.53 | |
| d1vr3a1 | 179 | Acireductone dioxygenase {Mouse (Mus musculus) [Ta | 98.49 | |
| d2o1qa1 | 144 | Putative acetyl/propionyl-CoA carboxylase subunit | 98.36 | |
| d2pa7a1 | 135 | dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane | 98.03 | |
| d2arca_ | 161 | Regulatory protein AraC {Escherichia coli [TaxId: | 97.86 | |
| d1o5ua_ | 88 | Hypothetical protein TM1112 {Thermotoga maritima [ | 97.73 | |
| d2gm6a1 | 192 | Cysteine dioxygenase type I {Ralstonia eutropha [T | 97.65 | |
| d3elna1 | 186 | Cysteine dioxygenase type I {Rattus norvegicus [Ta | 97.64 | |
| d1zvfa1 | 175 | 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea | 97.47 | |
| d1yfua1 | 174 | 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m | 97.35 | |
| d1vrba1 | 319 | Putative asparaginyl hydroxylase YxbC {Bacillus su | 97.24 | |
| d1wlta1 | 176 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo | 96.79 | |
| d2ixca1 | 198 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobac | 96.74 | |
| d1dzra_ | 183 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmone | 96.63 | |
| d2ixha1 | 184 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudom | 96.46 | |
| d1oi6a_ | 202 | dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amyc | 96.42 | |
| d1ep0a_ | 183 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo | 96.4 | |
| d1tq5a1 | 231 | Hypothetical protein YhhW {Escherichia coli [TaxId | 96.01 | |
| d2c0za1 | 190 | Novobiocin biosynthesis protein NovW {Streptomyces | 95.78 | |
| d1eyba_ | 439 | Homogentisate dioxygenase {Human (Homo sapiens) [T | 95.71 | |
| d1h2ka_ | 335 | Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum | 95.68 | |
| d1nxma_ | 194 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Strepto | 95.27 | |
| d1j1la_ | 288 | Pirin {Human (Homo sapiens) [TaxId: 9606]} | 95.21 | |
| d1pmia_ | 440 | Phosphomannose isomerase {Yeast (Candida albicans) | 93.59 | |
| d3dl3a1 | 96 | Tellurite resistance protein B, TehB {Vibrio fisch | 92.54 | |
| d3bb6a1 | 109 | Uncharacterized protein YeaR {Escherichia coli [Ta | 90.99 | |
| d1qwra_ | 315 | Mannose-6-phosphate isomerase ManA {Bacillus subti | 90.87 | |
| d1qwra_ | 315 | Mannose-6-phosphate isomerase ManA {Bacillus subti | 90.34 | |
| d1zx5a1 | 299 | Putative mannosephosphate isomerase AF0035 {Archae | 90.05 | |
| d1xrua1 | 277 | 5-keto-4-deoxyuronate isomerase KduI {Escherichia | 89.69 | |
| d2zcwa2 | 112 | Transcriptional regulator TTHA1359, N-terminal dom | 89.53 | |
| d1e5ra_ | 290 | Type II Proline 3-hydroxylase (proline oxidase) {S | 88.74 | |
| d1j1la_ | 288 | Pirin {Human (Homo sapiens) [TaxId: 9606]} | 88.42 | |
| d2oyza1 | 93 | Uncharacterized protein VPA0057 {Vibrio parahaemol | 88.24 | |
| d2oz6a2 | 134 | Cyclic AMP receptor-like protein Vfr {Pseudomonas | 87.8 | |
| d1i5za2 | 132 | Catabolite gene activator protein, N-terminal doma | 87.0 | |
| d1ywka1 | 260 | 5-keto-4-deoxyuronate isomerase KduI {Enterococcus | 86.73 | |
| d1tq5a1 | 231 | Hypothetical protein YhhW {Escherichia coli [TaxId | 85.93 | |
| d1znpa1 | 140 | Hypothetical protein Atu3615 {Agrobacterium tumefa | 85.4 | |
| d3e5ua2 | 139 | Chlorophenol reduction protein CprK {Desulfitobact | 84.02 | |
| d1zyba2 | 147 | Probable transcription regulator BT4300, N-termina | 83.38 | |
| d2gaua2 | 142 | Transcriptional regulator PG0396, N-terminal domai | 83.15 | |
| d1cx4a1 | 136 | Regulatory subunit of Protein kinase A {Rat (Rattu | 82.59 | |
| d1o5la1 | 129 | CRP-like transcriptional regulator TM1171, N-termi | 81.74 | |
| d1ft9a2 | 132 | CO-sensing protein CooA, N-terminal domain {Rhodos | 80.42 |
| >d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Double-stranded beta-helix superfamily: RmlC-like cupins family: Germin/Seed storage 7S protein domain: Germin species: Barley (Hordeum vulgare) [TaxId: 4513]
Probab=100.00 E-value=4.3e-63 Score=415.36 Aligned_cols=199 Identities=48% Similarity=0.795 Sum_probs=189.9
Q ss_pred cCCCCCcceeeecCCCCC-cceecCcccCCCCCCCCCCeeeecCCCCCCccCCCCeEEEEecccCcCcccccceEEEEEE
Q 027369 23 YDPSPLQDICVAIDEPKN-AVFVNGKFCKDPKLAKPEDFFFSGLDQPGDTANRLGFKVTTVNVEQIPGLNTLGVSAARID 101 (224)
Q Consensus 23 ~d~~~~~dfcv~~~~~~~-~~~~~g~~ck~p~~v~~~df~f~~l~~~~~~~~~~g~~v~~~~~~~~P~L~~lgis~~rv~ 101 (224)
|||||||||||| |+++ ++++||||||+++.++++||+|+++..+++++|+.|++++.+++.+||+||++|+|++|++
T Consensus 1 sdp~~lqdfcva--d~~~~~~~~~g~~ck~~~~~~~~~f~~~~l~~~~~~~~~~g~~vt~~~~~~fP~Ln~lglS~~rv~ 78 (201)
T d2et1a1 1 TDPDPLQDFCVA--DLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVD 78 (201)
T ss_dssp CCCCCSSSCCCB--CCCTTSCCCSSCCBCCGGGCCSCTTCCCTTSSCCCCCSTTSEEEEEESTTTCGGGTTSSCEEEEEE
T ss_pred CCCcccceeEee--cCCCCccccCCcccCChhhccccceeecccccCCCccCCCCcEEEEeehhcCccccccceeEEEEE
Confidence 799999999999 8865 5899999999999999999999999999999999999999999999999999999999999
Q ss_pred EcCCCcCCceeCCCCcEEEEEEecEEEEEEEecCCCCCeeEEEEecCCCEEEEcCCCeeEEEeCCCCcEEEEEEEcCCCC
Q 027369 102 FAPYGQNPPHTHPRATEILVVLEGTLYVGFVTSNQLNNTLIAKVLNKGDVFVFPIGMIHFQFNIGKTNAVAFAGFGSQNP 181 (224)
Q Consensus 102 l~pgg~~ppH~Hp~a~Ei~yVl~G~~~v~~~~~~~~~~~~~~~~L~~GDv~v~P~G~~H~~~N~G~~~a~~i~~~~s~~p 181 (224)
|+|||+++|||||+++|++||++|+++++++++...++++++++|++||+++||+|++||++|.|+++++++++|++++|
T Consensus 79 l~pgg~~~PH~Hp~A~Ei~yV~~G~~~v~~v~~~~~~~~~~~~~l~~GDv~vvP~G~~H~~~N~g~~~a~~i~~f~s~~p 158 (201)
T d2et1a1 79 FAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNP 158 (201)
T ss_dssp ECTTCEEEEEECTTCCEEEEEEESCEEEEEECCGGGTTCEEEEEECTTCEEEECTTCCEEEEECSSSCEEEEEEESSSCC
T ss_pred ECCCCCcCCcccCCCCEEEEEEcceEEEEEEeccCCCceeEEEEecCCCEEEECCCCeEEEEEcCCCCEEEEEEecCCCC
Confidence 99999999999999999999999999999987532227899999999999999999999999999999999999999999
Q ss_pred ceeeechhhhcCCCCCCHHHHHHhcCCCHHHHHHHhhhccCC
Q 027369 182 GVITIANTVFGADPPINPDFLGKAFQLDPQVVKDLQNKFMNG 223 (224)
Q Consensus 182 g~~~i~~~lf~~~p~~~~~vLa~af~~~~~~v~~l~~~~~~~ 223 (224)
|.+.++.++|+++|+||+|||+++|++|+++++|||++|+++
T Consensus 159 g~~~~~~~~f~~~~~~p~eVLa~af~i~~~~v~kLks~f~g~ 200 (201)
T d2et1a1 159 GIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGG 200 (201)
T ss_dssp CCEEHHHHHHHCSSCCCHHHHHHHHTSCHHHHHHHHHTTTTC
T ss_pred cceehhhhhhccCCCCCHHHHHHHhCCCHHHHHHHHhhccCC
Confidence 999999999999999999999999999999999999999975
|
| >d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} | Back information, alignment and structure |
|---|
| >d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} | Back information, alignment and structure |
|---|
| >d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} | Back information, alignment and structure |
|---|
| >d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} | Back information, alignment and structure |
|---|
| >d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} | Back information, alignment and structure |
|---|
| >d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} | Back information, alignment and structure |
|---|
| >d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1tq5a1 b.82.1.12 (A:1-231) Hypothetical protein YhhW {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]} | Back information, alignment and structure |
|---|
| >d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1j1la_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d3dl3a1 b.82.2.13 (A:5-100) Tellurite resistance protein B, TehB {Vibrio fischeri [TaxId: 668]} | Back information, alignment and structure |
|---|
| >d3bb6a1 b.82.2.13 (A:1-109) Uncharacterized protein YeaR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1xrua1 b.82.1.13 (A:1-277) 5-keto-4-deoxyuronate isomerase KduI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e5ra_ b.82.2.4 (A:) Type II Proline 3-hydroxylase (proline oxidase) {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1j1la_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oyza1 b.82.1.22 (A:2-94) Uncharacterized protein VPA0057 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ywka1 b.82.1.13 (A:1001-1260) 5-keto-4-deoxyuronate isomerase KduI {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1tq5a1 b.82.1.12 (A:1-231) Hypothetical protein YhhW {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1znpa1 b.82.1.16 (A:4-143) Hypothetical protein Atu3615 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} | Back information, alignment and structure |
|---|
| >d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|