Citrus Sinensis ID: 027440

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220---
MPRASSKRKSSAPQNPPAVKSSNARSGKAKAKEIENFFDKYANGGIIDSPDGIVTLCKDLELEYTDVRILMLAWYLKAVKLGYFTQDEWETGLKTLQVNNLSKLKKAISELEKEVRTPPNFADFYSFAFRYHLTEEKQKNIDIETICELLNLVLGPQFRRQVDLLIDYLKVQSNYKVINLDQWLGIFRFCNEISFPDLENYDETQAWPLILDNFVDWLRENHR
ccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHcccccccHHHHHHHHHHcccccccEEHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccHHHHHHHccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcc
ccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHEEEEEEEEHcHHHcccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccEccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHccc
mprasskrkssapqnppavkssnarsgKAKAKEIENFFDkyanggiidspdgIVTLCKDLELEYTDVRILMLAWYLKAVKLgyftqdewetGLKTLQVNNLSKLKKAISELEkevrtppnfadfySFAFRYHLTEEKQKNIDIETICELLNLVLGPQFRRQVDLLIDYLKVQSNYKVINLDQWLGIFRfcneisfpdlenydetqawpLILDNFVDWLRENHR
mprasskrkssapqnppavkssnarsgkaKAKEIENFFDKYanggiidspDGIVTLCKDLELEYTDVRILMLAWYLKAVKLGYFTQDEWETGLKTLQVNNLSKLKKAISElekevrtppnfadFYSFAFRYHLTEEKQKNIDIETICELLNLVLGPQFRRQVDLLIDYLKVQSNYKVINLDQWLGIFRFCNEISFPDLENYDETQAWPLILDNFVDWLRENHR
MPRASSKRKSSAPQNPPAVKSSNARSGKAKAKEIENFFDKYANGGIIDSPDGIVTLCKDLELEYTDVRILMLAWYLKAVKLGYFTQDEWETGLKTLQVNNLSKLKKAISELEKEVRTPPNFADFYSFAFRYHLTEEKQKNIDIETICELLNLVLGPQFRRQVDLLIDYLKVQSNYKVINLDQWLGIFRFCNEISFPDLENYDETQAWPLILDNFVDWLRENHR
*********************************IENFFDKYANGGIIDSPDGIVTLCKDLELEYTDVRILMLAWYLKAVKLGYFTQDEWETGLKTLQVNNLSKLKKAISELEKEVRTPPNFADFYSFAFRYHLTEEKQKNIDIETICELLNLVLGPQFRRQVDLLIDYLKVQSNYKVINLDQWLGIFRFCNEISFPDLENYDETQAWPLILDNFVDWLR****
***********************************NFFDKYANGGIIDSPDGIVTLCKDLELEYTDVRILMLAWYLKAVKLGYFTQDEWETGLKTLQVNNLSKLKKAISELEKEVRTPPNFADFYSFAFRYHLTEEKQKNIDIETICELLNLVLGPQFRRQVDLLIDYLKVQSNYKVINLDQWLGIFRFCNEISFPDLENYDETQAWPLILDNFVDWLRE***
******************************AKEIENFFDKYANGGIIDSPDGIVTLCKDLELEYTDVRILMLAWYLKAVKLGYFTQDEWETGLKTLQVNNLSKLKKAISELEKEVRTPPNFADFYSFAFRYHLTEEKQKNIDIETICELLNLVLGPQFRRQVDLLIDYLKVQSNYKVINLDQWLGIFRFCNEISFPDLENYDETQAWPLILDNFVDWLRENHR
***************************KAKAKEIENFFDKYANGGIIDSPDGIVTLCKDLELEYTDVRILMLAWYLKAVKLGYFTQDEWETGLKTLQVNNLSKLKKAISELEKEVRTPPNFADFYSFAFRYHLTEEKQKNIDIETICELLNLVLGPQFRRQVDLLIDYLKVQSNYKVINLDQWLGIFRFCNEISFPDLENYDETQAWPLILDNFVDWLREN**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPRASSKRKSSAPQNPPAVKSSNARSGKAKAKEIENFFDKYANGGIIDSPDGIVTLCKDLELEYTDVRILMLAWYLKAVKLGYFTQDEWETGLxxxxxxxxxxxxxxxxxxxxxVRTPPNFADFYSFAFRYHLTEEKQKNIDIETICELLNLVLGPQFRRQVDLLIDYLKVQSNYKVINLDQWLGIFRFCNEISFPDLENYDETQAWPLILDNFVDWLRENHR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query223 2.2.26 [Sep-21-2011]
Q86JM4267 DCN1-like protein 2 OS=Di no no 0.753 0.629 0.367 5e-28
Q92564292 DCN1-like protein 4 OS=Ho yes no 0.807 0.616 0.357 2e-27
Q8CCA0292 DCN1-like protein 4 OS=Mu yes no 0.807 0.616 0.362 2e-27
Q5RHX6280 DCN1-like protein 4 OS=Da yes no 0.820 0.653 0.352 8e-27
Q1RMX9236 DCN1-like protein 5 OS=Bo yes no 0.807 0.762 0.342 2e-26
Q9BTE7237 DCN1-like protein 5 OS=Ho no no 0.905 0.852 0.331 3e-26
Q5PPL2237 DCN1-like protein 5 OS=Ra no no 0.802 0.755 0.343 3e-26
Q9CXV9237 DCN1-like protein 5 OS=Mu no no 0.802 0.755 0.343 4e-26
Q5RDF9237 DCN1-like protein 5 OS=Po no no 0.807 0.759 0.336 1e-25
Q96GG9259 DCN1-like protein 1 OS=Ho no no 0.883 0.760 0.311 1e-21
>sp|Q86JM4|DCN1M_DICDI DCN1-like protein 2 OS=Dictyostelium discoideum GN=DDB_G0272016 PE=4 SV=1 Back     alignment and function desciption
 Score =  124 bits (311), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 65/177 (36%), Positives = 102/177 (57%), Gaps = 9/177 (5%)

Query: 50  PDGIVTLCKDLELEYTDVRILMLAWYLKAVKLGYFTQDEWETGLKTLQVNNLSKLKKAIS 109
           P+GI   C D+ L      IL+LAW + A K+GYF+++E+ +G + LQ ++LS LKK ++
Sbjct: 96  PEGIARFCSDIGLAPDSFEILVLAWTMNASKMGYFSKNEFSSGFEKLQCSDLSTLKKQLN 155

Query: 110 ELEKEVRT-PPNFADFYSFAFRYHLTEEKQKNIDIETICELLNLVL--GPQFRRQVDLLI 166
              ++++     F D Y +AF +    E +K++D+ T  E+L L+L  GP          
Sbjct: 156 STSQKLKHDSTKFTDLYKYAFGFASEVESKKSVDLGTAAEMLKLLLPEGPHTTN----FA 211

Query: 167 DYLKVQSNYKVINLDQWLGIFRFCNEISFPDLENYDETQAWPLILDNFVDWLRENHR 223
            +L  Q N K IN DQWL    F   +   DL NYD+++AWPL+LD F +W+++  R
Sbjct: 212 AFLCTQPN-KSINKDQWLCFLEFSRTVK-ADLSNYDDSEAWPLLLDQFSEWVQQEKR 266

Dictyostelium discoideum (taxid: 44689)
>sp|Q92564|DCNL4_HUMAN DCN1-like protein 4 OS=Homo sapiens GN=DCUN1D4 PE=1 SV=2 Back     alignment and function description
>sp|Q8CCA0|DCNL4_MOUSE DCN1-like protein 4 OS=Mus musculus GN=Dcun1d4 PE=2 SV=1 Back     alignment and function description
>sp|Q5RHX6|DCNL4_DANRE DCN1-like protein 4 OS=Danio rerio GN=dcun1d4 PE=2 SV=2 Back     alignment and function description
>sp|Q1RMX9|DCNL5_BOVIN DCN1-like protein 5 OS=Bos taurus GN=DCUN1D5 PE=2 SV=1 Back     alignment and function description
>sp|Q9BTE7|DCNL5_HUMAN DCN1-like protein 5 OS=Homo sapiens GN=DCUN1D5 PE=1 SV=1 Back     alignment and function description
>sp|Q5PPL2|DCNL5_RAT DCN1-like protein 5 OS=Rattus norvegicus GN=Dcun1d5 PE=2 SV=1 Back     alignment and function description
>sp|Q9CXV9|DCNL5_MOUSE DCN1-like protein 5 OS=Mus musculus GN=Dcun1d5 PE=2 SV=1 Back     alignment and function description
>sp|Q5RDF9|DCNL5_PONAB DCN1-like protein 5 OS=Pongo abelii GN=DCUN1D5 PE=2 SV=1 Back     alignment and function description
>sp|Q96GG9|DCNL1_HUMAN DCN1-like protein 1 OS=Homo sapiens GN=DCUN1D1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query223
224143997243 predicted protein [Populus trichocarpa] 0.982 0.901 0.609 2e-78
217074494228 unknown [Medicago truncatula] gi|3885005 0.995 0.973 0.592 3e-72
449468930230 PREDICTED: DCN1-like protein 4-like [Cuc 0.968 0.939 0.606 6e-70
351721895228 uncharacterized protein LOC100499856 [Gl 0.995 0.973 0.576 6e-70
224072695232 predicted protein [Populus trichocarpa] 0.977 0.939 0.563 7e-70
225443086231 PREDICTED: DCN1-like protein 4 isoform 1 0.878 0.848 0.648 7e-70
359482420212 PREDICTED: DCN1-like protein 4 isoform 2 0.878 0.924 0.648 8e-70
358248174228 uncharacterized protein LOC100776788 [Gl 0.995 0.973 0.580 1e-69
224057561232 predicted protein [Populus trichocarpa] 0.977 0.939 0.563 2e-69
388506842231 unknown [Lotus japonicus] 0.968 0.935 0.585 3e-69
>gi|224143997|ref|XP_002325151.1| predicted protein [Populus trichocarpa] gi|222866585|gb|EEF03716.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 147/241 (60%), Positives = 180/241 (74%), Gaps = 22/241 (9%)

Query: 1   MPRASSKRKSSAPQNPPAVKSSN----------------ARSGKAKAKE---IENFFDKY 41
           MP  +SKRK++APQN  +V S++                A S K K K+   ++  FD Y
Sbjct: 1   MPPRASKRKATAPQNSSSVTSADDSPTGTIAGLDNIILFAASDKTKTKKTDRLDTLFDSY 60

Query: 42  ANG--GIIDSPDGIVTLCKDLELEYTDVRILMLAWYLKAVKLGYFTQDEWETGLKTLQVN 99
           AN   GIID P+GI  LC D+ +E+TDVRILM AW LKA + GYFT+DEW +G+K L+V+
Sbjct: 61  ANSSLGIID-PEGIEALCSDMSVEHTDVRILMFAWKLKAQRQGYFTRDEWRSGMKALKVD 119

Query: 100 NLSKLKKAISELEKEVRTPPNFADFYSFAFRYHLTEEKQKNIDIETICELLNLVLGPQFR 159
           +LSKLKK + ELEKEV TP NF DFYS+AFRY LTEEKQK +DIE++CELLNLVLG QF+
Sbjct: 120 SLSKLKKGLPELEKEVNTPENFQDFYSYAFRYCLTEEKQKTVDIESVCELLNLVLGSQFQ 179

Query: 160 RQVDLLIDYLKVQSNYKVINLDQWLGIFRFCNEISFPDLENYDETQAWPLILDNFVDWLR 219
            +VDLLI+YLK+QS+YK INLDQW+G  RFC EISFPDLENYD   AWPLILDNFVDW++
Sbjct: 180 SKVDLLIEYLKIQSDYKAINLDQWMGFLRFCKEISFPDLENYDADLAWPLILDNFVDWMK 239

Query: 220 E 220
           E
Sbjct: 240 E 240

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|217074494|gb|ACJ85607.1| unknown [Medicago truncatula] gi|388500562|gb|AFK38347.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449468930|ref|XP_004152174.1| PREDICTED: DCN1-like protein 4-like [Cucumis sativus] gi|449527597|ref|XP_004170796.1| PREDICTED: DCN1-like protein 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|351721895|ref|NP_001236969.1| uncharacterized protein LOC100499856 [Glycine max] gi|255627169|gb|ACU13929.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224072695|ref|XP_002303837.1| predicted protein [Populus trichocarpa] gi|222841269|gb|EEE78816.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225443086|ref|XP_002273365.1| PREDICTED: DCN1-like protein 4 isoform 1 [Vitis vinifera] gi|297743605|emb|CBI36472.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482420|ref|XP_003632772.1| PREDICTED: DCN1-like protein 4 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|358248174|ref|NP_001240087.1| uncharacterized protein LOC100776788 [Glycine max] gi|255645050|gb|ACU23024.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224057561|ref|XP_002299268.1| predicted protein [Populus trichocarpa] gi|222846526|gb|EEE84073.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388506842|gb|AFK41487.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query223
DICTYBASE|DDB_G0284369274 DDB_G0284369 "DUF298 family pr 0.910 0.740 0.394 7.8e-39
UNIPROTKB|B4DH25336 DCUN1D4 "cDNA FLJ55777, highly 0.834 0.553 0.363 4.4e-29
UNIPROTKB|Q92564292 DCUN1D4 "DCN1-like protein 4" 0.834 0.636 0.363 4.4e-29
MGI|MGI:2140972292 Dcun1d4 "DCN1, defective in cu 0.834 0.636 0.368 9.1e-29
UNIPROTKB|Q9BTE7237 DCUN1D5 "DCN1-like protein 5" 0.919 0.864 0.331 1.9e-28
RGD|1307008237 Dcun1d5 "DCN1, defective in cu 0.919 0.864 0.331 2.4e-28
MGI|MGI:1924113237 Dcun1d5 "DCN1, defective in cu 0.919 0.864 0.331 3.1e-28
UNIPROTKB|Q5RDF9237 DCUN1D5 "DCN1-like protein 5" 0.919 0.864 0.327 1e-27
ZFIN|ZDB-GENE-040426-2603249 dcun1d5 "DCN1, defective in cu 0.950 0.851 0.326 1.3e-27
UNIPROTKB|E2QV42262 DCUN1D1 "Uncharacterized prote 0.901 0.767 0.307 1.1e-23
DICTYBASE|DDB_G0284369 DDB_G0284369 "DUF298 family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
 Score = 415 (151.1 bits), Expect = 7.8e-39, P = 7.8e-39
 Identities = 84/213 (39%), Positives = 131/213 (61%)

Query:    15 NPPAVKSSNARSG----KAKAKEIENFFDKYAN---GGIIDSPDGIVTLCKDLELEYTDV 67
             N  ++ S+N+ S     + K K IE+FFDKY +     +I  PDGI  LCKDL +E  DV
Sbjct:    61 NKVSISSNNSNSNNNKIEDKGKRIEDFFDKYKDEDDNNVI-GPDGITRLCKDLGVEPEDV 119

Query:    68 RILMLAWYLKAVKLGYFTQDEWETGLKTLQVNNLSKLKKAISELEKEVRTPPNFADFYSF 127
              +L+LAW+L A ++GYF++ E+  GL  L +++L KL++ +   +K++  P NF D Y F
Sbjct:   120 VVLVLAWHLGAKQMGYFSKAEFTQGLSKLNIDSLQKLQQHLPTFKKDLDNPNNFKDIYRF 179

Query:   128 AFRYHLTEEKQKNIDIETICELLNLVLGPQFRRQVDLLIDYLKVQSNYKVINLDQWLGIF 187
             AF +    E  K +D+E+ C +L LVL  ++    + L ++L  Q +YKV+N+DQWL I 
Sbjct:   180 AFIFAKENENNKILDLESACSMLQLVLADRYPH-TEKLQEFLMQQKSYKVLNMDQWLSIL 238

Query:   188 RFCNEISFPDLENYDETQAWPLILDNFVDWLRE 220
              F   I+  +  NYDE  AWP++LD + +W ++
Sbjct:   239 EFSKIIN-ANCSNYDENGAWPVLLDEYSEWRKQ 270
GO:0008150 "biological_process" evidence=ND
GO:0005575 "cellular_component" evidence=ND
UNIPROTKB|B4DH25 DCUN1D4 "cDNA FLJ55777, highly similar to DCN1-like protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q92564 DCUN1D4 "DCN1-like protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2140972 Dcun1d4 "DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BTE7 DCUN1D5 "DCN1-like protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1307008 Dcun1d5 "DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1924113 Dcun1d5 "DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RDF9 DCUN1D5 "DCN1-like protein 5" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2603 dcun1d5 "DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2QV42 DCUN1D1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00181015
hypothetical protein (243 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query223
pfam03556117 pfam03556, Cullin_binding, Cullin binding 2e-31
>gnl|CDD|217613 pfam03556, Cullin_binding, Cullin binding Back     alignment and domain information 
 Score =  110 bits (278), Expect = 2e-31
 Identities = 45/120 (37%), Positives = 68/120 (56%), Gaps = 4/120 (3%)

Query: 101 LSKLKKAISELEKEVRT-PPNFADFYSFAFRYHLTEEKQKNIDIETICELLNLVLGPQFR 159
           + KLK  + EL  E+++ P  F D Y F F +   EE QK++D+ET  E   L+ G +  
Sbjct: 1   IEKLKAKLPELRSELKSDPEKFKDLYRFTFDFAR-EEGQKSLDLETAIEYWKLLFGSRTF 59

Query: 160 RQVDLLIDYLKVQSNYKVINLDQWLGIFRFCNEISFPDLENYDETQAWPLILDNFVDWLR 219
             +D  I++L+ + + K I+ D W  +  F   I   DL NYDE  AWP ++D FV+WL+
Sbjct: 60  PLLDQWIEFLE-EKHKKSISKDTWNMLLEFSKTID-EDLSNYDEEGAWPSLIDEFVEWLK 117

This domain binds to cullins and to Rbx-1, components of an E3 ubiquitin ligase complex for neddylation. Neddylation is the process by which the C-terminal glycine of the ubiquitin-like protein Nedd8 is covalently linked to lysine residues in a protein through an isopeptide bond. The structure of this domain is composed entirely of alpha helices. Length = 117

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 223
KOG3077260 consensus Uncharacterized conserved protein [Funct 100.0
PF03556117 Cullin_binding: Cullin binding; InterPro: IPR00517 100.0
KOG3077260 consensus Uncharacterized conserved protein [Funct 93.61
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 93.57
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 93.45
PTZ00183158 centrin; Provisional 92.06
PTZ00183158 centrin; Provisional 91.67
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 91.48
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 90.46
cd0005267 EH Eps15 homology domain; found in proteins implic 90.34
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 89.54
cd0503088 calgranulins Calgranulins: S-100 domain found in p 88.64
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 87.63
PTZ00184149 calmodulin; Provisional 87.14
PTZ00184149 calmodulin; Provisional 86.19
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 84.84
cd0021388 S-100 S-100: S-100 domain, which represents the la 84.31
KOG0036 463 consensus Predicted mitochondrial carrier protein 80.38
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 80.28
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 80.22
>KOG3077 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=5e-64  Score=440.38  Aligned_cols=191  Identities=34%  Similarity=0.700  Sum_probs=182.4

Q ss_pred             CccCHHHHHHHHHhhcCC---CCCCCHHHHHHHHHHcCCCCCCHHHHHHHHHhcCCccccccHHHHHHHHhhcCCCcHHH
Q 027440           27 GKAKAKEIENFFDKYANG---GIIDSPDGIVTLCKDLELEYTDVRILMLAWYLKAVKLGYFTQDEWETGLKTLQVNNLSK  103 (223)
Q Consensus        27 ~~~~~~~l~~lF~~Y~d~---~~I~~~dGi~~~~~DLgv~~ed~~~LvLa~~l~a~~~g~itr~eF~~g~~~l~~ds~~~  103 (223)
                      .+...+.++++|.+|+|+   +.|+ +|||.+||+||||+|+|+++|||||+|+|++||+|||++|+.||.++||||+++
T Consensus        59 ~~~s~~~l~~~f~~y~d~~d~~~i~-~dgi~~fc~dlg~~p~~i~~LvlAwkl~A~~m~~Fsr~ef~~g~~~l~~dS~d~  137 (260)
T KOG3077|consen   59 ARVSEKRLEELFNQYKDPDDDNLIG-PDGIEKFCEDLGVEPEDISVLVLAWKLGAATMCEFSREEFLKGMTALGCDSIDK  137 (260)
T ss_pred             ccccHHHHHHHHHHhcCcccccccC-hHHHHHHHHHhCCCchhHHHHHHHHHhccchhhhhhHHHHHHHHHHcCCCcHHH
Confidence            445889999999999998   4899 999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhCCChhhHHHHHhHhhhccCccccccccHHHHHHHHHHhcCCCChhhHHHHHHHHHhcCCCccCChhhH
Q 027440          104 LKKAISELEKEVRTPPNFADFYSFAFRYHLTEEKQKNIDIETICELLNLVLGPQFRRQVDLLIDYLKVQSNYKVINLDQW  183 (223)
Q Consensus       104 lk~~l~~L~~~l~~~~~Fk~~Y~f~F~f~~~~~~qK~L~~e~Ai~~W~lll~~~~~~~l~~W~~Fl~~~~~~k~IskD~W  183 (223)
                      |++.|+.++..+.|++.|+++|+|||+|++ ++|||+|++++||+||.+||+.+++ .++.|++||..+ +++.|+||||
T Consensus       138 lq~~l~~l~~~l~d~~~Fk~iY~faf~fa~-e~~qk~Ld~~~ai~~w~ll~~~~~p-ll~~w~~FL~~~-~~~~~~KDtW  214 (260)
T KOG3077|consen  138 LQQRLDFLRSVLKDLEKFKSIYRFAFNFAK-EPGQKSLDLETAISLWKLLFGQTPP-LLDQWIQFLKDS-PNRAISKDTW  214 (260)
T ss_pred             HHHHHHHHHHHHccHHHhhHHHHhhhhhcc-CcCcCcCCHHHHHHHHHHHhCCCCc-hHHHHHHHHHhC-cCcccCcccH
Confidence            999999999999999999999999999999 5899999999999999999987775 899999999874 6799999999


Q ss_pred             hHHHHHhhhcCCCCCCCCCCCCCchhhHHHHHHHHHhhC
Q 027440          184 LGIFRFCNEISFPDLENYDETQAWPLILDNFVDWLRENH  222 (223)
Q Consensus       184 ~~~l~F~~~v~~~dls~YDe~~AWP~liDeFVe~~r~~~  222 (223)
                      +|+|+|++++. +|+|||||+||||+||||||||+|.++
T Consensus       215 ~~~l~Fs~~i~-~dlSnYDeegAWP~liDeFVe~~r~~~  252 (260)
T KOG3077|consen  215 NLLLDFSKTID-PDLSNYDEEGAWPVLIDEFVEYLRDKQ  252 (260)
T ss_pred             HHHHHHHHhcC-ccccCccccccchHHHHHHHHHHHHhc
Confidence            99999999886 999999999999999999999999875

>PF03556 Cullin_binding: Cullin binding; InterPro: IPR005176 The eukaryotic defective in cullin neddylation (DCN) protein family, may contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes Back     alignment and domain information
>KOG3077 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query223
3kev_A199 X-Ray Crystal Structure Of A Dcun1 Domain-Containin 2e-25
3tdu_A200 N-Terminal Acetylation Acts As An Avidity Enhancer 5e-22
4gao_A200 Dcnl Complex With N-terminally Acetylated Nedd8 E2 9e-21
4gba_A221 Dcnl Complex With N-terminally Acetylated Nedd8 E2 2e-19
3o2p_A202 A Dual E3 Mechanism For Rub1 Ligation To Cdc53: Dcn 3e-06
2is9_A204 Structure Of Yeast Dcn-1 Length = 204 1e-05
3bq3_A270 Crystal Structure Of S. Cerevisiae Dcn1 Length = 27 1e-05
>pdb|3KEV|A Chain A, X-Ray Crystal Structure Of A Dcun1 Domain-Containing Protein From Galdieria Sulfuraria Length = 199 Back     alignment and structure 
Iteration: 1

 Score =  112 bits (279), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 71/199 (35%), Positives = 114/199 (57%), Gaps = 8/199 (4%)
Query: 26  SGKAKAKEIENFFDKYAN--GGIIDSPDGIVTLCKDLELEYTDVRILMLAWYLKAVKLGY 83
           S +A  K I   F  Y    G  I + +G+  L +D++++ +DV  L+LAW LKA     
Sbjct: 1   SKRADKKAILELFQTYKEPLGNYIGA-EGLQRLFEDIQVDPSDVVTLVLAWKLKASSTXE 59
Query: 84  FTQDEWETGLKTLQVNNLSKLKKAISELEKEVRTPPNFADFYSFAFRYHLTEEKQKNIDI 143
           F++ E+  GL  LQV++L KLK+ +S L KE+  P  F  FY F F+Y   E  Q+++  
Sbjct: 60  FSEKEFVEGLANLQVDSLEKLKRKLSSLRKEIEDPSKFRAFYQFVFQYS-KEPSQRSLPA 118
Query: 144 ETICELLNLVLGPQFRRQVDLLIDYLKVQSNYKVINLDQWLGIFRFCNEISFPDLENYDE 203
           ET   L +++L  +F   +D  +++LK  +N   I+ D W  ++ F  ++S  DL +YDE
Sbjct: 119 ETAXALWDVLLRGRFSL-LDSWLEFLK--NNTHSISRDTWNLLYDFS-QLSEKDLSDYDE 174
Query: 204 TQAWPLILDNFVDWLRENH 222
             AWP+++D+FV WL+   
Sbjct: 175 NGAWPVLIDDFVKWLKHEQ 193
>pdb|3TDU|A Chain A, N-Terminal Acetylation Acts As An Avidity Enhancer Within An Interconnected Multiprotein Complex: Structure Of A Human Cul1whb- Dcn1p-Acetylated Ubc12n Complex Length = 200 Back     alignment and structure
>pdb|4GAO|A Chain A, Dcnl Complex With N-terminally Acetylated Nedd8 E2 Peptide Length = 200 Back     alignment and structure
>pdb|4GBA|A Chain A, Dcnl Complex With N-terminally Acetylated Nedd8 E2 Peptide Length = 221 Back     alignment and structure
>pdb|3O2P|A Chain A, A Dual E3 Mechanism For Rub1 Ligation To Cdc53: Dcn1(P)-Cdc53(Whb) Length = 202 Back     alignment and structure
>pdb|2IS9|A Chain A, Structure Of Yeast Dcn-1 Length = 204 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query223
3kev_A199 Galieria sulfuraria DCUN1 domain-containing prote; 4e-56
3tdu_A200 DCN1-like protein 1; E2:E3, ligase-protein binding 2e-54
3bq3_A270 Defective in cullin neddylation protein 1; ubiquit 7e-47
>3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} Length = 199 Back     alignment and structure
 Score =  176 bits (447), Expect = 4e-56
 Identities = 69/199 (34%), Positives = 110/199 (55%), Gaps = 8/199 (4%)

Query: 26  SGKAKAKEIENFFDKYA--NGGIIDSPDGIVTLCKDLELEYTDVRILMLAWYLKAVKLGY 83
           S +A  K I   F  Y    G  I   +G+  L +D++++ +DV  L+LAW LKA     
Sbjct: 1   SKRADKKAILELFQTYKEPLGNYIG-AEGLQRLFEDIQVDPSDVVTLVLAWKLKASSTCE 59

Query: 84  FTQDEWETGLKTLQVNNLSKLKKAISELEKEVRTPPNFADFYSFAFRYHLTEEKQKNIDI 143
           F++ E+  GL  LQV++L KLK+ +S L KE+  P  F  FY F F+Y   E  Q+++  
Sbjct: 60  FSEKEFVEGLANLQVDSLEKLKRKLSSLRKEIEDPSKFRAFYQFVFQY-SKEPSQRSLPA 118

Query: 144 ETICELLNLVLGPQFRRQVDLLIDYLKVQSNYKVINLDQWLGIFRFCNEISFPDLENYDE 203
           ET   L +++L  +F   +D  +++L  ++N   I+ D W  ++ F       DL +YDE
Sbjct: 119 ETAMALWDVLLRGRF-SLLDSWLEFL--KNNTHSISRDTWNLLYDFSQLSE-KDLSDYDE 174

Query: 204 TQAWPLILDNFVDWLRENH 222
             AWP+++D+FV WL+   
Sbjct: 175 NGAWPVLIDDFVKWLKHEQ 193
>3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A Length = 200 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query223
3kev_A199 Galieria sulfuraria DCUN1 domain-containing prote; 100.0
3tdu_A200 DCN1-like protein 1; E2:E3, ligase-protein binding 100.0
4gba_A221 DCN1-like protein 3; E3 ligase, ligase-peptide com 100.0
3bq3_A270 Defective in cullin neddylation protein 1; ubiquit 100.0
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 95.87
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 95.86
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 95.75
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 95.67
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 95.6
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 95.55
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 95.36
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 95.35
1avs_A90 Troponin C; muscle contraction, calcium-activated, 95.26
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 95.21
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 95.2
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 95.18
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 95.15
3fwb_A161 Cell division control protein 31; gene gating, com 95.06
2jnf_A158 Troponin C; stretch activated muscle contraction, 95.02
1y1x_A191 Leishmania major homolog of programmed cell death 95.01
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 94.96
2lv7_A100 Calcium-binding protein 7; metal binding protein; 94.95
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 94.93
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 94.9
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 94.86
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 94.83
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 94.8
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 94.73
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 94.57
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 94.45
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 94.43
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 94.36
1y1x_A191 Leishmania major homolog of programmed cell death 94.35
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 94.28
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 94.22
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 94.15
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 94.13
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 94.08
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 94.06
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 94.05
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 94.04
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 93.99
3li6_A66 Calcium-binding protein; calcium signaling protein 93.9
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 93.89
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 93.86
1exr_A148 Calmodulin; high resolution, disorder, metal trans 93.82
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 93.78
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 93.77
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 93.64
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 93.54
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 93.47
3fwb_A161 Cell division control protein 31; gene gating, com 93.46
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 93.3
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 93.22
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 93.19
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 93.16
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 93.05
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 93.01
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 92.97
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 92.9
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 92.8
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 92.78
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 92.74
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 92.72
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 92.68
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 92.66
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 92.62
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 92.55
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 92.55
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 92.53
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 92.33
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 92.3
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 92.16
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 92.03
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 92.03
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 91.99
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 91.96
3akb_A166 Putative calcium binding protein; EF-hand, metal b 91.88
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 91.88
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 91.87
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 91.86
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 91.78
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 91.76
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 91.75
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 91.74
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 91.71
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 91.69
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 91.42
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 91.41
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 91.38
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 91.34
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 91.33
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 91.29
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 91.18
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 91.14
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 91.04
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 91.02
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 90.93
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 90.87
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 90.84
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 90.79
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 90.77
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 90.72
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 90.62
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 90.61
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 90.6
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 90.57
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 90.54
1exr_A148 Calmodulin; high resolution, disorder, metal trans 90.54
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 90.4
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 90.38
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 90.38
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 90.37
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 90.35
1qjt_A99 EH1, epidermal growth factor receptor substrate su 90.19
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 90.19
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 90.17
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 90.17
1c07_A95 Protein (epidermal growth factor receptor pathway 90.1
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 89.97
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 89.8
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 89.78
3akb_A166 Putative calcium binding protein; EF-hand, metal b 89.76
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 89.72
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 89.67
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 89.62
2jnf_A158 Troponin C; stretch activated muscle contraction, 89.62
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 89.57
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 89.49
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 89.38
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 89.38
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 89.36
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 89.31
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 89.26
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 89.24
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 89.23
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 89.22
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 89.04
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 89.04
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 89.03
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 89.01
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 88.97
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 88.68
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 88.63
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 88.62
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 88.61
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 88.56
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 88.53
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 88.28
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 88.13
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 88.02
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 88.01
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 87.97
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 87.86
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 87.81
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 87.63
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 87.6
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 87.6
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 87.53
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 87.5
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 87.31
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 87.26
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 86.68
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 86.59
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 86.54
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 86.41
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 86.36
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 85.61
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 85.6
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 85.55
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 85.46
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 85.33
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 85.19
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 85.16
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 85.06
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 85.06
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 85.03
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 85.0
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 84.98
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 84.94
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 84.81
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 84.73
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 84.67
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 84.52
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 84.4
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 84.29
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 84.21
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 83.72
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 83.64
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 83.32
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 83.3
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 83.12
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 82.98
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 82.75
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 82.51
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 82.29
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 82.26
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 82.09
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 81.92
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 81.92
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 81.89
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 81.78
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 81.73
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 81.61
2jq6_A139 EH domain-containing protein 1; metal binding prot 81.23
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 80.82
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 80.73
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 80.58
>3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} Back     alignment and structure
Probab=100.00  E-value=4.4e-75  Score=495.80  Aligned_cols=189  Identities=35%  Similarity=0.690  Sum_probs=176.2

Q ss_pred             ccCHHHHHHHHHhhcCC--CCCCCHHHHHHHHHHcCCCCCCHHHHHHHHHhcCCccccccHHHHHHHHhhcCCCcHHHHH
Q 027440           28 KAKAKEIENFFDKYANG--GIIDSPDGIVTLCKDLELEYTDVRILMLAWYLKAVKLGYFTQDEWETGLKTLQVNNLSKLK  105 (223)
Q Consensus        28 ~~~~~~l~~lF~~Y~d~--~~I~~~dGi~~~~~DLgv~~ed~~~LvLa~~l~a~~~g~itr~eF~~g~~~l~~ds~~~lk  105 (223)
                      +.++++|+++|++|+|+  +.|| +||+++||+||||+|||+++|||||+|+|++||+|||+||++||+++||+|+++||
T Consensus         3 ~~~~~~l~~lF~~Y~d~~~~~I~-~dG~~~~~~DLgv~ped~~~LvLaw~l~a~~~g~ftr~ef~~G~~~l~~dsi~~lk   81 (199)
T 3kev_A            3 RADKKAILELFQTYKEPLGNYIG-AEGLQRLFEDIQVDPSDVVTLVLAWKLKASSTCEFSEKEFVEGLANLQVDSLEKLK   81 (199)
T ss_dssp             -CCHHHHHHHHHHHCCTTSSEEC-HHHHHHHHHHTTCCTTSHHHHHHHHHTTCCSTTCEEHHHHHHHHHHTTCCSHHHHH
T ss_pred             ccCHHHHHHHHHHhcCCCcCccC-HHHHHHHHHHcCCChhhHHHHHHHHHcCCCccCcccHHHHHHHHHHhCCCCHHHHH
Confidence            45789999999999998  4899 99999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhCCChhhHHHHHhHhhhccCccccccccHHHHHHHHHHhcCCCChhhHHHHHHHHHhcCCCccCChhhHhH
Q 027440          106 KAISELEKEVRTPPNFADFYSFAFRYHLTEEKQKNIDIETICELLNLVLGPQFRRQVDLLIDYLKVQSNYKVINLDQWLG  185 (223)
Q Consensus       106 ~~l~~L~~~l~~~~~Fk~~Y~f~F~f~~~~~~qK~L~~e~Ai~~W~lll~~~~~~~l~~W~~Fl~~~~~~k~IskD~W~~  185 (223)
                      ++|++|+++|+||.+||+||+|||+|+|+ +|||+|++||||+||+|||+++|+ +++.|++||+++ + |+||||||+|
T Consensus        82 ~~l~~l~~~l~d~~~Fk~~Y~ftF~~~re-~gqk~L~~e~Ai~~W~lll~~~~~-~l~~W~~FL~~~-~-k~IskD~W~~  157 (199)
T 3kev_A           82 RKLSSLRKEIEDPSKFRAFYQFVFQYSKE-PSQRSLPAETAMALWDVLLRGRFS-LLDSWLEFLKNN-T-HSISRDTWNL  157 (199)
T ss_dssp             HHHHHHHHHTTSHHHHHHHHHHHHHHHSC-TTCSSBCHHHHHHHHHHHHTTTCT-THHHHHHHGGGC-C-SCBCHHHHHH
T ss_pred             HHHHHHHHHccCHHHHHHHHHHHHHHHcC-cCcCCCCHHHHHHHHHHHhCCccH-HHHHHHHHHHhc-C-CCcCHHHHHH
Confidence            99999999999999999999999999996 799999999999999999999996 999999999875 4 9999999999


Q ss_pred             HHHHhhhcCCCCCCCCCCCCCchhhHHHHHHHHHhhC
Q 027440          186 IFRFCNEISFPDLENYDETQAWPLILDNFVDWLRENH  222 (223)
Q Consensus       186 ~l~F~~~v~~~dls~YDe~~AWP~liDeFVe~~r~~~  222 (223)
                      +|+|+++|+ +|+|||||+||||+||||||||+|+++
T Consensus       158 ~l~F~~~i~-~dls~YDe~gAWP~liDeFVe~~r~~~  193 (199)
T 3kev_A          158 LYDFSQLSE-KDLSDYDENGAWPVLIDDFVKWLKHEQ  193 (199)
T ss_dssp             HHHHHTC---CTTTTCC---CCCHHHHHHHHHHTTC-
T ss_pred             HHHHHHHhc-ccccCCCCCCCchHHHHHHHHHHHHcC
Confidence            999999986 899999999999999999999999885
>3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A* Back     alignment and structure
>4gba_A DCN1-like protein 3; E3 ligase, ligase-peptide complex; HET: AME; 2.40A {Homo sapiens} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query223
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 96.54
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 96.17
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 95.81
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 95.74
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 95.33
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 95.3
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 95.11
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 95.0
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 94.91
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 94.56
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 94.34
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 94.04
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 94.0
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 93.93
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 93.71
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 93.66
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 92.97
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 92.85
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 92.46
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 92.36
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 92.28
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 92.18
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 92.07
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 91.98
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 91.64
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 91.48
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 91.44
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 90.71
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 90.41
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 90.0
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 89.7
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 89.6
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 89.49
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 89.36
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 89.34
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 89.22
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 89.1
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 89.08
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 89.0
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 88.89
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 88.81
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 88.64
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 88.45
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 88.37
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 88.25
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 88.03
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 87.81
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 86.98
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 86.81
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 86.74
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 86.52
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 86.46
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 86.4
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 86.04
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 85.93
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 85.74
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 85.67
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 85.66
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 85.34
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 85.13
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 85.07
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 84.7
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 84.43
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 84.29
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 84.25
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 84.05
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 83.72
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 83.5
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 83.39
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 83.37
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 83.34
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 82.33
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 81.87
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 81.82
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 81.09
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 80.88
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 80.5
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Troponin C
species: Chicken (Gallus gallus) [TaxId: 9031]

Probab=96.54  E-value=0.0054  Score=41.38  Aligned_cols=68  Identities=16%  Similarity=0.170  Sum_probs=60.0

Q ss_pred             ccCHHHHHHHHHhhcCC--CCCCCHHHHHHHHHHcCCCCCCHHHHHHHHHhcCCccccccHHHHHHHHhhc
Q 027440           28 KAKAKEIENFFDKYANG--GIIDSPDGIVTLCKDLELEYTDVRILMLAWYLKAVKLGYFTQDEWETGLKTL   96 (223)
Q Consensus        28 ~~~~~~l~~lF~~Y~d~--~~I~~~dGi~~~~~DLgv~~ed~~~LvLa~~l~a~~~g~itr~eF~~g~~~l   96 (223)
                      .....+|.++|..|=..  +.|. .+-+.+++..||+.+.+-.+--+...+....-|.|+-+||++-|+.+
T Consensus         5 ~~~eeel~~~F~~fD~~~~G~I~-~~el~~~l~~lg~~~~~~e~~~~~~~~D~d~dg~I~~~EF~~~m~~~   74 (75)
T d1jc2a_           5 GKSEEELANCFRIFDKNADGFID-IEELGEILRATGEHVIEEDIEDLMKDSDKNNDGRIDFDEFLKMMEGV   74 (75)
T ss_dssp             CCCHHHHHHHHHHHCCSTTSSEE-HHHHHHHHHHSSSCCCHHHHHHHHHHHCSSSCSEECHHHHHHHHHTC
T ss_pred             CCcHHHHHHHHHHHcCCCcCeEc-HHHHHHHHHhcCCCccHHHHHHHHHHhCCCCCCcEeHHHHHHHHHhC
Confidence            34678999999999433  7899 99999999999999998888888889998889999999999998875
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure