Citrus Sinensis ID: 027527


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MAISLSTALSPNTTVRFNRLTNPAPTRILPNQSPLWRPRHWNKTLKLSPRRPSHVIASAVSESPPSVSEDTKNLLDTVKVYDVNGNAIPISDLWKDRKAVVAFARHFGCVLCRKRADYLAAKKDVMDASGVALVLIGPGSVEQARTFSEQTKFKGEVYADPNHSSYEALSFVSGVLVTFTPKAGLKIIQSYMEGYRQDWKLSFERDTVSRGGWYDTPLFEVL
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccEEEcccccEEEcccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHcccccEEEEcccHHHHHHccccccccccccccHHHHHHHHHHHHHccccccccccccccccEEEEccEEEEc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccHHHHHccccEEEEccccEEcHHHHHHcccEEEEEEEccccHHHHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHcccccEEEEcccHHHHHHHcccccccEEcccccHHHHHHHHHHHHHccccEcccccccccccccccccEEcc
maislstalspnttvrfnrltnpaptrilpnqsplwrprhwnktlklsprrpshviasavsesppsvsedtknLLDTVKvydvngnaipisdlwKDRKAVVAFARHFGCVLCRKRADYLAAKKDVMDASGVALVLIGpgsveqartfseqtkfkgevyadpnhssyeaLSFVSGVLVTFTPKAGLKIIQSYMEGYRQDWKLSferdtvsrggwydtplfevl
maislstalspnttvrfnrltnpaptrilpnqsplwrprhwnktlklsprrPSHVIasavsesppsvsedtknLLDTVKVYDVngnaipisdlwkDRKAVVAFARHFGCVLCRKRADYLAAKKDVMDASGVALVLIGPGSVEQARTFSEQTKFKGEVYADPNHSSYEALSFVSGVLVTFTPKAGLKIIQSYMEGYRQDWKLSFerdtvsrggwydtplfevl
MAISLSTALSPNTTVRFNRLTNPAPTRILPNQSPLWRPRHWNKTLKLSPRRPSHVIasavsesppsvseDTKNLLDTVKVYDVNGNAIPISDLWKDRKAVVAFARHFGCVLCRKRADYLAAKKDVMDASGVALVLIGPGSVEQARTFSEQTKFKGEVYADPNHSSYEALSFVSGVLVTFTPKAGLKIIQSYMEGYRQDWKLSFERDTVSRGGWYDTPLFEVL
***********************************W****W********************************LLDTVKVYDVNGNAIPISDLWKDRKAVVAFARHFGCVLCRKRADYLAAKKDVMDASGVALVLIGPGSVEQARTFSEQTKFKGEVYADPNHSSYEALSFVSGVLVTFTPKAGLKIIQSYMEGYRQDWKLSFERDTVSRGGWYDTPLF***
*************************************************************************LLDTVKVYDVNGNAIPISDLWKDRKAVVAFARHFGCVLCRKRADYLAAKKDVMDASGVALVLIGPGSVEQARTFSEQTKFKGEVYADPNHSSYEALSFVSGVLVTFTPKAGLKIIQSYMEGYR*******ERDTVSRGGWYDTPLFEVL
MAISLSTALSPNTTVRFNRLTNPAPTRILPNQSPLWRPRHWNKTLKLSPR*******************DTKNLLDTVKVYDVNGNAIPISDLWKDRKAVVAFARHFGCVLCRKRADYLAAKKDVMDASGVALVLIGPGSVEQARTFSEQTKFKGEVYADPNHSSYEALSFVSGVLVTFTPKAGLKIIQSYMEGYRQDWKLSFERDTVSRGGWYDTPLFEVL
*****************************************************************SVSEDTKNLLDTVKVYDVNGNAIPISDLWKDRKAVVAFARHFGCVLCRKRADYLAAKKDVMDASGVALVLIGPGSVEQARTFSEQTKFKGEVYADPNHSSYEALSFVSGVLVTFTPKAGLKIIQSYMEGYRQDWKLSFERDTVSRGGWYDTPLFEVL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAISLSTALSPNTTVRFNRLTNPAPTRILPNQSPLWRPRHWNKTLKLSPRRPSHVIASAVSESPPSVSEDTKNLLDTVKVYDVNGNAIPISDLWKDRKAVVAFARHFGCVLCRKRADYLAAKKDVMDASGVALVLIGPGSVEQARTFSEQTKFKGEVYADPNHSSYEALSFVSGVLVTFTPKAGLKIIQSYMEGYRQDWKLSFERDTVSRGGWYDTPLFEVL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query222 2.2.26 [Sep-21-2011]
Q9ZUU2248 Thioredoxin-like protein yes no 0.734 0.657 0.763 5e-70
B5X9L9200 Prostamide/prostaglandin N/A no 0.581 0.645 0.320 2e-11
Q7RTV5226 Thioredoxin-like protein yes no 0.563 0.553 0.285 1e-10
C1C416201 Prostamide/prostaglandin N/A no 0.581 0.641 0.305 1e-10
Q5R7S9198 Prostamide/prostaglandin no no 0.405 0.454 0.373 2e-10
Q9D1A0226 Thioredoxin-like protein yes no 0.657 0.646 0.284 2e-10
Q148E0228 Thioredoxin-like protein yes no 0.427 0.416 0.312 3e-10
Q58CY6201 Prostamide/prostaglandin no no 0.405 0.447 0.362 5e-10
Q28IJ3201 Prostamide/prostaglandin yes no 0.581 0.641 0.312 7e-10
Q8TBF2198 Prostamide/prostaglandin no no 0.405 0.454 0.362 8e-10
>sp|Q9ZUU2|AAED1_ARATH Thioredoxin-like protein AAED1, chloroplastic OS=Arabidopsis thaliana GN=At2g37240 PE=2 SV=2 Back     alignment and function desciption
 Score =  263 bits (673), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 140/165 (84%), Gaps = 2/165 (1%)

Query: 51  RPSHVIASAVS--ESPPSVSEDTKNLLDTVKVYDVNGNAIPISDLWKDRKAVVAFARHFG 108
           R S V+ SA++   S   + + T + LDTVKV D+ GN IPISDLWKDRKAVVAFARHFG
Sbjct: 45  RRSAVVVSAITGASSGAGIGKGTADSLDTVKVLDLRGNEIPISDLWKDRKAVVAFARHFG 104

Query: 109 CVLCRKRADYLAAKKDVMDASGVALVLIGPGSVEQARTFSEQTKFKGEVYADPNHSSYEA 168
           CVLCRKRA YLA KKDVMDASGVALVLIGPGS++QA TF EQTKFKGEVYADPNH+SYEA
Sbjct: 105 CVLCRKRAAYLAEKKDVMDASGVALVLIGPGSIDQANTFVEQTKFKGEVYADPNHASYEA 164

Query: 169 LSFVSGVLVTFTPKAGLKIIQSYMEGYRQDWKLSFERDTVSRGGW 213
           L FVSGV VTFTPKA +KI++SYMEGYRQDWKLSF +DTV RGGW
Sbjct: 165 LEFVSGVSVTFTPKAAMKILESYMEGYRQDWKLSFMKDTVERGGW 209





Arabidopsis thaliana (taxid: 3702)
>sp|B5X9L9|PGFS_SALSA Prostamide/prostaglandin F synthase OS=Salmo salar GN=fam213b PE=2 SV=1 Back     alignment and function description
>sp|Q7RTV5|AAED1_HUMAN Thioredoxin-like protein AAED1 OS=Homo sapiens GN=AAED1 PE=2 SV=1 Back     alignment and function description
>sp|C1C416|PGFS_LITCT Prostamide/prostaglandin F synthase OS=Lithobates catesbeiana GN=fam213b PE=2 SV=1 Back     alignment and function description
>sp|Q5R7S9|PGFS_PONAB Prostamide/prostaglandin F synthase OS=Pongo abelii GN=FAM213B PE=2 SV=1 Back     alignment and function description
>sp|Q9D1A0|AAED1_MOUSE Thioredoxin-like protein AAED1 OS=Mus musculus GN=Aaed1 PE=2 SV=1 Back     alignment and function description
>sp|Q148E0|AAED1_BOVIN Thioredoxin-like protein AAED1 OS=Bos taurus GN=AAED1 PE=2 SV=1 Back     alignment and function description
>sp|Q58CY6|PGFS_BOVIN Prostamide/prostaglandin F synthase OS=Bos taurus GN=FAM213B PE=2 SV=1 Back     alignment and function description
>sp|Q28IJ3|PGFS_XENTR Prostamide/prostaglandin F synthase OS=Xenopus tropicalis GN=fam213b PE=2 SV=1 Back     alignment and function description
>sp|Q8TBF2|PGFS_HUMAN Prostamide/prostaglandin F synthase OS=Homo sapiens GN=FAM213B PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
225439771254 PREDICTED: UPF0308 protein At2g37240, ch 0.950 0.830 0.672 5e-75
388514001256 unknown [Lotus japonicus] 0.954 0.828 0.683 8e-75
255568448249 conserved hypothetical protein [Ricinus 0.923 0.823 0.679 5e-74
359806966256 uncharacterized protein LOC100795126 [Gl 0.950 0.824 0.657 2e-73
224068620200 predicted protein [Populus trichocarpa] 0.662 0.735 0.877 4e-73
357510551251 hypothetical protein MTR_7g100540 [Medic 0.945 0.836 0.647 7e-72
449448701258 PREDICTED: thioredoxin-like protein AAED 0.954 0.821 0.618 3e-71
297827233248 hypothetical protein ARALYDRAFT_482716 [ 0.932 0.834 0.641 1e-70
18404359248 Thioredoxin-like protein [Arabidopsis th 0.734 0.657 0.763 3e-68
224102475146 predicted protein [Populus trichocarpa] 0.603 0.917 0.888 2e-66
>gi|225439771|ref|XP_002273449.1| PREDICTED: UPF0308 protein At2g37240, chloroplastic [Vitis vinifera] gi|297741495|emb|CBI32627.3| unnamed protein product [Vitis vinifera] gi|342160850|gb|AEL16461.1| type II peroxiredoxin 2 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  286 bits (732), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 168/217 (77%), Gaps = 6/217 (2%)

Query: 1   MAISLSTALSPNTTVRFNRLTNPAPTRILPNQSPLWRPRHWNKTLKLSPRRPSHVIASAV 60
           MAISLST + PNT  R      P+P R+  N       R  N++++LS  R   + ASA 
Sbjct: 1   MAISLSTTILPNTIQRRRITILPSP-RVSRNLGFSLSFRPCNESIELSSSR-RVITASAA 58

Query: 61  SESP----PSVSEDTKNLLDTVKVYDVNGNAIPISDLWKDRKAVVAFARHFGCVLCRKRA 116
           S SP     +VS+DT NLLD  +V+D+NGN IPISDLWKDRKAVVAFARHFGCV CRKRA
Sbjct: 59  SGSPGIESSTVSDDTTNLLDRAQVFDLNGNGIPISDLWKDRKAVVAFARHFGCVFCRKRA 118

Query: 117 DYLAAKKDVMDASGVALVLIGPGSVEQARTFSEQTKFKGEVYADPNHSSYEALSFVSGVL 176
           D LA++KD MDASGVALVLIGPGS++QA+ FSEQT FKGEVYADP+HSSYE L FVSGVL
Sbjct: 119 DLLASQKDRMDASGVALVLIGPGSIDQAKAFSEQTNFKGEVYADPSHSSYEVLGFVSGVL 178

Query: 177 VTFTPKAGLKIIQSYMEGYRQDWKLSFERDTVSRGGW 213
            TFTP+AGLKIIQ YMEGYRQDW LSF+RDTV+RGGW
Sbjct: 179 STFTPQAGLKIIQLYMEGYRQDWGLSFQRDTVTRGGW 215




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|388514001|gb|AFK45062.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255568448|ref|XP_002525198.1| conserved hypothetical protein [Ricinus communis] gi|223535495|gb|EEF37164.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|359806966|ref|NP_001241584.1| uncharacterized protein LOC100795126 [Glycine max] gi|255639489|gb|ACU20039.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224068620|ref|XP_002326159.1| predicted protein [Populus trichocarpa] gi|222833352|gb|EEE71829.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357510551|ref|XP_003625564.1| hypothetical protein MTR_7g100540 [Medicago truncatula] gi|355500579|gb|AES81782.1| hypothetical protein MTR_7g100540 [Medicago truncatula] Back     alignment and taxonomy information
>gi|449448701|ref|XP_004142104.1| PREDICTED: thioredoxin-like protein AAED1, chloroplastic-like [Cucumis sativus] gi|449521503|ref|XP_004167769.1| PREDICTED: thioredoxin-like protein AAED1, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297827233|ref|XP_002881499.1| hypothetical protein ARALYDRAFT_482716 [Arabidopsis lyrata subsp. lyrata] gi|297327338|gb|EFH57758.1| hypothetical protein ARALYDRAFT_482716 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18404359|ref|NP_030274.1| Thioredoxin-like protein [Arabidopsis thaliana] gi|46397070|sp|Q9ZUU2.2|AAED1_ARATH RecName: Full=Thioredoxin-like protein AAED1, chloroplastic; AltName: Full=AhpC/TSA antioxidant enzyme domain-containing protein 1; Flags: Precursor gi|15215634|gb|AAK91362.1| At2g37240/F3G5.3 [Arabidopsis thaliana] gi|20197473|gb|AAC98045.2| expressed protein [Arabidopsis thaliana] gi|21618147|gb|AAM67197.1| unknown [Arabidopsis thaliana] gi|30102454|gb|AAP21145.1| At2g37240/F3G5.3 [Arabidopsis thaliana] gi|330254277|gb|AEC09371.1| Thioredoxin-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224102475|ref|XP_002334170.1| predicted protein [Populus trichocarpa] gi|222869935|gb|EEF07066.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
TAIR|locus:2049801248 AT2G37240 [Arabidopsis thalian 0.932 0.834 0.627 1.4e-62
TAIR|locus:2152054275 AT5G65840 [Arabidopsis thalian 0.662 0.534 0.331 1.1e-16
UNIPROTKB|B5X9L9200 fam213b "Prostamide/prostaglan 0.581 0.645 0.320 3.4e-13
UNIPROTKB|C1C416201 fam213b "Prostamide/prostaglan 0.581 0.641 0.305 9.1e-13
UNIPROTKB|Q28IJ3201 fam213b "Prostamide/prostaglan 0.581 0.641 0.312 5e-12
MGI|MGI:1913379226 Aaed1 "AhpC/TSA antioxidant en 0.594 0.584 0.283 5e-12
UNIPROTKB|Q5R7S9198 FAM213B "Prostamide/prostaglan 0.396 0.444 0.382 1.7e-11
UNIPROTKB|Q6AZG8201 fam213b "Prostamide/prostaglan 0.581 0.641 0.297 2.2e-11
ZFIN|ZDB-GENE-040426-2556201 fam213b "family with sequence 0.567 0.626 0.307 2.2e-11
UNIPROTKB|J3KQD0228 FAM213B "Prostamide/prostaglan 0.396 0.385 0.370 4.5e-11
TAIR|locus:2049801 AT2G37240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 639 (230.0 bits), Expect = 1.4e-62, P = 1.4e-62
 Identities = 135/215 (62%), Positives = 156/215 (72%)

Query:     1 MAISLSTALS-PNTTVRFNRLTNPAPTRILPNQSPLWRPRHWNKTLKLSPRRPSHVIXXX 59
             MAI+LS++ +  + T++    T      +LP  S      H+     +S RR + V+   
Sbjct:     1 MAIALSSSSTITSITLQPKLKTIHGLGTVLPGYSV---KSHFRS---VSLRRSAVVVSAI 54

Query:    60 XXXXXXXXXXD-TKNLLDTVKVYDVNGNAIPISDLWKDRKAVVAFARHFGCVLCRKRADY 118
                         T + LDTVKV D+ GN IPISDLWKDRKAVVAFARHFGCVLCRKRA Y
Sbjct:    55 TGASSGAGIGKGTADSLDTVKVLDLRGNEIPISDLWKDRKAVVAFARHFGCVLCRKRAAY 114

Query:   119 LAAKKDVMDASGVALVLIGPGSVEQARTFSEQTKFKGEVYADPNHSSYEALSFVSGVLVT 178
             LA KKDVMDASGVALVLIGPGS++QA TF EQTKFKGEVYADPNH+SYEAL FVSGV VT
Sbjct:   115 LAEKKDVMDASGVALVLIGPGSIDQANTFVEQTKFKGEVYADPNHASYEALEFVSGVSVT 174

Query:   179 FTPKAGLKIIQSYMEGYRQDWKLSFERDTVSRGGW 213
             FTPKA +KI++SYMEGYRQDWKLSF +DTV RGGW
Sbjct:   175 FTPKAAMKILESYMEGYRQDWKLSFMKDTVERGGW 209




GO:0005576 "extracellular region" evidence=ISM
GO:0016209 "antioxidant activity" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA
GO:0010264 "myo-inositol hexakisphosphate biosynthetic process" evidence=RCA
TAIR|locus:2152054 AT5G65840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|B5X9L9 fam213b "Prostamide/prostaglandin F synthase" [Salmo salar (taxid:8030)] Back     alignment and assigned GO terms
UNIPROTKB|C1C416 fam213b "Prostamide/prostaglandin F synthase" [Rana catesbeiana (taxid:8400)] Back     alignment and assigned GO terms
UNIPROTKB|Q28IJ3 fam213b "Prostamide/prostaglandin F synthase" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
MGI|MGI:1913379 Aaed1 "AhpC/TSA antioxidant enzyme domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R7S9 FAM213B "Prostamide/prostaglandin F synthase" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|Q6AZG8 fam213b "Prostamide/prostaglandin F synthase" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2556 fam213b "family with sequence similarity 213, member B" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|J3KQD0 FAM213B "Prostamide/prostaglandin F synthase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ZUU2AAED1_ARATHNo assigned EC number0.76360.73420.6572yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00280112
hypothetical protein (201 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
cd02970149 cd02970, PRX_like2, Peroxiredoxin (PRX)-like 2 fam 7e-31
pfam13911113 pfam13911, AhpC-TSA_2, AhpC/TSA antioxidant enzyme 5e-10
pfam00578124 pfam00578, AhpC-TSA, AhpC/TSA family 9e-05
>gnl|CDD|239268 cd02970, PRX_like2, Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
 Score =  110 bits (277), Expect = 7e-31
 Identities = 39/125 (31%), Positives = 55/125 (44%)

Query: 75  LDTVKVYDVNGNAIPISDLWKDRKAVVAFARHFGCVLCRKRADYLAAKKDVMDASGVALV 134
               ++ D  G  + +S L  +   VV F R FGC  CR+    L+     +DA GV LV
Sbjct: 2   APDFELPDAGGETVTLSALLGEGPVVVVFYRGFGCPFCREYLRALSKLLPELDALGVELV 61

Query: 135 LIGPGSVEQARTFSEQTKFKGEVYADPNHSSYEALSFVSGVLVTFTPKAGLKIIQSYMEG 194
            +GP S E+   F +       VYADP+   Y AL  V  +  + TP+A  K       G
Sbjct: 62  AVGPESPEKLEAFDKGKFLPFPVYADPDRKLYRALGLVRSLPWSNTPRALWKNAAIGFRG 121

Query: 195 YRQDW 199
             +  
Sbjct: 122 NDEGD 126


Members of this group contain a CXXC motif, similar to TRX. The second cysteine in the motif corresponds to the peroxidatic cysteine of PRX, however, these proteins do not contain the other two residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. TRXs alter the redox state of target proteins by catalyzing the reduction of their disulfide bonds via the CXXC motif using reducing equivalents derived from either NADPH or ferredoxins. Length = 149

>gnl|CDD|222452 pfam13911, AhpC-TSA_2, AhpC/TSA antioxidant enzyme Back     alignment and domain information
>gnl|CDD|216002 pfam00578, AhpC-TSA, AhpC/TSA family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 222
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot 99.94
COG1225157 Bcp Peroxiredoxin [Posttranslational modification, 99.87
KOG4498197 consensus Uncharacterized conserved protein [Funct 99.86
PF00578124 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per 99.86
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik 99.83
cd03013155 PRX5_like Peroxiredoxin (PRX) family, PRX5-like su 99.81
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 99.8
PF08534146 Redoxin: Redoxin; InterPro: IPR013740 This redoxin 99.79
PRK09437154 bcp thioredoxin-dependent thiol peroxidase; Review 99.79
cd03016203 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub 99.79
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of 99.78
TIGR03137187 AhpC peroxiredoxin. This gene contains two invaria 99.78
PRK13599215 putative peroxiredoxin; Provisional 99.77
PRK13190202 putative peroxiredoxin; Provisional 99.77
PF13911115 AhpC-TSA_2: AhpC/TSA antioxidant enzyme 99.77
PRK13191215 putative peroxiredoxin; Provisional 99.76
PTZ00137261 2-Cys peroxiredoxin; Provisional 99.76
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- 99.76
PRK13189222 peroxiredoxin; Provisional 99.75
PRK00522167 tpx lipid hydroperoxide peroxidase; Provisional 99.74
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 99.74
PTZ00056199 glutathione peroxidase; Provisional 99.73
PRK10382187 alkyl hydroperoxide reductase subunit C; Provision 99.73
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot 99.72
KOG0855211 consensus Alkyl hydroperoxide reductase, thiol spe 99.71
cd00340152 GSH_Peroxidase Glutathione (GSH) peroxidase family 99.71
PRK15000200 peroxidase; Provisional 99.71
PTZ00256183 glutathione peroxidase; Provisional 99.7
PRK03147173 thiol-disulfide oxidoreductase; Provisional 99.7
TIGR02661189 MauD methylamine dehydrogenase accessory protein M 99.69
PLN02412167 probable glutathione peroxidase 99.67
PLN02399236 phospholipid hydroperoxide glutathione peroxidase 99.67
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like su 99.67
PTZ00253199 tryparedoxin peroxidase; Provisional 99.67
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 99.65
TIGR02540153 gpx7 putative glutathione peroxidase Gpx7. This mo 99.65
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c 99.64
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 99.63
cd02967114 mauD Methylamine utilization (mau) D family; mauD 99.62
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 99.6
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 99.59
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 99.54
PRK10606183 btuE putative glutathione peroxidase; Provisional 99.5
COG0450194 AhpC Peroxiredoxin [Posttranslational modification 99.49
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 99.47
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 99.42
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 99.4
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.39
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 99.31
PRK13728181 conjugal transfer protein TrbB; Provisional 99.21
KOG0854224 consensus Alkyl hydroperoxide reductase, thiol spe 99.2
TIGR01626184 ytfJ_HI0045 conserved hypothetical protein YtfJ-fa 99.18
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 99.09
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 98.73
COG2077158 Tpx Peroxiredoxin [Posttranslational modification, 98.7
KOG0541171 consensus Alkyl hydroperoxide reductase/peroxiredo 98.69
KOG0852196 consensus Alkyl hydroperoxide reductase, thiol spe 98.68
PF02630174 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This fam 98.57
KOG2501157 consensus Thioredoxin, nucleoredoxin and related p 98.56
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 98.54
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 98.54
PF00255108 GSHPx: Glutathione peroxidase; InterPro: IPR000889 98.51
COG0678165 AHP1 Peroxiredoxin [Posttranslational modification 98.41
COG0386162 BtuE Glutathione peroxidase [Posttranslational mod 98.34
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 98.32
PF05988211 DUF899: Bacterial protein of unknown function (DUF 98.3
TIGR02740271 TraF-like TraF-like protein. This protein is relat 98.22
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 98.14
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 98.01
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 97.98
COG1999207 Uncharacterized protein SCO1/SenC/PrrC, involved i 97.98
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 97.97
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 97.94
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 97.9
KOG1651171 consensus Glutathione peroxidase [Posttranslationa 97.87
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 97.87
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 97.87
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 97.86
PRK10996139 thioredoxin 2; Provisional 97.84
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 97.81
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 97.8
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 97.77
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 97.76
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 97.76
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 97.76
PRK09381109 trxA thioredoxin; Provisional 97.74
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 97.73
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 97.72
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 97.72
cd02962152 TMX2 TMX2 family; composed of proteins similar to 97.71
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 97.71
PTZ0005198 thioredoxin; Provisional 97.71
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 97.7
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 97.68
COG4312247 Uncharacterized protein conserved in bacteria [Fun 97.66
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 97.65
PF00837237 T4_deiodinase: Iodothyronine deiodinase; InterPro: 97.61
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 97.6
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 97.6
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 97.58
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 97.57
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 97.54
cd0294793 TRX_family TRX family; composed of two groups: Gro 97.52
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 97.5
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 97.46
COG0526127 TrxA Thiol-disulfide isomerase and thioredoxins [P 97.39
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 97.39
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 97.36
KOG0907106 consensus Thioredoxin [Posttranslational modificat 97.32
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 97.3
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 97.19
PHA02278103 thioredoxin-like protein 97.13
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 97.07
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 97.02
KOG2792280 consensus Putative cytochrome C oxidase assembly p 96.96
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 96.96
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 96.93
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 96.93
PTZ00443224 Thioredoxin domain-containing protein; Provisional 96.88
PRK00293571 dipZ thiol:disulfide interchange protein precursor 96.87
cd02955124 SSP411 TRX domain, SSP411 protein family; members 96.86
TIGR01130 462 ER_PDI_fam protein disulfide isomerases, eukaryoti 96.84
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 96.8
PF13728215 TraF: F plasmid transfer operon protein 96.8
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 96.61
PTZ00102477 disulphide isomerase; Provisional 96.58
PLN02309457 5'-adenylylsulfate reductase 96.58
KOG0910150 consensus Thioredoxin-like protein [Posttranslatio 96.5
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 96.43
PTZ00102 477 disulphide isomerase; Provisional 96.42
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 96.41
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 96.37
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 95.99
TIGR02739256 TraF type-F conjugative transfer system pilin asse 95.9
COG3118 304 Thioredoxin domain-containing protein [Posttransla 95.78
PF14595129 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. 95.57
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 95.52
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 95.5
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 95.47
KOG0190 493 consensus Protein disulfide isomerase (prolyl 4-hy 95.47
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 95.39
PF04592238 SelP_N: Selenoprotein P, N terminal region; InterP 95.37
cd02960130 AGR Anterior Gradient (AGR) family; members of thi 95.12
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 94.97
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 94.95
PF07976169 Phe_hydrox_dim: Phenol hydroxylase, C-terminal dim 94.79
PRK13703248 conjugal pilus assembly protein TraF; Provisional 94.76
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 94.74
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 94.67
PF06110119 DUF953: Eukaryotic protein of unknown function (DU 94.57
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 94.49
PRK1120085 grxA glutaredoxin 1; Provisional 94.47
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 94.42
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 94.41
cd03032115 ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub 94.4
PHA0212575 thioredoxin-like protein 94.3
PTZ00062204 glutaredoxin; Provisional 94.28
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; comp 94.21
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 94.16
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknow 94.11
PRK01655131 spxA transcriptional regulator Spx; Reviewed 93.93
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 93.67
cd02958114 UAS UAS family; UAS is a domain of unknown functio 93.61
TIGR01617117 arsC_related transcriptional regulator, Spx/MgsR f 93.53
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 93.49
PRK1032981 glutaredoxin-like protein; Provisional 93.23
KOG0191 383 consensus Thioredoxin/protein disulfide isomerase 93.22
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 93.05
PRK12559131 transcriptional regulator Spx; Provisional 93.01
smart00594122 UAS UAS domain. 92.98
PF13462162 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DV 92.61
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 92.51
PRK10824115 glutaredoxin-4; Provisional 92.5
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 91.93
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 91.88
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 91.86
cd03023154 DsbA_Com1_like DsbA family, Com1-like subfamily; c 91.72
PRK1063883 glutaredoxin 3; Provisional 91.62
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 91.62
KOG1731 606 consensus FAD-dependent sulfhydryl oxidase/quiesci 91.56
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 91.42
cd02979167 PHOX_C FAD-dependent Phenol hydoxylase (PHOX) fami 91.14
PHA03050108 glutaredoxin; Provisional 91.12
cd03035105 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s 90.87
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 90.82
PF13778118 DUF4174: Domain of unknown function (DUF4174) 90.75
KOG0908 288 consensus Thioredoxin-like protein [Posttranslatio 90.33
PRK13344132 spxA transcriptional regulator Spx; Reviewed 89.91
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 89.84
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 89.6
PRK08294634 phenol 2-monooxygenase; Provisional 88.11
PF0576881 DUF836: Glutaredoxin-like domain (DUF836); InterPr 87.57
TIGR03759200 conj_TIGR03759 integrating conjugative element pro 86.82
KOG0190493 consensus Protein disulfide isomerase (prolyl 4-hy 86.75
KOG3425128 consensus Uncharacterized conserved protein [Funct 86.7
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 85.92
KOG0191383 consensus Thioredoxin/protein disulfide isomerase 85.48
cd03034112 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s 84.99
PRK10026141 arsenate reductase; Provisional 84.86
cd02991116 UAS_ETEA UAS family, ETEA subfamily; composed of p 83.98
COG4232569 Thiol:disulfide interchange protein [Posttranslati 83.8
cd03019178 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a m 83.75
PTZ00062204 glutaredoxin; Provisional 82.75
cd03020197 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil 82.25
TIGR00014114 arsC arsenate reductase (glutaredoxin). composed o 82.08
PRK10877232 protein disulfide isomerase II DsbC; Provisional 81.86
TIGR00995270 3a0901s06TIC22 chloroplast protein import componen 81.29
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 80.4
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
Probab=99.94  E-value=3.1e-26  Score=181.29  Aligned_cols=136  Identities=30%  Similarity=0.461  Sum_probs=116.2

Q ss_pred             cCCCcEEecCCCCeEeCCCccCCCeEEEEEEcCCCChhHHHHHHHHHHhHHHHHhCCCEEEEEcCCCHHHHHHHHHHcCC
Q 027527           74 LLDTVKVYDVNGNAIPISDLWKDRKAVVAFARHFGCVLCRKRADYLAAKKDVMDASGVALVLIGPGSVEQARTFSEQTKF  153 (222)
Q Consensus        74 ~apdf~L~D~~G~~v~Lsdl~~~~~vvVvF~R~~~Cp~C~~el~~L~~~~~~l~~~gv~lvaIs~~s~~~i~~f~~~~~~  153 (222)
                      .+|+|++.|.+|+.++++++.+++++||+|||++|||+|++|++.|+++++++++.|+++|+|+.++.+..++|.+++++
T Consensus         1 ~~p~f~l~~~~g~~~~l~~~~~~~~~vl~f~~~~~Cp~C~~~~~~l~~~~~~~~~~~v~vv~V~~~~~~~~~~~~~~~~~   80 (149)
T cd02970           1 TAPDFELPDAGGETVTLSALLGEGPVVVVFYRGFGCPFCREYLRALSKLLPELDALGVELVAVGPESPEKLEAFDKGKFL   80 (149)
T ss_pred             CCCCccccCCCCCEEchHHHhcCCCEEEEEECCCCChhHHHHHHHHHHHHHHHHhcCeEEEEEeCCCHHHHHHHHHhcCC
Confidence            47999999999999999998777899999999999999999999999999999999999999999999888899999999


Q ss_pred             CCceeecCChHHHHHcCCccccceeeccchhHHHHHHHHHHHHhhhccccccCCccCCceeeCceEEE
Q 027527          154 KGEVYADPNHSSYEALSFVSGVLVTFTPKAGLKIIQSYMEGYRQDWKLSFERDTVSRGGWYDTPLFEV  221 (222)
Q Consensus       154 pfpil~Dpd~~lyk~lGl~~~~~~~~~P~a~~~~l~~~~~g~r~~~k~~~~g~~~~g~~~Q~GG~fvv  221 (222)
                      +||+++|+++.++++||+.......+.+..+++           ....... ....|++.|+||+|||
T Consensus        81 ~~p~~~D~~~~~~~~~g~~~~~~~~~~~~~~~~-----------~~~~~~~-~~~~~~~~~~p~~fvi  136 (149)
T cd02970          81 PFPVYADPDRKLYRALGLVRSLPWSNTPRALWK-----------NAAIGFR-GNDEGDGLQLPGVFVI  136 (149)
T ss_pred             CCeEEECCchhHHHHcCceecCcHHHHHHHHhh-----------Ccccccc-cCCCCcccccceEEEE
Confidence            999999999999999999877665554433332           1111122 2355779999999997



Members of this group contain a CXXC motif, similar to TRX. The second cysteine in the motif corresponds to the peroxidatic cysteine of PRX, however, these proteins do not contain the other two residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. TRXs alter the redox state of target proteins by catalyzing the reduction of their disulfide bonds via the CXXC motif using reducing equivalents derived from either NADPH or ferredoxins.

>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4498 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>PRK13599 putative peroxiredoxin; Provisional Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>PF13911 AhpC-TSA_2: AhpC/TSA antioxidant enzyme Back     alignment and domain information
>PRK13191 putative peroxiredoxin; Provisional Back     alignment and domain information
>PTZ00137 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>KOG0855 consensus Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>PRK15000 peroxidase; Provisional Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD Back     alignment and domain information
>PLN02412 probable glutathione peroxidase Back     alignment and domain information
>PLN02399 phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>PTZ00253 tryparedoxin peroxidase; Provisional Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7 Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>PRK10606 btuE putative glutathione peroxidase; Provisional Back     alignment and domain information
>COG0450 AhpC Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>KOG0854 consensus Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>COG2077 Tpx Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0541 consensus Alkyl hydroperoxide reductase/peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0852 consensus Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02630 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This family is involved in biogenesis of respiratory and photosynthetic systems Back     alignment and domain information
>KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only] Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>PF00255 GSHPx: Glutathione peroxidase; InterPro: IPR000889 Glutathione peroxidase (GSHPx) (1 Back     alignment and domain information
>COG0678 AHP1 Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0386 BtuE Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>PF05988 DUF899: Bacterial protein of unknown function (DUF899); InterPro: IPR010296 This family consists of uncharacterised bacterial proteins of unknown function which are thioredoxin-like Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>COG1999 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems [General function prediction only] Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>KOG1651 consensus Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>COG4312 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>PF00837 T4_deiodinase: Iodothyronine deiodinase; InterPro: IPR000643 Iodothyronine deiodinase (1 Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>KOG2792 consensus Putative cytochrome C oxidase assembly protein [Energy production and conversion] Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>PF04592 SelP_N: Selenoprotein P, N terminal region; InterPro: IPR007671 SelP is the only known eukaryotic selenoprotein that contains multiple selenocysteine (Sec) residues, and accounts for more than 50% of the selenium content of rat and human plasma [] Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PF07976 Phe_hydrox_dim: Phenol hydroxylase, C-terminal dimerisation domain ; InterPro: IPR012941 Phenol hydroxylase is a homodimer which hydroxylates phenol to catechol, or similar products Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>PRK01655 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>PRK12559 transcriptional regulator Spx; Provisional Back     alignment and domain information
>smart00594 UAS UAS domain Back     alignment and domain information
>PF13462 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>KOG1731 consensus FAD-dependent sulfhydryl oxidase/quiescin and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>cd02979 PHOX_C FAD-dependent Phenol hydoxylase (PHOX) family, C-terminal TRX-fold domain; composed of proteins similar to PHOX from the aerobic topsoil yeast Trichosporon cutaneum Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>PF13778 DUF4174: Domain of unknown function (DUF4174) Back     alignment and domain information
>KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13344 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>TIGR03759 conj_TIGR03759 integrating conjugative element protein, PFL_4693 family Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3425 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli Back     alignment and domain information
>PRK10026 arsenate reductase; Provisional Back     alignment and domain information
>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals Back     alignment and domain information
>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>TIGR00014 arsC arsenate reductase (glutaredoxin) Back     alignment and domain information
>PRK10877 protein disulfide isomerase II DsbC; Provisional Back     alignment and domain information
>TIGR00995 3a0901s06TIC22 chloroplast protein import component, Tic22 family Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
3mng_A173 Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, 99.9
4g2e_A157 Peroxiredoxin; redox protein, structural genomics, 99.89
4gqc_A164 Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f 99.89
2wfc_A167 Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan 99.89
3uma_A184 Hypothetical peroxiredoxin protein; nysgrc, PSI bi 99.89
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, at 99.87
2pwj_A171 Mitochondrial peroxiredoxin; alpha and beta protei 99.86
3ixr_A179 Bacterioferritin comigratory protein; alpha beta p 99.86
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 99.86
1tp9_A162 Peroxiredoxin, PRX D (type II); oligomer, thioredo 99.86
2a4v_A159 Peroxiredoxin DOT5; yeast nuclear thiol peroxidase 99.86
3p7x_A166 Probable thiol peroxidase; thioredoxin fold, oxido 99.83
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 99.82
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 99.82
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th 99.82
1prx_A224 HORF6; peroxiredoxin, hydrogen peroxide, redox reg 99.81
4f82_A176 Thioredoxin reductase; structural genomics, niaid, 99.81
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; p 99.81
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 99.81
2yzh_A171 Probable thiol peroxidase; redox protein, antioxid 99.81
1psq_A163 Probable thiol peroxidase; structural genomics, NY 99.81
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 99.81
2xhf_A171 Peroxiredoxin 5; oxidoreductase, antioxidant enzym 99.81
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXR 99.81
2i81_A213 2-Cys peroxiredoxin; structural genomics consortiu 99.81
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 99.8
2v2g_A233 Peroxiredoxin 6; oxidoreductase, antioxidant enzym 99.8
1xcc_A220 1-Cys peroxiredoxin; unknown function, structural 99.8
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 99.8
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 99.8
3zrd_A200 Thiol peroxidase; oxidoreductase, 2Cys peroxiredox 99.8
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 99.79
1xiy_A182 Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin 99.79
3tue_A219 Tryparedoxin peroxidase; thioredoxin fold, peroxir 99.79
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 99.78
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, 99.78
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 99.78
3sbc_A216 Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c 99.78
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 99.78
2lrn_A152 Thiol:disulfide interchange protein; structural ge 99.78
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 99.78
2ywi_A196 Hypothetical conserved protein; uncharacterized co 99.78
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 99.78
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, stru 99.78
3qpm_A240 Peroxiredoxin; oxidoreductase, thioredoxin fold, p 99.78
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 99.78
3tjj_A254 Peroxiredoxin-4; thioredoxin fold, sulfenylation, 99.77
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 99.77
3ztl_A222 Thioredoxin peroxidase; oxidoreductase, reductase, 99.77
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 99.77
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 99.76
3kij_A180 Probable glutathione peroxidase 8; human PDI-perox 99.76
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 99.76
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 99.76
2l5o_A153 Putative thioredoxin; structural genomics, unknown 99.76
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 99.76
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 99.76
1zye_A220 Thioredoxin-dependent peroxide reductase; catenane 99.76
2lrt_A152 Uncharacterized protein; structural genomics, thio 99.76
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 99.75
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 99.75
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hy 99.75
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 99.75
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, 99.74
1xvq_A175 Thiol peroxidase; thioredoxin fold, structural gen 99.74
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 99.74
2jsy_A167 Probable thiol peroxidase; solution structure, ant 99.74
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 99.74
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 99.74
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 99.74
3keb_A224 Probable thiol peroxidase; structural genomics, AP 99.73
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 99.73
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 99.73
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidor 99.72
2vup_A190 Glutathione peroxidase-like protein; oxidoreductas 99.72
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 99.71
4eo3_A 322 Bacterioferritin comigratory protein/NADH dehydro; 99.71
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 99.71
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 99.71
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 99.71
2k6v_A172 Putative cytochrome C oxidase assembly protein; th 99.7
2f8a_A208 Glutathione peroxidase 1; thioredoxin fold, struct 99.7
2i3y_A215 Epididymal secretory glutathione peroxidase; thior 99.7
4evm_A138 Thioredoxin family protein; structural genomics, n 99.7
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 99.69
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 99.69
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 99.69
2r37_A207 Glutathione peroxidase 3; plasma, structural genom 99.68
2ls5_A159 Uncharacterized protein; structural genomics, unkn 99.51
3raz_A151 Thioredoxin-related protein; structural genomics, 99.68
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 99.67
2hyx_A 352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 99.67
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 99.66
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 99.66
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3 99.66
3me7_A170 Putative uncharacterized protein; electron transfe 99.66
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 99.65
2b7k_A200 SCO1 protein; metallochaperone, cytochrome C oxida 99.64
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 99.64
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 99.64
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 99.61
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 99.6
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 99.58
2lus_A143 Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci 99.34
4hde_A170 SCO1/SENC family lipoprotein; structural genomics, 99.54
4h86_A199 Peroxiredoxin type-2; oxidoreductase; 2.00A {Sacch 98.81
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 98.77
2l57_A126 Uncharacterized protein; structural genomics, unkn 98.72
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 98.68
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 98.55
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 98.54
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 98.42
3f9u_A172 Putative exported cytochrome C biogenesis-related; 98.41
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 98.4
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 98.37
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 98.37
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 98.36
1z6n_A167 Hypothetical protein PA1234; alpha-beta-alpha sand 98.35
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 98.33
2l5l_A136 Thioredoxin; structural genomics, electron transpo 98.32
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 98.31
4euy_A105 Uncharacterized protein; structural genomics, PSI- 98.27
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 98.27
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 98.25
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 98.24
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 98.24
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 98.21
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 98.19
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 98.19
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 98.18
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 98.17
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 98.16
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 98.15
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 98.15
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 98.14
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 98.11
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 98.11
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 98.1
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 98.09
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 98.09
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 98.08
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 98.08
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 98.08
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 98.07
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 98.05
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 98.05
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 98.05
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 98.05
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 98.05
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 98.04
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 98.02
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 98.02
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 98.01
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 98.01
2yzu_A109 Thioredoxin; redox protein, electron transport, st 98.01
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 98.01
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 98.0
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 97.98
1zma_A118 Bacterocin transport accessory protein; alpha-beta 97.97
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 97.97
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 97.97
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 97.97
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 97.97
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 97.96
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 97.96
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 97.96
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 97.96
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 97.2
3gyk_A175 27KDA outer membrane protein; APC61738.2, siliciba 97.95
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 97.94
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 97.94
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 97.93
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 97.91
2kuc_A130 Putative disulphide-isomerase; structural genomics 97.91
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 97.9
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 97.9
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 97.89
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 97.88
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 97.88
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 97.87
3qou_A 287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.85
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 97.82
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 96.99
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 97.78
3ira_A173 Conserved protein; methanosarcina mazei,structural 97.76
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 97.75
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 97.73
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 97.71
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 97.69
3ed3_A 298 Protein disulfide-isomerase MPD1; thioredoxin-like 97.67
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 97.65
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 97.6
1eej_A216 Thiol:disulfide interchange protein; oxidoreductas 97.6
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 97.54
3hd5_A195 Thiol:disulfide interchange protein DSBA; protein 97.52
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 97.51
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 97.48
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 97.48
1wmj_A130 Thioredoxin H-type; structural genomics, program f 97.46
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 97.46
1mek_A120 Protein disulfide isomerase; electron transport, r 97.39
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 97.36
3h93_A192 Thiol:disulfide interchange protein DSBA; disulfid 97.32
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 97.32
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 97.31
2r2j_A 382 Thioredoxin domain-containing protein 4; CRFS moti 97.3
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 97.26
2znm_A195 Thiol:disulfide interchange protein DSBA; thioredo 97.17
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 97.16
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 97.14
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 97.14
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 97.14
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 97.1
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 97.08
1sji_A 350 Calsequestrin 2, calsequestrin, cardiac muscle iso 97.04
2rem_A193 Disulfide oxidoreductase; disulfide oxidoreductase 97.02
1z6m_A175 Conserved hypothetical protein; structural genomic 97.01
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 96.87
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 96.86
1t3b_A211 Thiol:disulfide interchange protein DSBC; oxidored 96.83
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 96.83
3iv4_A112 Putative oxidoreductase; APC23140, meticillin-resi 96.82
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 96.8
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 96.75
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 96.7
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 96.66
3ga4_A178 Dolichyl-diphosphooligosaccharide-protein glycosyl 96.59
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 96.54
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 96.54
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 96.48
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 96.46
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 96.45
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 96.41
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 96.4
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 96.26
2qsi_A137 Putative hydrogenase expression/formation protein; 96.24
3us3_A 367 Calsequestrin-1; calcium-binding protein; 1.74A {O 96.23
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 96.22
1v58_A241 Thiol:disulfide interchange protein DSBG; reduced 96.08
3l78_A120 Regulatory protein SPX; transcription, transcripti 95.69
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 95.66
1ttz_A87 Conserved hypothetical protein; structural genomic 95.48
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 95.27
1kte_A105 Thioltransferase; redox-active center, electron tr 95.25
3fz4_A120 Putative arsenate reductase; APC61768, structural 95.1
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 95.09
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 95.08
3hz8_A193 Thiol:disulfide interchange protein DSBA; thiol-ox 95.04
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 95.04
3gkx_A120 Putative ARSC family related protein; ARSC family 95.03
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 94.99
1z3e_A132 Regulatory protein SPX; bacterial transcription re 94.95
3rdw_A121 Putative arsenate reductase; structural genomics, 94.95
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 94.93
3f0i_A119 Arsenate reductase; structural genomics, IDP01300, 94.91
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 94.88
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 94.87
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 94.69
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 94.65
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 94.59
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 94.57
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 94.51
1s3c_A141 Arsenate reductase; ARSC, arsenite, oxidoreductase 94.51
3l9v_A189 Putative thiol-disulfide isomerase or thioredoxin; 94.23
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 94.2
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 94.1
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 94.03
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 93.93
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 93.85
3uem_A 361 Protein disulfide-isomerase; thioredoxin-like doma 93.75
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 93.51
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 93.37
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 93.34
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 93.08
1un2_A197 DSBA, thiol-disulfide interchange protein; disulfi 93.07
3kp9_A291 Vkorc1/thioredoxin domain protein; warfarin, disul 92.95
2qc7_A240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 92.86
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 92.79
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 92.68
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 92.52
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 92.31
2c0g_A248 ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, 92.28
2kok_A120 Arsenate reductase; brucellosis, zoonotic, oxidore 92.01
1rw1_A114 Conserved hypothetical protein YFFB; thioredoxin f 91.87
3feu_A185 Putative lipoprotein; alpha-beta structure, struct 91.26
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 91.06
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 90.97
3gv1_A147 Disulfide interchange protein; neisseria gonorrhoe 90.63
3gn3_A182 Putative protein-disulfide isomerase; MCSG, PSI, s 88.99
4dvc_A184 Thiol:disulfide interchange protein DSBA; pilus as 88.9
1pn0_A665 Phenol 2-monooxygenase; two dimers, TLS refinement 88.16
3c7m_A195 Thiol:disulfide interchange protein DSBA-like; red 87.93
2wul_A118 Glutaredoxin related protein 5; chromosome 14 open 87.68
3l9s_A191 Thiol:disulfide interchange protein; thioredoxin-f 86.43
3bci_A186 Disulfide bond protein A; thiol-disulfide oxidored 85.99
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 85.5
3tdg_A273 DSBG, putative uncharacterized protein; thioredoxi 84.9
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 83.82
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 83.78
3gha_A202 Disulfide bond formation protein D; BDBD, DSBA-lik 82.33
3f4s_A226 Alpha-DSBA1, putative uncharacterized protein; thi 81.57
3gmf_A205 Protein-disulfide isomerase; oxidoreductase, PSI-2 80.96
>3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A Back     alignment and structure
Probab=99.90  E-value=1.5e-23  Score=172.10  Aligned_cols=108  Identities=16%  Similarity=0.224  Sum_probs=101.6

Q ss_pred             CCccccCcCCCcEEe-cCCCCeEeCCCccCCCeEEEEEEcCCCChhHH-HHHHHHHHhHHHHHhCCCEEEE-EcCCCHHH
Q 027527           67 VSEDTKNLLDTVKVY-DVNGNAIPISDLWKDRKAVVAFARHFGCVLCR-KRADYLAAKKDVMDASGVALVL-IGPGSVEQ  143 (222)
Q Consensus        67 ~~~~~g~~apdf~L~-D~~G~~v~Lsdl~~~~~vvVvF~R~~~Cp~C~-~el~~L~~~~~~l~~~gv~lva-Is~~s~~~  143 (222)
                      ++..+|+++|+|+|. |.+|+.++|+++++++++||+|||+.|||+|+ +|++.|++.+++|++.|+++|+ |+.|+++.
T Consensus        13 ~~~~vG~~aPdf~l~~~~~g~~v~L~d~~~gk~vvL~f~pa~wcp~C~~~e~p~l~~~~~~~~~~gv~vv~~iS~D~~~~   92 (173)
T 3mng_A           13 APIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFV   92 (173)
T ss_dssp             CCCCTTCBCCCCEEECSSTTCEEEHHHHTTTSEEEEEECSCTTCHHHHHTHHHHHHHTHHHHHTTTCCEEEEEESSCHHH
T ss_pred             CCCCCCCCCCCeEeeeCCCCCEEEhHHHhCCCcEEEEEEeCCCCCCCCHHHHHHHHHHHHHHHhCCCEEEEEEcCCCHHH
Confidence            447889999999999 99999999999777888999999999999999 5999999999999999999997 99999999


Q ss_pred             HHHHHHHcCCC--CceeecCChHHHHHcCCccc
Q 027527          144 ARTFSEQTKFK--GEVYADPNHSSYEALSFVSG  174 (222)
Q Consensus       144 i~~f~~~~~~p--fpil~Dpd~~lyk~lGl~~~  174 (222)
                      .++|+++.+++  |++++|+++++.++||+...
T Consensus        93 ~~~f~~~~~~~~~fp~l~D~~~~va~~yGv~~~  125 (173)
T 3mng_A           93 TGEWGRAHKAEGKVRLLADPTGAFGKETDLLLD  125 (173)
T ss_dssp             HHHHHHHTTCTTTCEEEECTTCHHHHHHTCBCC
T ss_pred             HHHHHHHhCCCCceEEEECCChHHHHHhCCCcc
Confidence            99999999998  99999999999999999743



>4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A Back     alignment and structure
>4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A Back     alignment and structure
>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} Back     alignment and structure
>3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A Back     alignment and structure
>2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} Back     alignment and structure
>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 Back     alignment and structure
>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 Back     alignment and structure
>3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Back     alignment and structure
>1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 Back     alignment and structure
>4f82_A Thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} Back     alignment and structure
>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>2xhf_A Peroxiredoxin 5; oxidoreductase, antioxidant enzymes; 1.30A {Alvinella pompejana} Back     alignment and structure
>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A Back     alignment and structure
>1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>1xiy_A Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin fold, peroxiredoxin fold, oxidoreductase; 1.80A {Plasmodium falciparum} SCOP: c.47.1.10 Back     alignment and structure
>3tue_A Tryparedoxin peroxidase; thioredoxin fold, peroxiredoxin, oxidoreductase; 3.00A {Leishmania major} PDB: 1e2y_A Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>4eo3_A Bacterioferritin comigratory protein/NADH dehydro; thioredoxin-fold, alpha-beta-aplha sandwich fold, antioxidan oxidoreductase, FMN binding; HET: FMN; 1.65A {Thermotoga maritima} Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A Back     alignment and structure
>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Back     alignment and structure
>4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} Back     alignment and structure
>4h86_A Peroxiredoxin type-2; oxidoreductase; 2.00A {Saccharomyces cerevisiae} PDB: 4dsq_A 4dsr_A 4dss_A Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} Back     alignment and structure
>1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A Back     alignment and structure
>3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A Back     alignment and structure
>3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A Back     alignment and structure
>3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, ISOM oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} SCOP: c.47.1.0 Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13 Back     alignment and structure
>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Back     alignment and structure
>2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} Back     alignment and structure
>1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 Back     alignment and structure
>3feu_A Putative lipoprotein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Vibrio fischeri} SCOP: c.47.1.0 Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} Back     alignment and structure
>3gn3_A Putative protein-disulfide isomerase; MCSG, PSI, structural GEN protein structure initiative, midwest center for structural genomics; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>4dvc_A Thiol:disulfide interchange protein DSBA; pilus assembly, oxidoreductase, thioredoxin fold, D disulfide bond, DSBB; HET: DMS; 1.20A {Vibrio cholerae} PDB: 2ijy_A 1bed_A Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3c7m_A Thiol:disulfide interchange protein DSBA-like; redox protein, periplasm, redox-active center, oxidoreductase; HET: PGE; 1.55A {Escherichia coli} PDB: 3l9u_A Back     alignment and structure
>2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} Back     alignment and structure
>3l9s_A Thiol:disulfide interchange protein; thioredoxin-fold, DSBA, thiol-disulfide oxidoreductase, DISU bond, redox-active center; 1.58A {Salmonella enterica subsp} SCOP: c.47.1.13 PDB: 1a23_A 1a24_A 1a2j_A 1a2l_A 1a2m_A 1dsb_A 1fvk_A 3dks_A 1bq7_A 1fvj_A 1acv_A 1u3a_A* 1ti1_A* 2hi7_A* 2leg_A* 2zup_A* 3e9j_B* 1ac1_A 2b6m_A 2b3s_A Back     alignment and structure
>3bci_A Disulfide bond protein A; thiol-disulfide oxidoreductase, redox protein, protein folding, redox active centre; 1.81A {Staphylococcus aureus} PDB: 3bd2_A 3bck_A Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3tdg_A DSBG, putative uncharacterized protein; thioredoxin fold, reductase, oxidoreductase; HET: P6G; 2.10A {Helicobacter pylori} Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>3gha_A Disulfide bond formation protein D; BDBD, DSBA-like, TRX-like, oxidoreductase, competence, redox-active center; 1.40A {Bacillus subtilis} PDB: 3eu4_A 3gh9_A 3eu3_A Back     alignment and structure
>3f4s_A Alpha-DSBA1, putative uncharacterized protein; thioredoxin-fold, oxidoreductase; HET: PGE; 1.55A {Wolbachia pipientis} PDB: 3f4r_A* 3f4t_A* Back     alignment and structure
>3gmf_A Protein-disulfide isomerase; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Novosphingobium aromaticivorans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
d2a4va1156 Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c 99.88
d1xvwa1153 Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri 99.86
d2cx4a1160 Bacterioferritin comigratory protein {Archaeon Aer 99.86
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 99.85
d2bmxa1169 Alkyl hydroperoxide reductase AhpC {Mycobacterium 99.84
d1we0a1166 Alkyl hydroperoxide reductase AhpC {Amphibacillus 99.83
d1zofa1170 Thioredoxin reductase TsaA {Helicobacter pylori [T 99.82
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 99.81
d1e2ya_167 Tryparedoxin peroxidase (thioredoxin peroxidase ho 99.8
d1uula_194 Tryparedoxin peroxidase (thioredoxin peroxidase ho 99.79
d1prxa_220 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 99.79
d1qmva_197 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 99.79
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 99.79
d1xcca_219 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [Tax 99.79
d2h01a1170 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 99.78
d1qxha_164 Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 99.77
d1zyea1158 Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ 99.77
d2zcta1237 Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} 99.77
d1n8ja_186 Alkyl hydroperoxide reductase AhpC {Salmonella typ 99.75
d1psqa_163 Probable thiol peroxidase PsaD {Streptococcus pneu 99.72
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 99.72
d1q98a_164 Thiol peroxidase Tpx {Haemophilus influenzae [TaxI 99.71
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 99.69
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 99.69
d1hd2a_161 Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606 99.68
d1xvqa_166 Thiol peroxidase Tpx {Mycobacterium tuberculosis [ 99.68
d1tp9a1162 Plant peroxiredoxin {Western balsam poplar(Populus 99.59
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 99.59
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 99.57
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 99.57
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 99.54
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 99.5
d1xzoa1172 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 99.47
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 99.4
d1nm3a2163 N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus 99.35
d1xiya1179 1-Cys peroxiredoxin {Malaria parasite (Plasmodium 99.31
d2f8aa1184 Glutathione peroxidase {Human (Homo sapiens) [TaxI 99.23
d1wp0a1160 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 98.95
d1z6na1166 Hypothetical protein PA1234 {Pseudomonas aeruginos 98.55
d2b7ka1169 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 98.33
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 98.12
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 97.98
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 97.97
d1sena_135 Thioredoxin-like protein p19, TLP19 {Human (Homo s 97.91
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 97.89
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 97.82
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 97.81
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 97.8
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 97.8
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 97.77
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 97.72
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 97.68
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 97.66
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 97.65
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 97.63
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 97.62
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 97.59
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 97.57
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 97.56
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 97.53
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 97.41
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 97.35
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 97.28
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 97.23
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 97.11
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 97.09
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 97.05
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 96.99
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 96.87
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 96.44
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 95.65
d1wjka_100 Thioredoxin-like structure containing protein C330 95.5
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 95.47
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 95.17
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 95.16
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 93.91
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 93.45
d1pn0a2201 Phenol hydroxylase, C-terminal domain {Soil-living 92.36
d1z6ma1172 Hypothetical protein EF0770 {Enterococcus faecalis 91.92
d1eeja1156 Disulfide bond isomerase, DsbC, C-terminal domain 91.0
d1v58a1169 Thiol:disulfide interchange protein DsbG, C-termin 90.47
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 89.31
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 88.37
d1z3ea1114 Regulatory protein Spx {Bacillus subtilis [TaxId: 87.54
d1t3ba1150 Disulfide bond isomerase, DsbC, C-terminal domain 87.53
d1beda_181 Disulfide-bond formation facilitator (DsbA) {Vibri 87.16
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 84.53
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 83.74
d1fvka_188 Disulfide-bond formation facilitator (DsbA) {Esche 82.81
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 82.41
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 82.33
>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione peroxidase-like
domain: Peroxiredoxin dot5
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.88  E-value=4e-23  Score=164.77  Aligned_cols=109  Identities=11%  Similarity=0.156  Sum_probs=98.1

Q ss_pred             CCCccccCcCCCcEEecCCCCeEeCCCccCCCeEEEEE-EcCCCChhHHHHHHHHHHhHHHHHhCCCEEEEEcCCCHHHH
Q 027527           66 SVSEDTKNLLDTVKVYDVNGNAIPISDLWKDRKAVVAF-ARHFGCVLCRKRADYLAAKKDVMDASGVALVLIGPGSVEQA  144 (222)
Q Consensus        66 ~~~~~~g~~apdf~L~D~~G~~v~Lsdl~~~~~vvVvF-~R~~~Cp~C~~el~~L~~~~~~l~~~gv~lvaIs~~s~~~i  144 (222)
                      +...++|++||+|+|.|.+|+.++|+++.+++++||+| +++.|||.|+++++.|++.+++|++ ++.+++|+.++++.+
T Consensus         2 ~~~L~vG~~aP~f~L~~~~g~~~~l~~~~~k~~~vvlff~p~~~cp~C~~~~~~~~~~~~~~~~-~~~~~~is~d~~~~~   80 (156)
T d2a4va1           2 VNELEIGDPIPDLSLLNEDNDSISLKKITENNRVVVFFVYPRASTPGSTRQASGFRDNYQELKE-YAAVFGLSADSVTSQ   80 (156)
T ss_dssp             TTCCCTTCBCCSCEEECTTSCEEEHHHHHHHCSEEEEEECSSSSSHHHHHHHHHHHHHHHHHTT-TCEEEEEESCCHHHH
T ss_pred             CccCCCCCCCCCeEEECCCCCEEeeHHHcCCccEEEEEecccccCcchhhhhHHHHHHHHHHhh-ccceeeeccchhhhH
Confidence            45678999999999999999999999987666666655 5699999999999999999999965 567899999999999


Q ss_pred             HHHHHHcCCCCceeecCChHHHHHcCCcccc
Q 027527          145 RTFSEQTKFKGEVYADPNHSSYEALSFVSGV  175 (222)
Q Consensus       145 ~~f~~~~~~pfpil~Dpd~~lyk~lGl~~~~  175 (222)
                      ++|+++++++|++++|+++++.++||+....
T Consensus        81 ~~f~~~~~l~f~~L~D~~~~v~~~ygv~~~~  111 (156)
T d2a4va1          81 KKFQSKQNLPYHLLSDPKREFIGLLGAKKTP  111 (156)
T ss_dssp             HHHHHHHTCSSEEEECTTCHHHHHHTCBSSS
T ss_pred             HhhhcccCccceeccchHHHHHHHcCCCccc
Confidence            9999999999999999999999999987654



>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Back     information, alignment and structure
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hd2a_ c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tp9a1 c.47.1.10 (A:1-162) Plant peroxiredoxin {Western balsam poplar(Populus trichocarpa) [TaxId: 3694]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nm3a2 c.47.1.10 (A:3-165) N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xiya1 c.47.1.10 (A:2-180) 1-Cys peroxiredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1pn0a2 c.47.1.10 (A:462-662) Phenol hydroxylase, C-terminal domain {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure