Citrus Sinensis ID: 027566
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 222 | ||||||
| 297733766 | 375 | unnamed protein product [Vitis vinifera] | 0.878 | 0.52 | 0.666 | 7e-72 | |
| 225457005 | 277 | PREDICTED: uncharacterized protein LOC10 | 0.855 | 0.685 | 0.677 | 6e-71 | |
| 224133570 | 285 | predicted protein [Populus trichocarpa] | 0.846 | 0.659 | 0.718 | 2e-68 | |
| 147841526 | 223 | hypothetical protein VITISV_003764 [Viti | 0.666 | 0.663 | 0.837 | 2e-67 | |
| 449469699 | 261 | PREDICTED: F-box protein SKIP16-like [Cu | 0.815 | 0.693 | 0.691 | 4e-66 | |
| 224119374 | 283 | predicted protein [Populus trichocarpa] | 0.648 | 0.508 | 0.833 | 3e-65 | |
| 222630358 | 300 | hypothetical protein OsJ_17287 [Oryza sa | 0.662 | 0.49 | 0.795 | 5e-64 | |
| 115462343 | 300 | Os05g0170800 [Oryza sativa Japonica Grou | 0.662 | 0.49 | 0.795 | 5e-64 | |
| 242089717 | 290 | hypothetical protein SORBIDRAFT_09g00520 | 0.653 | 0.5 | 0.806 | 6e-64 | |
| 169730490 | 300 | SKIP interacting protein 10 [Oryza sativ | 0.662 | 0.49 | 0.795 | 6e-64 |
| >gi|297733766|emb|CBI15013.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 275 bits (704), Expect = 7e-72, Method: Compositional matrix adjust.
Identities = 144/216 (66%), Positives = 162/216 (75%), Gaps = 21/216 (9%)
Query: 19 RRRRCLSYNNSLDLEYGRRR-------------RVGRGCKDLTRTYGIVACVGGGGGGSG 65
R LS+ DL GR R + G C+D R I AC SG
Sbjct: 97 REMHALSFKGFPDLNVGRERSWPGRLYHCTGTRKDGWNCRDFRRNCRIFAC------SSG 150
Query: 66 GGGERLSSSARSFLSRSQAYALLKQQMEVAAKTEDYKEAARIRDSLRSFEEEEPIFRLRR 125
GE S S SFLSRSQ YALLKQQ++VAAK+EDYKEAAR+RDSLR FEEEEP+ RLRR
Sbjct: 151 ANGENQSPS--SFLSRSQTYALLKQQLQVAAKSEDYKEAARLRDSLRLFEEEEPVLRLRR 208
Query: 126 LMKEAVAEERFEDAARYRDKLKEIAPNSLLKCLSDATTLGIRVQVRSVYIEDRSQPLKGQ 185
L+KEAVA+ERFEDAARYRD+LKEIAP+SLLKC SDATT+GIRVQVRSVYIE RSQP KGQ
Sbjct: 209 LIKEAVADERFEDAARYRDELKEIAPHSLLKCSSDATTVGIRVQVRSVYIEGRSQPSKGQ 268
Query: 186 YFFAYRVRITNNSERPVQLLRRHWIITDANGKTENI 221
+FFAYR+RITNNS+RPVQLLRRHWIITDANGK E++
Sbjct: 269 FFFAYRIRITNNSDRPVQLLRRHWIITDANGKIEHV 304
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225457005|ref|XP_002282383.1| PREDICTED: uncharacterized protein LOC100267315 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224133570|ref|XP_002321607.1| predicted protein [Populus trichocarpa] gi|222868603|gb|EEF05734.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147841526|emb|CAN75322.1| hypothetical protein VITISV_003764 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449469699|ref|XP_004152556.1| PREDICTED: F-box protein SKIP16-like [Cucumis sativus] gi|449487861|ref|XP_004157837.1| PREDICTED: F-box protein SKIP16-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224119374|ref|XP_002318056.1| predicted protein [Populus trichocarpa] gi|222858729|gb|EEE96276.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|222630358|gb|EEE62490.1| hypothetical protein OsJ_17287 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|115462343|ref|NP_001054771.1| Os05g0170800 [Oryza sativa Japonica Group] gi|52353765|gb|AAU44331.1| unknown protein [Oryza sativa Japonica Group] gi|113578322|dbj|BAF16685.1| Os05g0170800 [Oryza sativa Japonica Group] gi|125550999|gb|EAY96708.1| hypothetical protein OsI_18629 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|242089717|ref|XP_002440691.1| hypothetical protein SORBIDRAFT_09g005200 [Sorghum bicolor] gi|241945976|gb|EES19121.1| hypothetical protein SORBIDRAFT_09g005200 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|169730490|gb|ACA64811.1| SKIP interacting protein 10 [Oryza sativa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 222 | ||||||
| UNIPROTKB|Q8EB92 | 126 | apaG "Protein ApaG" [Shewanell | 0.252 | 0.444 | 0.5 | 1.2e-10 | |
| TIGR_CMR|SO_3640 | 126 | SO_3640 "apaG protein" [Shewan | 0.252 | 0.444 | 0.5 | 1.2e-10 | |
| UNIPROTKB|Q60C69 | 126 | apaG "Protein ApaG" [Methyloco | 0.256 | 0.452 | 0.473 | 3.2e-10 | |
| UNIPROTKB|Q9KUS3 | 126 | apaG "Protein ApaG" [Vibrio ch | 0.234 | 0.412 | 0.480 | 5.9e-09 | |
| TIGR_CMR|VC_0442 | 126 | VC_0442 "apaG protein" [Vibrio | 0.234 | 0.412 | 0.480 | 5.9e-09 | |
| UNIPROTKB|Q0BYU0 | 138 | apaG "ApaG protein" [Hyphomona | 0.279 | 0.449 | 0.338 | 7.6e-09 | |
| UNIPROTKB|Q2GIY5 | 135 | apaG "ApaG protein" [Anaplasma | 0.301 | 0.496 | 0.376 | 3.4e-07 | |
| TIGR_CMR|APH_1120 | 135 | APH_1120 "apaG protein" [Anapl | 0.301 | 0.496 | 0.376 | 3.4e-07 | |
| UNIPROTKB|Q2GFG4 | 134 | apaG "Protein ApaG" [Ehrlichia | 0.229 | 0.380 | 0.431 | 1.8e-06 | |
| TIGR_CMR|ECH_1033 | 134 | ECH_1033 "apaG protein" [Ehrli | 0.229 | 0.380 | 0.431 | 1.8e-06 |
| UNIPROTKB|Q8EB92 apaG "Protein ApaG" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
Score = 149 (57.5 bits), Expect = 1.2e-10, P = 1.2e-10
Identities = 28/56 (50%), Positives = 38/56 (67%)
Query: 166 IRVQVRSVYIEDRSQPLKGQYFFAYRVRITNNSERPVQLLRRHWIITDANGKTENI 221
IRV+V++ YIE +S P +Y F+Y + I N E+ +L RHWIITDANGKT +
Sbjct: 8 IRVEVKTEYIEQQSSPEDEKYLFSYTITIINLGEQAAKLETRHWIITDANGKTSEV 63
|
|
| TIGR_CMR|SO_3640 SO_3640 "apaG protein" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q60C69 apaG "Protein ApaG" [Methylococcus capsulatus str. Bath (taxid:243233)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KUS3 apaG "Protein ApaG" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_0442 VC_0442 "apaG protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0BYU0 apaG "ApaG protein" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2GIY5 apaG "ApaG protein" [Anaplasma phagocytophilum HZ (taxid:212042)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|APH_1120 APH_1120 "apaG protein" [Anaplasma phagocytophilum HZ (taxid:212042)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2GFG4 apaG "Protein ApaG" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|ECH_1033 ECH_1033 "apaG protein" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 222 | |||
| PRK05461 | 127 | PRK05461, apaG, CO2+/MG2+ efflux protein ApaG; Rev | 9e-32 | |
| COG2967 | 126 | COG2967, ApaG, Uncharacterized protein affecting M | 7e-22 | |
| pfam04379 | 90 | pfam04379, DUF525, Protein of unknown function (DU | 3e-21 | |
| pfam02151 | 36 | pfam02151, UVR, UvrB/uvrC motif | 2e-06 | |
| TIGR00631 | 655 | TIGR00631, uvrb, excinuclease ABC, B subunit | 5e-06 | |
| PRK05298 | 652 | PRK05298, PRK05298, excinuclease ABC subunit B; Pr | 9e-06 | |
| COG0556 | 663 | COG0556, UvrB, Helicase subunit of the DNA excisio | 8e-05 | |
| PRK00558 | 598 | PRK00558, uvrC, excinuclease ABC subunit C; Valida | 1e-04 | |
| PRK00558 | 598 | PRK00558, uvrC, excinuclease ABC subunit C; Valida | 2e-04 | |
| PRK07883 | 557 | PRK07883, PRK07883, hypothetical protein; Validate | 2e-04 | |
| pfam02151 | 36 | pfam02151, UVR, UvrB/uvrC motif | 6e-04 | |
| COG0322 | 581 | COG0322, UvrC, Nuclease subunit of the excinucleas | 0.001 | |
| COG0556 | 663 | COG0556, UvrB, Helicase subunit of the DNA excisio | 0.003 | |
| PRK05298 | 652 | PRK05298, PRK05298, excinuclease ABC subunit B; Pr | 0.004 |
| >gnl|CDD|180098 PRK05461, apaG, CO2+/MG2+ efflux protein ApaG; Reviewed | Back alignment and domain information |
|---|
Score = 112 bits (282), Expect = 9e-32
Identities = 31/61 (50%), Positives = 41/61 (67%)
Query: 159 SDATTLGIRVQVRSVYIEDRSQPLKGQYFFAYRVRITNNSERPVQLLRRHWIITDANGKT 218
A T GI V V+ Y+E++S P +G+Y FAY + I N PVQLL RHW+ITDANG+
Sbjct: 2 YSAVTYGIEVSVQPRYLEEQSDPEEGRYVFAYTITIENLGRVPVQLLSRHWLITDANGRV 61
Query: 219 E 219
+
Sbjct: 62 Q 62
|
Length = 127 |
| >gnl|CDD|225515 COG2967, ApaG, Uncharacterized protein affecting Mg2+/Co2+ transport [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|202989 pfam04379, DUF525, Protein of unknown function (DUF525) | Back alignment and domain information |
|---|
| >gnl|CDD|145355 pfam02151, UVR, UvrB/uvrC motif | Back alignment and domain information |
|---|
| >gnl|CDD|233063 TIGR00631, uvrb, excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235395 PRK05298, PRK05298, excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223630 COG0556, UvrB, Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|234792 PRK00558, uvrC, excinuclease ABC subunit C; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|234792 PRK00558, uvrC, excinuclease ABC subunit C; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236123 PRK07883, PRK07883, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|145355 pfam02151, UVR, UvrB/uvrC motif | Back alignment and domain information |
|---|
| >gnl|CDD|223399 COG0322, UvrC, Nuclease subunit of the excinuclease complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223630 COG0556, UvrB, Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235395 PRK05298, PRK05298, excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| COG2967 | 126 | ApaG Uncharacterized protein affecting Mg2+/Co2+ t | 99.89 | |
| PRK05461 | 127 | apaG CO2+/MG2+ efflux protein ApaG; Reviewed | 99.89 | |
| PF04379 | 90 | DUF525: Protein of unknown function (DUF525); Inte | 99.71 | |
| KOG4408 | 386 | consensus Putative Mg2+ and Co2+ transporter CorD | 99.51 | |
| COG3880 | 176 | Modulator of heat shock repressor CtsR, McsA [Sign | 99.23 | |
| PF02151 | 36 | UVR: UvrB/uvrC motif; InterPro: IPR001943 During t | 98.17 | |
| COG3880 | 176 | Modulator of heat shock repressor CtsR, McsA [Sign | 97.93 | |
| PF02151 | 36 | UVR: UvrB/uvrC motif; InterPro: IPR001943 During t | 97.68 | |
| PRK07883 | 557 | hypothetical protein; Validated | 95.99 | |
| PRK00558 | 598 | uvrC excinuclease ABC subunit C; Validated | 95.93 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 95.75 | |
| PRK14666 | 694 | uvrC excinuclease ABC subunit C; Provisional | 95.69 | |
| PRK12306 | 519 | uvrC excinuclease ABC subunit C; Reviewed | 95.67 | |
| TIGR00194 | 574 | uvrC excinuclease ABC, C subunit. This family cons | 95.56 | |
| PRK14670 | 574 | uvrC excinuclease ABC subunit C; Provisional | 95.54 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 95.53 | |
| PRK14669 | 624 | uvrC excinuclease ABC subunit C; Provisional | 95.47 | |
| PRK14671 | 621 | uvrC excinuclease ABC subunit C; Provisional | 95.46 | |
| PRK14672 | 691 | uvrC excinuclease ABC subunit C; Provisional | 95.42 | |
| PRK14667 | 567 | uvrC excinuclease ABC subunit C; Provisional | 95.35 | |
| PRK14668 | 577 | uvrC excinuclease ABC subunit C; Provisional | 95.32 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 94.91 | |
| COG0322 | 581 | UvrC Nuclease subunit of the excinuclease complex | 94.54 | |
| KOG4825 | 666 | consensus Component of synaptic membrane glycine-, | 94.03 | |
| PF11611 | 123 | DUF4352: Domain of unknown function (DUF4352); Int | 93.45 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 92.36 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 92.04 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 90.74 | |
| PRK07883 | 557 | hypothetical protein; Validated | 90.49 | |
| PRK00558 | 598 | uvrC excinuclease ABC subunit C; Validated | 90.27 | |
| PRK12306 | 519 | uvrC excinuclease ABC subunit C; Reviewed | 87.95 | |
| PRK14666 | 694 | uvrC excinuclease ABC subunit C; Provisional | 87.65 | |
| PF15469 | 182 | Sec5: Exocyst complex component Sec5 | 87.47 | |
| PRK14668 | 577 | uvrC excinuclease ABC subunit C; Provisional | 86.79 | |
| PRK14669 | 624 | uvrC excinuclease ABC subunit C; Provisional | 86.5 | |
| PRK14672 | 691 | uvrC excinuclease ABC subunit C; Provisional | 86.41 | |
| PRK14671 | 621 | uvrC excinuclease ABC subunit C; Provisional | 86.41 | |
| PRK14667 | 567 | uvrC excinuclease ABC subunit C; Provisional | 86.27 | |
| PRK14670 | 574 | uvrC excinuclease ABC subunit C; Provisional | 86.03 | |
| TIGR00194 | 574 | uvrC excinuclease ABC, C subunit. This family cons | 85.56 | |
| PF14263 | 124 | DUF4354: Domain of unknown function (DUF4354); PDB | 84.74 | |
| PF07743 | 78 | HSCB_C: HSCB C-terminal oligomerisation domain; In | 84.11 | |
| COG0322 | 581 | UvrC Nuclease subunit of the excinuclease complex | 83.58 | |
| PF06476 | 115 | DUF1090: Protein of unknown function (DUF1090); In | 80.23 |
| >COG2967 ApaG Uncharacterized protein affecting Mg2+/Co2+ transport [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Probab=99.89 E-value=1.1e-23 Score=170.07 Aligned_cols=62 Identities=47% Similarity=0.784 Sum_probs=60.0
Q ss_pred eeccCCeEEEEEeEEecCcccCCCCceEEEEEEEEEeCCCCCeEEeeceEEEEcCCCcEEec
Q 027566 160 DATTLGIRVQVRSVYIEDRSQPLKGQYFFAYRVRITNNSERPVQLLRRHWIITDANGKTENI 221 (222)
Q Consensus 160 ~a~T~gIkV~V~t~Ylpe~S~P~~~rYvFaY~ItIeN~s~~tVQLlsRhW~ItD~~G~v~eV 221 (222)
.+.|..|.|+|.|.|+|+||+|.+++|+|+|+|||.|+|+.+|||++|||+|||+||+++||
T Consensus 2 ~~~~~~I~V~V~~~yleeQS~P~~~RyvfaYtitI~N~g~~~vqLlsR~W~ITd~~g~v~eV 63 (126)
T COG2967 2 MASSPDIEVQVQPRYLEEQSSPEEERYVFAYTVTIRNLGEVPVQLLSRYWLITDGNGRVTEV 63 (126)
T ss_pred CcccCceEEEEeeEEccccCCcccceEEEEEEEEEecCCCccceeeeeEEEEecCCCcEEEE
Confidence 35788999999999999999999999999999999999999999999999999999999998
|
|
| >PRK05461 apaG CO2+/MG2+ efflux protein ApaG; Reviewed | Back alignment and domain information |
|---|
| >PF04379 DUF525: Protein of unknown function (DUF525); InterPro: IPR007474 This domain is found in the bacterial protein ApaG and at the C termini of some F-box proteins (IPR001810 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG4408 consensus Putative Mg2+ and Co2+ transporter CorD [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3880 Modulator of heat shock repressor CtsR, McsA [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF02151 UVR: UvrB/uvrC motif; InterPro: IPR001943 During the process of Escherichia coli nucleotide excision repair, DNA damage recognition and processing are achieved by the action of the uvrA, uvrB, and uvrC gene products [] | Back alignment and domain information |
|---|
| >COG3880 Modulator of heat shock repressor CtsR, McsA [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF02151 UVR: UvrB/uvrC motif; InterPro: IPR001943 During the process of Escherichia coli nucleotide excision repair, DNA damage recognition and processing are achieved by the action of the uvrA, uvrB, and uvrC gene products [] | Back alignment and domain information |
|---|
| >PRK07883 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK00558 uvrC excinuclease ABC subunit C; Validated | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK14666 uvrC excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >PRK12306 uvrC excinuclease ABC subunit C; Reviewed | Back alignment and domain information |
|---|
| >TIGR00194 uvrC excinuclease ABC, C subunit | Back alignment and domain information |
|---|
| >PRK14670 uvrC excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >PRK14669 uvrC excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >PRK14671 uvrC excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >PRK14672 uvrC excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >PRK14667 uvrC excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >PRK14668 uvrC excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG0322 UvrC Nuclease subunit of the excinuclease complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG4825 consensus Component of synaptic membrane glycine-, glutamate- and thienylcyclohexylpiperidine-binding glycoprotein (43kDa) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF11611 DUF4352: Domain of unknown function (DUF4352); InterPro: IPR021652 This entry is represented by Bacteriophage A118, Gp32 | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK07883 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK00558 uvrC excinuclease ABC subunit C; Validated | Back alignment and domain information |
|---|
| >PRK12306 uvrC excinuclease ABC subunit C; Reviewed | Back alignment and domain information |
|---|
| >PRK14666 uvrC excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >PF15469 Sec5: Exocyst complex component Sec5 | Back alignment and domain information |
|---|
| >PRK14668 uvrC excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >PRK14669 uvrC excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >PRK14672 uvrC excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >PRK14671 uvrC excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >PRK14667 uvrC excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >PRK14670 uvrC excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >TIGR00194 uvrC excinuclease ABC, C subunit | Back alignment and domain information |
|---|
| >PF14263 DUF4354: Domain of unknown function (DUF4354); PDB: 3NRF_B 3SB3_A | Back alignment and domain information |
|---|
| >PF07743 HSCB_C: HSCB C-terminal oligomerisation domain; InterPro: IPR009073 This entry represents the C-terminal oligomerisation domain found in HscB (heat shock cognate protein B), which is also known as HSC20 (20K heat shock cognate protein) | Back alignment and domain information |
|---|
| >COG0322 UvrC Nuclease subunit of the excinuclease complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF06476 DUF1090: Protein of unknown function (DUF1090); InterPro: IPR009468 This family consists of several bacterial proteins of unknown function and is known as YqjC in Escherichia coli | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 222 | ||||
| 1tza_A | 134 | X-Ray Structure Of Northeast Structural Genomics Co | 9e-11 | ||
| 1xq4_A | 139 | Crystal Structure Of The Putative Apaa Protein From | 2e-09 | ||
| 2f1e_A | 127 | Solution Structure Of Apag Protein Length = 127 | 4e-09 | ||
| 1xvs_A | 126 | Crystal Structure Of Apag Protein From Vibrio Chole | 3e-08 |
| >pdb|1TZA|A Chain A, X-Ray Structure Of Northeast Structural Genomics Consortium Target Sor45 Length = 134 | Back alignment and structure |
|
| >pdb|1XQ4|A Chain A, Crystal Structure Of The Putative Apaa Protein From Bordetella Pertussis, Northeast Structural Genomics Target Ber40 Length = 139 | Back alignment and structure |
| >pdb|2F1E|A Chain A, Solution Structure Of Apag Protein Length = 127 | Back alignment and structure |
| >pdb|1XVS|A Chain A, Crystal Structure Of Apag Protein From Vibrio Cholerae Length = 126 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 222 | |||
| 1xvs_A | 126 | Protein APAG; MCSG APC26324, midwest center for st | 4e-27 | |
| 1xq4_A | 139 | Protein APAG; all beta protein, structural genomic | 8e-27 | |
| 2f1e_A | 127 | Protein APAG; APAG protein, xanthomonas axonopodis | 1e-26 | |
| 1tza_A | 134 | APAG protein, SOR45; structural genomics, PSI, pro | 2e-26 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-07 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 7e-06 | |
| 1e52_A | 63 | Excinuclease ABC subunit; DNA excision repair, UVR | 4e-05 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 2e-04 |
| >1xvs_A Protein APAG; MCSG APC26324, midwest center for structural genomics, structure initiative, PSI, structural genomics, unknown FUN; 2.01A {Vibrio cholerae} SCOP: b.1.23.1 Length = 126 | Back alignment and structure |
|---|
Score = 99.5 bits (248), Expect = 4e-27
Identities = 26/62 (41%), Positives = 41/62 (66%)
Query: 160 DATTLGIRVQVRSVYIEDRSQPLKGQYFFAYRVRITNNSERPVQLLRRHWIITDANGKTE 219
D + I++QV++ YIE++S P ++ FAY + I N S + VQL+ R W+ITDA+GK
Sbjct: 2 DVSLPCIKIQVQTRYIEEQSNPEYQRFVFAYLITIKNLSSQTVQLMSRRWLITDADGKQT 61
Query: 220 NI 221
+
Sbjct: 62 VV 63
|
| >1xq4_A Protein APAG; all beta protein, structural genomics, protein structure initiative, PSI, northeast structural genomics consortium, NESG; 2.70A {Bordetella pertussis} SCOP: b.1.23.1 Length = 139 | Back alignment and structure |
|---|
| >2f1e_A Protein APAG; APAG protein, xanthomonas axonopodis PV.citri, structural genomics, unknown function; NMR {Xanthomonas axonopodis PV} Length = 127 | Back alignment and structure |
|---|
| >1tza_A APAG protein, SOR45; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG, unknown function; 2.40A {Shewanella oneidensis} SCOP: b.1.23.1 Length = 134 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Length = 661 | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Length = 664 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| 2f1e_A | 127 | Protein APAG; APAG protein, xanthomonas axonopodis | 99.91 | |
| 1xvs_A | 126 | Protein APAG; MCSG APC26324, midwest center for st | 99.9 | |
| 1tza_A | 134 | APAG protein, SOR45; structural genomics, PSI, pro | 99.89 | |
| 1xq4_A | 139 | Protein APAG; all beta protein, structural genomic | 99.89 | |
| 1e52_A | 63 | Excinuclease ABC subunit; DNA excision repair, UVR | 97.88 | |
| 1e52_A | 63 | Excinuclease ABC subunit; DNA excision repair, UVR | 97.21 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 96.59 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 95.74 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 94.86 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 92.97 | |
| 3cfu_A | 159 | Uncharacterized lipoprotein YJHA; YJHA_bacsu, SR56 | 88.48 | |
| 3nrf_A | 106 | APAG protein; structural genomics, joint center fo | 87.37 |
| >2f1e_A Protein APAG; APAG protein, xanthomonas axonopodis PV.citri, structural genomics, unknown function; NMR {Xanthomonas axonopodis PV} | Back alignment and structure |
|---|
Probab=99.91 E-value=1.7e-24 Score=174.49 Aligned_cols=63 Identities=40% Similarity=0.777 Sum_probs=58.4
Q ss_pred eeeccCCeEEEEEeEEecCcccCCCCceEEEEEEEEEeCCCCCeEEeeceEEEEcCCCcEEec
Q 027566 159 SDATTLGIRVQVRSVYIEDRSQPLKGQYFFAYRVRITNNSERPVQLLRRHWIITDANGKTENI 221 (222)
Q Consensus 159 s~a~T~gIkV~V~t~Ylpe~S~P~~~rYvFaY~ItIeN~s~~tVQLlsRhW~ItD~~G~v~eV 221 (222)
++++|+||+|+|.|.|+|++|+|.+++|+|+|+|||+|.++.+|||++|||+|+|++|+++||
T Consensus 2 ~~~~t~~I~V~V~~~y~~e~S~p~~~~y~faY~I~I~N~~~~~vQL~sRhW~Itd~~g~~~eV 64 (127)
T 2f1e_A 2 QDDPRYRVEVEVSPRFLAHQSTPDEGRYAFAYSIRIQNAGAVPARLVARHWQITDGNGRTEQV 64 (127)
T ss_dssp ----CCCEEEEEEEEECSTTCBGGGTBEEEEEEEEEEECSSSCEEEEEEEEEEEETTSCEEEE
T ss_pred ccceECCEEEEEEEEEchhhCCCcCCEEEEEEEEEEEeCCCCCEEEEeceEEEEeCCCCEEEE
Confidence 468899999999999999999999999999999999999999999999999999999999997
|
| >1xvs_A Protein APAG; MCSG APC26324, midwest center for structural genomics, structure initiative, PSI, structural genomics, unknown FUN; 2.01A {Vibrio cholerae} SCOP: b.1.23.1 | Back alignment and structure |
|---|
| >1tza_A APAG protein, SOR45; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG, unknown function; 2.40A {Shewanella oneidensis} SCOP: b.1.23.1 | Back alignment and structure |
|---|
| >1xq4_A Protein APAG; all beta protein, structural genomics, protein structure initiative, PSI, northeast structural genomics consortium, NESG; 2.70A {Bordetella pertussis} SCOP: b.1.23.1 | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >3cfu_A Uncharacterized lipoprotein YJHA; YJHA_bacsu, SR562, NESG, structural genomics, PSI-2, protein structure initiative; 2.40A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3nrf_A APAG protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; 1.50A {Pseudomonas aeruginosa} PDB: 3sb3_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 222 | ||||
| d1xvsa_ | 124 | b.1.23.1 (A:) ApaG {Vibrio cholerae [TaxId: 666]} | 2e-28 | |
| d1tzaa_ | 132 | b.1.23.1 (A:) ApaG {Shewanella oneidensis [TaxId: | 2e-27 | |
| d1xq4a_ | 123 | b.1.23.1 (A:) ApaG {Bordetella pertussis [TaxId: 5 | 7e-26 | |
| d1e52a_ | 56 | a.2.9.1 (A:) C-terminal UvrC-binding domain of Uvr | 2e-05 | |
| d1e52a_ | 56 | a.2.9.1 (A:) C-terminal UvrC-binding domain of Uvr | 8e-05 |
| >d1xvsa_ b.1.23.1 (A:) ApaG {Vibrio cholerae [TaxId: 666]} Length = 124 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: ApaG-like family: ApaG-like domain: ApaG species: Vibrio cholerae [TaxId: 666]
Score = 101 bits (254), Expect = 2e-28
Identities = 26/62 (41%), Positives = 41/62 (66%)
Query: 160 DATTLGIRVQVRSVYIEDRSQPLKGQYFFAYRVRITNNSERPVQLLRRHWIITDANGKTE 219
D + I++QV++ YIE++S P ++ FAY + I N S + VQL+ R W+ITDA+GK
Sbjct: 2 DVSLPCIKIQVQTRYIEEQSNPEYQRFVFAYLITIKNLSSQTVQLMSRRWLITDADGKQT 61
Query: 220 NI 221
+
Sbjct: 62 VV 63
|
| >d1tzaa_ b.1.23.1 (A:) ApaG {Shewanella oneidensis [TaxId: 70863]} Length = 132 | Back information, alignment and structure |
|---|
| >d1xq4a_ b.1.23.1 (A:) ApaG {Bordetella pertussis [TaxId: 520]} Length = 123 | Back information, alignment and structure |
|---|
| >d1e52a_ a.2.9.1 (A:) C-terminal UvrC-binding domain of UvrB {Escherichia coli [TaxId: 562]} Length = 56 | Back information, alignment and structure |
|---|
| >d1e52a_ a.2.9.1 (A:) C-terminal UvrC-binding domain of UvrB {Escherichia coli [TaxId: 562]} Length = 56 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| d1tzaa_ | 132 | ApaG {Shewanella oneidensis [TaxId: 70863]} | 99.89 | |
| d1xvsa_ | 124 | ApaG {Vibrio cholerae [TaxId: 666]} | 99.88 | |
| d1xq4a_ | 123 | ApaG {Bordetella pertussis [TaxId: 520]} | 99.85 | |
| d1e52a_ | 56 | C-terminal UvrC-binding domain of UvrB {Escherichi | 97.82 | |
| d1e52a_ | 56 | C-terminal UvrC-binding domain of UvrB {Escherichi | 97.32 | |
| d1fpoa2 | 95 | HSC20 (HSCB), C-terminal oligomerisation domain {E | 86.04 | |
| d2fzta1 | 78 | Hypothetical protein TM0693 {Thermotoga maritima [ | 82.21 |
| >d1tzaa_ b.1.23.1 (A:) ApaG {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: ApaG-like family: ApaG-like domain: ApaG species: Shewanella oneidensis [TaxId: 70863]
Probab=99.89 E-value=9.3e-24 Score=169.48 Aligned_cols=61 Identities=48% Similarity=0.809 Sum_probs=59.6
Q ss_pred eccCCeEEEEEeEEecCcccCCCCceEEEEEEEEEeCCCCCeEEeeceEEEEcCCCcEEec
Q 027566 161 ATTLGIRVQVRSVYIEDRSQPLKGQYFFAYRVRITNNSERPVQLLRRHWIITDANGKTENI 221 (222)
Q Consensus 161 a~T~gIkV~V~t~Ylpe~S~P~~~rYvFaY~ItIeN~s~~tVQLlsRhW~ItD~~G~v~eV 221 (222)
|+|+||+|+|.|.|+|++|+|.+.+|+|+|+|||+|.++.+|||++|||+|+|++|++++|
T Consensus 1 a~t~gI~V~V~t~y~~e~S~p~~~~y~F~Y~ItI~N~~~~~vQLlsR~W~I~d~~G~~~eV 61 (132)
T d1tzaa_ 1 ALDNSIRVEVKTEYIEQQSSPEDEKYLFSYTITIINLGEQAAKLETRHWIITDANGKTSEV 61 (132)
T ss_dssp CGGGTEEEEEEEEEEEECCBTTBCCEEEEEEEEEEECSSSCEEEEEEEEEEEETTSCEEEE
T ss_pred CccCCEEEEEEEEEchhcCCCCCCeEEEEEEEEEEeCCCCCEEEEeeEEEEECCCCCEEEE
Confidence 5799999999999999999999999999999999999999999999999999999999987
|
| >d1xvsa_ b.1.23.1 (A:) ApaG {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1xq4a_ b.1.23.1 (A:) ApaG {Bordetella pertussis [TaxId: 520]} | Back information, alignment and structure |
|---|
| >d1e52a_ a.2.9.1 (A:) C-terminal UvrC-binding domain of UvrB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e52a_ a.2.9.1 (A:) C-terminal UvrC-binding domain of UvrB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fpoa2 a.23.1.1 (A:77-171) HSC20 (HSCB), C-terminal oligomerisation domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fzta1 a.46.3.1 (A:1-78) Hypothetical protein TM0693 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|