Citrus Sinensis ID: 027566


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MHAFNLSSINVSTEFNATRRRRCLSYNNSLDLEYGRRRRVGRGCKDLTRTYGIVACVGGGGGGSGGGGERLSSSARSFLSRSQAYALLKQQMEVAAKTEDYKEAARIRDSLRSFEEEEPIFRLRRLMKEAVAEERFEDAARYRDKLKEIAPNSLLKCLSDATTLGIRVQVRSVYIEDRSQPLKGQYFFAYRVRITNNSERPVQLLRRHWIITDANGKTENIL
ccccccccccEEEccccccccEEEccccccccccccccccccccccccccccEEEEEccccccccccccccccccccHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEEEEccccccccccEEEEEEEEEEEcccccEEEcccEEEEEcccccEEEEc
cccccHcHcEEEEccccccccEccccccccccccccHHEccccccccEEccEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHccccccccEEEEEEEEEcccccccccccEEEEEEEEEEEcccccEEEEEEEEEEEcccccEEEEc
mhafnlssinvstefnatRRRRCLSYnnsldleygrrrrvgrgckdlTRTYGIVacvggggggsggggerlsSSARSFLSRSQAYALLKQQMEVAAKTEDYKEAARIRDSLRSFEEEEPIFRLRRLMKEAVAEERFEDAARYRDKLkeiapnsllKCLSDATTLGIRVQVRSVYiedrsqplkgqyFFAYRVRITNNSERPVQLLRRHWiitdangktenil
mhafnlssinvstefnatrrrrclsynnsldleygrrrrvgrgckdltrTYGIVACVGGGGGGSGGGGERLSSSARSFLSRSQAYALLKQQMEVAAKTEDYKEAARirdslrsfeeeepifrlRRLMKEAVAEERFEDAARYRDKlkeiapnsllkclsdattlgirVQVRsvyiedrsqplkgqyfFAYRVRitnnserpvqllrrhwiitdangktenil
MHAFNLSSINVSTEFNATRRRRCLSYNNSLDLEYGRRRRVGRGCKDLTRTYGIVACVggggggsggggErlsssarsflsrsQAYALLKQQMEVAAKTEDYKEAARIRDSLRSFEEEEPIFRLRRLMKEAVAEERFEDAARYRDKLKEIAPNSLLKCLSDATTLGIRVQVRSVYIEDRSQPLKGQYFFAYRVRITNNSERPVQLLRRHWIITDANGKTENIL
************TEFNATRRRRCLSYNNSLDLEYGRRRRVGRGCKDLTRTYGIVAC***************************************************************IFRLRRLMKEAVAEERFEDAARYRDKLKEIAPNSLLKCLSDATTLGIRVQVRSVYIEDRSQPLKGQYFFAYRVRITNNSERPVQLLRRHWIITD*********
**************FNATRRRRCLSYNNSLDL***************TRTYGIVACV****************SARSFLSRSQAYALLKQQMEVAAKTEDYKEAARIRDSLRSFEEEEPIFRLRRLMKEAVAEERFED*********************DATTLGIRVQVRSVYIEDRSQPLKGQYFFAYRVRITNNSERPVQLLRRHWIITDANG*T**I*
MHAFNLSSINVSTEFNATRRRRCLSYNNSLDLEYGRRRRVGRGCKDLTRTYGIVACVGGG*****************FLSRSQAYALLKQQMEVAAKTEDYKEAARIRDSLRSFEEEEPIFRLRRLMKEAVAEERFEDAARYRDKLKEIAPNSLLKCLSDATTLGIRVQVRSVYIEDRSQPLKGQYFFAYRVRITNNSERPVQLLRRHWIITDANGKTENIL
****NLSSINVSTEFNATRRRRCLSYNNSLDLEYGRRRRVGRGCKDLTRTYGIVACVG*********************SRSQAYALLKQQMEVAAKTEDYKEAARIRDSLRSFEEEEPIFRLRRLMKEAVAEERFEDAARYRDKLKEIAPNSLLKCLSDATTLGIRVQVRSVYIEDRSQPLKGQYFFAYRVRITNNSERPVQLLRRHWIITDANGKTENIL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHAFNLSSINVSTEFNATRRRRCLSYNNSLDLEYGRRRRVGRGCKDLTRTYGIVACVGGGGGGSGGGGERLSSSARSFLSRSQAYALLKQQMEVAAKTEDYKEAARIRDSLRSFEEEEPIFRLRRLMKEAVAEERFEDAARYRDKLKEIAPNSLLKCLSDATTLGIRVQVRSVYIEDRSQPLKGQYFFAYRVRITNNSERPVQLLRRHWIITDANGKTENIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query222 2.2.26 [Sep-21-2011]
Q2IGT4125 Protein ApaG OS=Anaeromyx yes no 0.283 0.504 0.492 6e-12
Q0ASF3130 Protein ApaG OS=Maricauli yes no 0.265 0.453 0.457 2e-11
Q2VZE7130 Protein ApaG OS=Magnetosp yes no 0.270 0.461 0.5 3e-11
B4UHA8125 Protein ApaG OS=Anaeromyx yes no 0.283 0.504 0.492 1e-10
Q6MK56127 Protein ApaG OS=Bdellovib no no 0.252 0.440 0.446 1e-10
A6WVX4130 Protein ApaG OS=Ochrobact yes no 0.274 0.469 0.491 3e-10
B7VIE1126 Protein ApaG OS=Vibrio sp yes no 0.261 0.460 0.517 4e-10
B8JAJ1125 Protein ApaG OS=Anaeromyx yes no 0.283 0.504 0.476 6e-10
Q8EB92126 Protein ApaG OS=Shewanell yes no 0.252 0.444 0.5 7e-10
Q8G2L5130 Protein ApaG OS=Brucella yes no 0.288 0.492 0.453 1e-09
>sp|Q2IGT4|APAG_ANADE Protein ApaG OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=apaG PE=3 SV=1 Back     alignment and function desciption
 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 44/65 (67%), Gaps = 2/65 (3%)

Query: 158 LSDATTLGIRVQVRSVYIEDRSQPLKGQYFFAYRVRITNNSERPVQLLRRHWIITDANGK 217
           +S A T GI V VRS +  +RS+P  G++ F+Y VR+ N  E P QL+ RHWII DANG+
Sbjct: 1   MSTAVTEGIEVTVRSTFRPERSEP--GRFLFSYSVRVVNQGEAPAQLVSRHWIIVDANGE 58

Query: 218 TENIL 222
            E ++
Sbjct: 59  REEVV 63





Anaeromyxobacter dehalogenans (strain 2CP-C) (taxid: 290397)
>sp|Q0ASF3|APAG_MARMM Protein ApaG OS=Maricaulis maris (strain MCS10) GN=apaG PE=3 SV=1 Back     alignment and function description
>sp|Q2VZE7|APAG_MAGSA Protein ApaG OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=apaG PE=3 SV=1 Back     alignment and function description
>sp|B4UHA8|APAG_ANASK Protein ApaG OS=Anaeromyxobacter sp. (strain K) GN=apaG PE=3 SV=1 Back     alignment and function description
>sp|Q6MK56|APAG_BDEBA Protein ApaG OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=apaG PE=3 SV=2 Back     alignment and function description
>sp|A6WVX4|APAG_OCHA4 Protein ApaG OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=apaG PE=3 SV=1 Back     alignment and function description
>sp|B7VIE1|APAG_VIBSL Protein ApaG OS=Vibrio splendidus (strain LGP32) GN=apaG PE=3 SV=1 Back     alignment and function description
>sp|B8JAJ1|APAG_ANAD2 Protein ApaG OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=apaG PE=3 SV=1 Back     alignment and function description
>sp|Q8EB92|APAG_SHEON Protein ApaG OS=Shewanella oneidensis (strain MR-1) GN=apaG PE=1 SV=1 Back     alignment and function description
>sp|Q8G2L5|APAG_BRUSU Protein ApaG OS=Brucella suis biovar 1 (strain 1330) GN=apaG PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
297733766 375 unnamed protein product [Vitis vinifera] 0.878 0.52 0.666 7e-72
225457005277 PREDICTED: uncharacterized protein LOC10 0.855 0.685 0.677 6e-71
224133570285 predicted protein [Populus trichocarpa] 0.846 0.659 0.718 2e-68
147841526223 hypothetical protein VITISV_003764 [Viti 0.666 0.663 0.837 2e-67
449469699261 PREDICTED: F-box protein SKIP16-like [Cu 0.815 0.693 0.691 4e-66
224119374283 predicted protein [Populus trichocarpa] 0.648 0.508 0.833 3e-65
222630358300 hypothetical protein OsJ_17287 [Oryza sa 0.662 0.49 0.795 5e-64
115462343300 Os05g0170800 [Oryza sativa Japonica Grou 0.662 0.49 0.795 5e-64
242089717290 hypothetical protein SORBIDRAFT_09g00520 0.653 0.5 0.806 6e-64
169730490300 SKIP interacting protein 10 [Oryza sativ 0.662 0.49 0.795 6e-64
>gi|297733766|emb|CBI15013.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  275 bits (704), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 144/216 (66%), Positives = 162/216 (75%), Gaps = 21/216 (9%)

Query: 19  RRRRCLSYNNSLDLEYGRRR-------------RVGRGCKDLTRTYGIVACVGGGGGGSG 65
           R    LS+    DL  GR R             + G  C+D  R   I AC       SG
Sbjct: 97  REMHALSFKGFPDLNVGRERSWPGRLYHCTGTRKDGWNCRDFRRNCRIFAC------SSG 150

Query: 66  GGGERLSSSARSFLSRSQAYALLKQQMEVAAKTEDYKEAARIRDSLRSFEEEEPIFRLRR 125
             GE  S S  SFLSRSQ YALLKQQ++VAAK+EDYKEAAR+RDSLR FEEEEP+ RLRR
Sbjct: 151 ANGENQSPS--SFLSRSQTYALLKQQLQVAAKSEDYKEAARLRDSLRLFEEEEPVLRLRR 208

Query: 126 LMKEAVAEERFEDAARYRDKLKEIAPNSLLKCLSDATTLGIRVQVRSVYIEDRSQPLKGQ 185
           L+KEAVA+ERFEDAARYRD+LKEIAP+SLLKC SDATT+GIRVQVRSVYIE RSQP KGQ
Sbjct: 209 LIKEAVADERFEDAARYRDELKEIAPHSLLKCSSDATTVGIRVQVRSVYIEGRSQPSKGQ 268

Query: 186 YFFAYRVRITNNSERPVQLLRRHWIITDANGKTENI 221
           +FFAYR+RITNNS+RPVQLLRRHWIITDANGK E++
Sbjct: 269 FFFAYRIRITNNSDRPVQLLRRHWIITDANGKIEHV 304




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225457005|ref|XP_002282383.1| PREDICTED: uncharacterized protein LOC100267315 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224133570|ref|XP_002321607.1| predicted protein [Populus trichocarpa] gi|222868603|gb|EEF05734.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147841526|emb|CAN75322.1| hypothetical protein VITISV_003764 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449469699|ref|XP_004152556.1| PREDICTED: F-box protein SKIP16-like [Cucumis sativus] gi|449487861|ref|XP_004157837.1| PREDICTED: F-box protein SKIP16-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224119374|ref|XP_002318056.1| predicted protein [Populus trichocarpa] gi|222858729|gb|EEE96276.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|222630358|gb|EEE62490.1| hypothetical protein OsJ_17287 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|115462343|ref|NP_001054771.1| Os05g0170800 [Oryza sativa Japonica Group] gi|52353765|gb|AAU44331.1| unknown protein [Oryza sativa Japonica Group] gi|113578322|dbj|BAF16685.1| Os05g0170800 [Oryza sativa Japonica Group] gi|125550999|gb|EAY96708.1| hypothetical protein OsI_18629 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|242089717|ref|XP_002440691.1| hypothetical protein SORBIDRAFT_09g005200 [Sorghum bicolor] gi|241945976|gb|EES19121.1| hypothetical protein SORBIDRAFT_09g005200 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|169730490|gb|ACA64811.1| SKIP interacting protein 10 [Oryza sativa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
UNIPROTKB|Q8EB92126 apaG "Protein ApaG" [Shewanell 0.252 0.444 0.5 1.2e-10
TIGR_CMR|SO_3640126 SO_3640 "apaG protein" [Shewan 0.252 0.444 0.5 1.2e-10
UNIPROTKB|Q60C69126 apaG "Protein ApaG" [Methyloco 0.256 0.452 0.473 3.2e-10
UNIPROTKB|Q9KUS3126 apaG "Protein ApaG" [Vibrio ch 0.234 0.412 0.480 5.9e-09
TIGR_CMR|VC_0442126 VC_0442 "apaG protein" [Vibrio 0.234 0.412 0.480 5.9e-09
UNIPROTKB|Q0BYU0138 apaG "ApaG protein" [Hyphomona 0.279 0.449 0.338 7.6e-09
UNIPROTKB|Q2GIY5135 apaG "ApaG protein" [Anaplasma 0.301 0.496 0.376 3.4e-07
TIGR_CMR|APH_1120135 APH_1120 "apaG protein" [Anapl 0.301 0.496 0.376 3.4e-07
UNIPROTKB|Q2GFG4134 apaG "Protein ApaG" [Ehrlichia 0.229 0.380 0.431 1.8e-06
TIGR_CMR|ECH_1033134 ECH_1033 "apaG protein" [Ehrli 0.229 0.380 0.431 1.8e-06
UNIPROTKB|Q8EB92 apaG "Protein ApaG" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
 Score = 149 (57.5 bits), Expect = 1.2e-10, P = 1.2e-10
 Identities = 28/56 (50%), Positives = 38/56 (67%)

Query:   166 IRVQVRSVYIEDRSQPLKGQYFFAYRVRITNNSERPVQLLRRHWIITDANGKTENI 221
             IRV+V++ YIE +S P   +Y F+Y + I N  E+  +L  RHWIITDANGKT  +
Sbjct:     8 IRVEVKTEYIEQQSSPEDEKYLFSYTITIINLGEQAAKLETRHWIITDANGKTSEV 63




GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
TIGR_CMR|SO_3640 SO_3640 "apaG protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q60C69 apaG "Protein ApaG" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KUS3 apaG "Protein ApaG" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0442 VC_0442 "apaG protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|Q0BYU0 apaG "ApaG protein" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
UNIPROTKB|Q2GIY5 apaG "ApaG protein" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms
TIGR_CMR|APH_1120 APH_1120 "apaG protein" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms
UNIPROTKB|Q2GFG4 apaG "Protein ApaG" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_1033 ECH_1033 "apaG protein" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
PRK05461127 PRK05461, apaG, CO2+/MG2+ efflux protein ApaG; Rev 9e-32
COG2967126 COG2967, ApaG, Uncharacterized protein affecting M 7e-22
pfam0437990 pfam04379, DUF525, Protein of unknown function (DU 3e-21
pfam0215136 pfam02151, UVR, UvrB/uvrC motif 2e-06
TIGR00631655 TIGR00631, uvrb, excinuclease ABC, B subunit 5e-06
PRK05298652 PRK05298, PRK05298, excinuclease ABC subunit B; Pr 9e-06
COG0556663 COG0556, UvrB, Helicase subunit of the DNA excisio 8e-05
PRK00558 598 PRK00558, uvrC, excinuclease ABC subunit C; Valida 1e-04
PRK00558 598 PRK00558, uvrC, excinuclease ABC subunit C; Valida 2e-04
PRK07883557 PRK07883, PRK07883, hypothetical protein; Validate 2e-04
pfam0215136 pfam02151, UVR, UvrB/uvrC motif 6e-04
COG0322 581 COG0322, UvrC, Nuclease subunit of the excinucleas 0.001
COG0556663 COG0556, UvrB, Helicase subunit of the DNA excisio 0.003
PRK05298652 PRK05298, PRK05298, excinuclease ABC subunit B; Pr 0.004
>gnl|CDD|180098 PRK05461, apaG, CO2+/MG2+ efflux protein ApaG; Reviewed Back     alignment and domain information
 Score =  112 bits (282), Expect = 9e-32
 Identities = 31/61 (50%), Positives = 41/61 (67%)

Query: 159 SDATTLGIRVQVRSVYIEDRSQPLKGQYFFAYRVRITNNSERPVQLLRRHWIITDANGKT 218
             A T GI V V+  Y+E++S P +G+Y FAY + I N    PVQLL RHW+ITDANG+ 
Sbjct: 2   YSAVTYGIEVSVQPRYLEEQSDPEEGRYVFAYTITIENLGRVPVQLLSRHWLITDANGRV 61

Query: 219 E 219
           +
Sbjct: 62  Q 62


Length = 127

>gnl|CDD|225515 COG2967, ApaG, Uncharacterized protein affecting Mg2+/Co2+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|202989 pfam04379, DUF525, Protein of unknown function (DUF525) Back     alignment and domain information
>gnl|CDD|145355 pfam02151, UVR, UvrB/uvrC motif Back     alignment and domain information
>gnl|CDD|233063 TIGR00631, uvrb, excinuclease ABC, B subunit Back     alignment and domain information
>gnl|CDD|235395 PRK05298, PRK05298, excinuclease ABC subunit B; Provisional Back     alignment and domain information
>gnl|CDD|223630 COG0556, UvrB, Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|234792 PRK00558, uvrC, excinuclease ABC subunit C; Validated Back     alignment and domain information
>gnl|CDD|234792 PRK00558, uvrC, excinuclease ABC subunit C; Validated Back     alignment and domain information
>gnl|CDD|236123 PRK07883, PRK07883, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|145355 pfam02151, UVR, UvrB/uvrC motif Back     alignment and domain information
>gnl|CDD|223399 COG0322, UvrC, Nuclease subunit of the excinuclease complex [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223630 COG0556, UvrB, Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|235395 PRK05298, PRK05298, excinuclease ABC subunit B; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 222
COG2967126 ApaG Uncharacterized protein affecting Mg2+/Co2+ t 99.89
PRK05461127 apaG CO2+/MG2+ efflux protein ApaG; Reviewed 99.89
PF0437990 DUF525: Protein of unknown function (DUF525); Inte 99.71
KOG4408386 consensus Putative Mg2+ and Co2+ transporter CorD 99.51
COG3880176 Modulator of heat shock repressor CtsR, McsA [Sign 99.23
PF0215136 UVR: UvrB/uvrC motif; InterPro: IPR001943 During t 98.17
COG3880176 Modulator of heat shock repressor CtsR, McsA [Sign 97.93
PF0215136 UVR: UvrB/uvrC motif; InterPro: IPR001943 During t 97.68
PRK07883557 hypothetical protein; Validated 95.99
PRK00558 598 uvrC excinuclease ABC subunit C; Validated 95.93
PRK05298652 excinuclease ABC subunit B; Provisional 95.75
PRK14666 694 uvrC excinuclease ABC subunit C; Provisional 95.69
PRK12306 519 uvrC excinuclease ABC subunit C; Reviewed 95.67
TIGR00194 574 uvrC excinuclease ABC, C subunit. This family cons 95.56
PRK14670 574 uvrC excinuclease ABC subunit C; Provisional 95.54
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 95.53
PRK14669 624 uvrC excinuclease ABC subunit C; Provisional 95.47
PRK14671 621 uvrC excinuclease ABC subunit C; Provisional 95.46
PRK14672 691 uvrC excinuclease ABC subunit C; Provisional 95.42
PRK14667 567 uvrC excinuclease ABC subunit C; Provisional 95.35
PRK14668 577 uvrC excinuclease ABC subunit C; Provisional 95.32
COG0556663 UvrB Helicase subunit of the DNA excision repair c 94.91
COG0322 581 UvrC Nuclease subunit of the excinuclease complex 94.54
KOG4825 666 consensus Component of synaptic membrane glycine-, 94.03
PF11611123 DUF4352: Domain of unknown function (DUF4352); Int 93.45
COG0556663 UvrB Helicase subunit of the DNA excision repair c 92.36
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 92.04
PRK05298652 excinuclease ABC subunit B; Provisional 90.74
PRK07883557 hypothetical protein; Validated 90.49
PRK00558 598 uvrC excinuclease ABC subunit C; Validated 90.27
PRK12306 519 uvrC excinuclease ABC subunit C; Reviewed 87.95
PRK14666 694 uvrC excinuclease ABC subunit C; Provisional 87.65
PF15469182 Sec5: Exocyst complex component Sec5 87.47
PRK14668 577 uvrC excinuclease ABC subunit C; Provisional 86.79
PRK14669 624 uvrC excinuclease ABC subunit C; Provisional 86.5
PRK14672 691 uvrC excinuclease ABC subunit C; Provisional 86.41
PRK14671 621 uvrC excinuclease ABC subunit C; Provisional 86.41
PRK14667 567 uvrC excinuclease ABC subunit C; Provisional 86.27
PRK14670 574 uvrC excinuclease ABC subunit C; Provisional 86.03
TIGR00194 574 uvrC excinuclease ABC, C subunit. This family cons 85.56
PF14263124 DUF4354: Domain of unknown function (DUF4354); PDB 84.74
PF0774378 HSCB_C: HSCB C-terminal oligomerisation domain; In 84.11
COG0322 581 UvrC Nuclease subunit of the excinuclease complex 83.58
PF06476115 DUF1090: Protein of unknown function (DUF1090); In 80.23
>COG2967 ApaG Uncharacterized protein affecting Mg2+/Co2+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
Probab=99.89  E-value=1.1e-23  Score=170.07  Aligned_cols=62  Identities=47%  Similarity=0.784  Sum_probs=60.0

Q ss_pred             eeccCCeEEEEEeEEecCcccCCCCceEEEEEEEEEeCCCCCeEEeeceEEEEcCCCcEEec
Q 027566          160 DATTLGIRVQVRSVYIEDRSQPLKGQYFFAYRVRITNNSERPVQLLRRHWIITDANGKTENI  221 (222)
Q Consensus       160 ~a~T~gIkV~V~t~Ylpe~S~P~~~rYvFaY~ItIeN~s~~tVQLlsRhW~ItD~~G~v~eV  221 (222)
                      .+.|..|.|+|.|.|+|+||+|.+++|+|+|+|||.|+|+.+|||++|||+|||+||+++||
T Consensus         2 ~~~~~~I~V~V~~~yleeQS~P~~~RyvfaYtitI~N~g~~~vqLlsR~W~ITd~~g~v~eV   63 (126)
T COG2967           2 MASSPDIEVQVQPRYLEEQSSPEEERYVFAYTVTIRNLGEVPVQLLSRYWLITDGNGRVTEV   63 (126)
T ss_pred             CcccCceEEEEeeEEccccCCcccceEEEEEEEEEecCCCccceeeeeEEEEecCCCcEEEE
Confidence            35788999999999999999999999999999999999999999999999999999999998



>PRK05461 apaG CO2+/MG2+ efflux protein ApaG; Reviewed Back     alignment and domain information
>PF04379 DUF525: Protein of unknown function (DUF525); InterPro: IPR007474 This domain is found in the bacterial protein ApaG and at the C termini of some F-box proteins (IPR001810 from INTERPRO) Back     alignment and domain information
>KOG4408 consensus Putative Mg2+ and Co2+ transporter CorD [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3880 Modulator of heat shock repressor CtsR, McsA [Signal transduction mechanisms] Back     alignment and domain information
>PF02151 UVR: UvrB/uvrC motif; InterPro: IPR001943 During the process of Escherichia coli nucleotide excision repair, DNA damage recognition and processing are achieved by the action of the uvrA, uvrB, and uvrC gene products [] Back     alignment and domain information
>COG3880 Modulator of heat shock repressor CtsR, McsA [Signal transduction mechanisms] Back     alignment and domain information
>PF02151 UVR: UvrB/uvrC motif; InterPro: IPR001943 During the process of Escherichia coli nucleotide excision repair, DNA damage recognition and processing are achieved by the action of the uvrA, uvrB, and uvrC gene products [] Back     alignment and domain information
>PRK07883 hypothetical protein; Validated Back     alignment and domain information
>PRK00558 uvrC excinuclease ABC subunit C; Validated Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK14666 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>PRK12306 uvrC excinuclease ABC subunit C; Reviewed Back     alignment and domain information
>TIGR00194 uvrC excinuclease ABC, C subunit Back     alignment and domain information
>PRK14670 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK14669 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>PRK14671 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>PRK14672 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>PRK14667 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>PRK14668 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0322 UvrC Nuclease subunit of the excinuclease complex [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4825 consensus Component of synaptic membrane glycine-, glutamate- and thienylcyclohexylpiperidine-binding glycoprotein (43kDa) [Signal transduction mechanisms] Back     alignment and domain information
>PF11611 DUF4352: Domain of unknown function (DUF4352); InterPro: IPR021652 This entry is represented by Bacteriophage A118, Gp32 Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK07883 hypothetical protein; Validated Back     alignment and domain information
>PRK00558 uvrC excinuclease ABC subunit C; Validated Back     alignment and domain information
>PRK12306 uvrC excinuclease ABC subunit C; Reviewed Back     alignment and domain information
>PRK14666 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>PF15469 Sec5: Exocyst complex component Sec5 Back     alignment and domain information
>PRK14668 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>PRK14669 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>PRK14672 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>PRK14671 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>PRK14667 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>PRK14670 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>TIGR00194 uvrC excinuclease ABC, C subunit Back     alignment and domain information
>PF14263 DUF4354: Domain of unknown function (DUF4354); PDB: 3NRF_B 3SB3_A Back     alignment and domain information
>PF07743 HSCB_C: HSCB C-terminal oligomerisation domain; InterPro: IPR009073 This entry represents the C-terminal oligomerisation domain found in HscB (heat shock cognate protein B), which is also known as HSC20 (20K heat shock cognate protein) Back     alignment and domain information
>COG0322 UvrC Nuclease subunit of the excinuclease complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PF06476 DUF1090: Protein of unknown function (DUF1090); InterPro: IPR009468 This family consists of several bacterial proteins of unknown function and is known as YqjC in Escherichia coli Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
1tza_A134 X-Ray Structure Of Northeast Structural Genomics Co 9e-11
1xq4_A139 Crystal Structure Of The Putative Apaa Protein From 2e-09
2f1e_A127 Solution Structure Of Apag Protein Length = 127 4e-09
1xvs_A126 Crystal Structure Of Apag Protein From Vibrio Chole 3e-08
>pdb|1TZA|A Chain A, X-Ray Structure Of Northeast Structural Genomics Consortium Target Sor45 Length = 134 Back     alignment and structure

Iteration: 1

Score = 63.5 bits (153), Expect = 9e-11, Method: Compositional matrix adjust. Identities = 28/56 (50%), Positives = 38/56 (67%) Query: 166 IRVQVRSVYIEDRSQPLKGQYFFAYRVRITNNSERPVQLLRRHWIITDANGKTENI 221 IRV+V++ YIE +S P +Y F+Y + I N E+ +L RHWIITDANGKT + Sbjct: 8 IRVEVKTEYIEQQSSPEDEKYLFSYTITIINLGEQAAKLETRHWIITDANGKTSEV 63
>pdb|1XQ4|A Chain A, Crystal Structure Of The Putative Apaa Protein From Bordetella Pertussis, Northeast Structural Genomics Target Ber40 Length = 139 Back     alignment and structure
>pdb|2F1E|A Chain A, Solution Structure Of Apag Protein Length = 127 Back     alignment and structure
>pdb|1XVS|A Chain A, Crystal Structure Of Apag Protein From Vibrio Cholerae Length = 126 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
1xvs_A126 Protein APAG; MCSG APC26324, midwest center for st 4e-27
1xq4_A139 Protein APAG; all beta protein, structural genomic 8e-27
2f1e_A127 Protein APAG; APAG protein, xanthomonas axonopodis 1e-26
1tza_A134 APAG protein, SOR45; structural genomics, PSI, pro 2e-26
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 7e-06
1e52_A63 Excinuclease ABC subunit; DNA excision repair, UVR 4e-05
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 2e-04
>1xvs_A Protein APAG; MCSG APC26324, midwest center for structural genomics, structure initiative, PSI, structural genomics, unknown FUN; 2.01A {Vibrio cholerae} SCOP: b.1.23.1 Length = 126 Back     alignment and structure
 Score = 99.5 bits (248), Expect = 4e-27
 Identities = 26/62 (41%), Positives = 41/62 (66%)

Query: 160 DATTLGIRVQVRSVYIEDRSQPLKGQYFFAYRVRITNNSERPVQLLRRHWIITDANGKTE 219
           D +   I++QV++ YIE++S P   ++ FAY + I N S + VQL+ R W+ITDA+GK  
Sbjct: 2   DVSLPCIKIQVQTRYIEEQSNPEYQRFVFAYLITIKNLSSQTVQLMSRRWLITDADGKQT 61

Query: 220 NI 221
            +
Sbjct: 62  VV 63


>1xq4_A Protein APAG; all beta protein, structural genomics, protein structure initiative, PSI, northeast structural genomics consortium, NESG; 2.70A {Bordetella pertussis} SCOP: b.1.23.1 Length = 139 Back     alignment and structure
>2f1e_A Protein APAG; APAG protein, xanthomonas axonopodis PV.citri, structural genomics, unknown function; NMR {Xanthomonas axonopodis PV} Length = 127 Back     alignment and structure
>1tza_A APAG protein, SOR45; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG, unknown function; 2.40A {Shewanella oneidensis} SCOP: b.1.23.1 Length = 134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Length = 661 Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Length = 664 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
2f1e_A127 Protein APAG; APAG protein, xanthomonas axonopodis 99.91
1xvs_A126 Protein APAG; MCSG APC26324, midwest center for st 99.9
1tza_A134 APAG protein, SOR45; structural genomics, PSI, pro 99.89
1xq4_A139 Protein APAG; all beta protein, structural genomic 99.89
1e52_A63 Excinuclease ABC subunit; DNA excision repair, UVR 97.88
1e52_A63 Excinuclease ABC subunit; DNA excision repair, UVR 97.21
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 96.59
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 95.74
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 94.86
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 92.97
3cfu_A159 Uncharacterized lipoprotein YJHA; YJHA_bacsu, SR56 88.48
3nrf_A106 APAG protein; structural genomics, joint center fo 87.37
>2f1e_A Protein APAG; APAG protein, xanthomonas axonopodis PV.citri, structural genomics, unknown function; NMR {Xanthomonas axonopodis PV} Back     alignment and structure
Probab=99.91  E-value=1.7e-24  Score=174.49  Aligned_cols=63  Identities=40%  Similarity=0.777  Sum_probs=58.4

Q ss_pred             eeeccCCeEEEEEeEEecCcccCCCCceEEEEEEEEEeCCCCCeEEeeceEEEEcCCCcEEec
Q 027566          159 SDATTLGIRVQVRSVYIEDRSQPLKGQYFFAYRVRITNNSERPVQLLRRHWIITDANGKTENI  221 (222)
Q Consensus       159 s~a~T~gIkV~V~t~Ylpe~S~P~~~rYvFaY~ItIeN~s~~tVQLlsRhW~ItD~~G~v~eV  221 (222)
                      ++++|+||+|+|.|.|+|++|+|.+++|+|+|+|||+|.++.+|||++|||+|+|++|+++||
T Consensus         2 ~~~~t~~I~V~V~~~y~~e~S~p~~~~y~faY~I~I~N~~~~~vQL~sRhW~Itd~~g~~~eV   64 (127)
T 2f1e_A            2 QDDPRYRVEVEVSPRFLAHQSTPDEGRYAFAYSIRIQNAGAVPARLVARHWQITDGNGRTEQV   64 (127)
T ss_dssp             ----CCCEEEEEEEEECSTTCBGGGTBEEEEEEEEEEECSSSCEEEEEEEEEEEETTSCEEEE
T ss_pred             ccceECCEEEEEEEEEchhhCCCcCCEEEEEEEEEEEeCCCCCEEEEeceEEEEeCCCCEEEE
Confidence            468899999999999999999999999999999999999999999999999999999999997



>1xvs_A Protein APAG; MCSG APC26324, midwest center for structural genomics, structure initiative, PSI, structural genomics, unknown FUN; 2.01A {Vibrio cholerae} SCOP: b.1.23.1 Back     alignment and structure
>1tza_A APAG protein, SOR45; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG, unknown function; 2.40A {Shewanella oneidensis} SCOP: b.1.23.1 Back     alignment and structure
>1xq4_A Protein APAG; all beta protein, structural genomics, protein structure initiative, PSI, northeast structural genomics consortium, NESG; 2.70A {Bordetella pertussis} SCOP: b.1.23.1 Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3cfu_A Uncharacterized lipoprotein YJHA; YJHA_bacsu, SR562, NESG, structural genomics, PSI-2, protein structure initiative; 2.40A {Bacillus subtilis} Back     alignment and structure
>3nrf_A APAG protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; 1.50A {Pseudomonas aeruginosa} PDB: 3sb3_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 222
d1xvsa_124 b.1.23.1 (A:) ApaG {Vibrio cholerae [TaxId: 666]} 2e-28
d1tzaa_132 b.1.23.1 (A:) ApaG {Shewanella oneidensis [TaxId: 2e-27
d1xq4a_123 b.1.23.1 (A:) ApaG {Bordetella pertussis [TaxId: 5 7e-26
d1e52a_56 a.2.9.1 (A:) C-terminal UvrC-binding domain of Uvr 2e-05
d1e52a_56 a.2.9.1 (A:) C-terminal UvrC-binding domain of Uvr 8e-05
>d1xvsa_ b.1.23.1 (A:) ApaG {Vibrio cholerae [TaxId: 666]} Length = 124 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: ApaG-like
family: ApaG-like
domain: ApaG
species: Vibrio cholerae [TaxId: 666]
 Score =  101 bits (254), Expect = 2e-28
 Identities = 26/62 (41%), Positives = 41/62 (66%)

Query: 160 DATTLGIRVQVRSVYIEDRSQPLKGQYFFAYRVRITNNSERPVQLLRRHWIITDANGKTE 219
           D +   I++QV++ YIE++S P   ++ FAY + I N S + VQL+ R W+ITDA+GK  
Sbjct: 2   DVSLPCIKIQVQTRYIEEQSNPEYQRFVFAYLITIKNLSSQTVQLMSRRWLITDADGKQT 61

Query: 220 NI 221
            +
Sbjct: 62  VV 63


>d1tzaa_ b.1.23.1 (A:) ApaG {Shewanella oneidensis [TaxId: 70863]} Length = 132 Back     information, alignment and structure
>d1xq4a_ b.1.23.1 (A:) ApaG {Bordetella pertussis [TaxId: 520]} Length = 123 Back     information, alignment and structure
>d1e52a_ a.2.9.1 (A:) C-terminal UvrC-binding domain of UvrB {Escherichia coli [TaxId: 562]} Length = 56 Back     information, alignment and structure
>d1e52a_ a.2.9.1 (A:) C-terminal UvrC-binding domain of UvrB {Escherichia coli [TaxId: 562]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
d1tzaa_132 ApaG {Shewanella oneidensis [TaxId: 70863]} 99.89
d1xvsa_124 ApaG {Vibrio cholerae [TaxId: 666]} 99.88
d1xq4a_123 ApaG {Bordetella pertussis [TaxId: 520]} 99.85
d1e52a_56 C-terminal UvrC-binding domain of UvrB {Escherichi 97.82
d1e52a_56 C-terminal UvrC-binding domain of UvrB {Escherichi 97.32
d1fpoa295 HSC20 (HSCB), C-terminal oligomerisation domain {E 86.04
d2fzta178 Hypothetical protein TM0693 {Thermotoga maritima [ 82.21
>d1tzaa_ b.1.23.1 (A:) ApaG {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: ApaG-like
family: ApaG-like
domain: ApaG
species: Shewanella oneidensis [TaxId: 70863]
Probab=99.89  E-value=9.3e-24  Score=169.48  Aligned_cols=61  Identities=48%  Similarity=0.809  Sum_probs=59.6

Q ss_pred             eccCCeEEEEEeEEecCcccCCCCceEEEEEEEEEeCCCCCeEEeeceEEEEcCCCcEEec
Q 027566          161 ATTLGIRVQVRSVYIEDRSQPLKGQYFFAYRVRITNNSERPVQLLRRHWIITDANGKTENI  221 (222)
Q Consensus       161 a~T~gIkV~V~t~Ylpe~S~P~~~rYvFaY~ItIeN~s~~tVQLlsRhW~ItD~~G~v~eV  221 (222)
                      |+|+||+|+|.|.|+|++|+|.+.+|+|+|+|||+|.++.+|||++|||+|+|++|++++|
T Consensus         1 a~t~gI~V~V~t~y~~e~S~p~~~~y~F~Y~ItI~N~~~~~vQLlsR~W~I~d~~G~~~eV   61 (132)
T d1tzaa_           1 ALDNSIRVEVKTEYIEQQSSPEDEKYLFSYTITIINLGEQAAKLETRHWIITDANGKTSEV   61 (132)
T ss_dssp             CGGGTEEEEEEEEEEEECCBTTBCCEEEEEEEEEEECSSSCEEEEEEEEEEEETTSCEEEE
T ss_pred             CccCCEEEEEEEEEchhcCCCCCCeEEEEEEEEEEeCCCCCEEEEeeEEEEECCCCCEEEE
Confidence            5799999999999999999999999999999999999999999999999999999999987



>d1xvsa_ b.1.23.1 (A:) ApaG {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1xq4a_ b.1.23.1 (A:) ApaG {Bordetella pertussis [TaxId: 520]} Back     information, alignment and structure
>d1e52a_ a.2.9.1 (A:) C-terminal UvrC-binding domain of UvrB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e52a_ a.2.9.1 (A:) C-terminal UvrC-binding domain of UvrB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fpoa2 a.23.1.1 (A:77-171) HSC20 (HSCB), C-terminal oligomerisation domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fzta1 a.46.3.1 (A:1-78) Hypothetical protein TM0693 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure