Citrus Sinensis ID: 027584

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-
MLRVAARRLLSPSSSSSLRPMASSRNIINGAGSSSSSNDDFRSNGFYGSGYLGPQFQLPCRGDFSSESLTPRNEESLVPGVPATVAAVKNPTSKIVYDEYNHERYPPGDPSKRAFAYFVLTGGSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVGVCTHLGFARDQHHTIWKYPLTPSWMRTRCSLVDKCDVLYR
cHHHHHHHHHcccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHEEEcccccEEEEcccccccccccHHHHccccEEEEccccccccEEEEEEccEEEEEEEccHHHHHHHccccccccccccccccccccccEEEEEEEccccccccccccccccccccHHHHHHHcccccccccccc
ccHHHHHcccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHccccHHHHHHHccEcccccccHHHHHHEEEEEEccHcccccEEEEEEccEEEEEEEccHHHHHHHHcccHHHccccccHHHHcccccEEEEEccccccccccccccccccccccccHHHccccccccccEEcc
MLRVAArrllspssssslrpmassrniingagsssssnddfrsngfygsgylgpqfqlpcrgdfssesltprneeslvpgvpatvaavknptskivydeynheryppgdpskrAFAYFVLtggsiepgstvtvkwrgkpvfirRRTEediklansvdlgslrdpqqdaervknpewLVVVGVCTHlgfardqhhtiwkypltpswmrtrcslvdkcdvlyr
mlrvaarrllspssssslrpmaSSRNIIngagsssssndDFRSNGFYGSGYLGPQFQLPCRGDFSSESLTPrneeslvpgvpatvaavknptskivydeynheryppgdPSKRAFAYFVLTggsiepgstvtvkwrgkpvfirrrteediklansvdlgslrdpqqdaervknpewLVVVGVCTHLgfardqhhtiwkypltpswmrtrcslvdkcdvlyr
MLRVaarrllspssssslrpmassrniingagsssssnddfrsngfYGSGYLGPQFQLPCRGDFSSESLTPRNEESLVPGVPATVAAVKNPTSKIVYDEYNHERYPPGDPSKRAFAYFVLTGGSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVGVCTHLGFARDQHHTIWKYPLTPSWMRTRCSLVDKCDVLYR
*********************************************FYGSGYLGPQFQLPC***********************TVAAVKNPTSKIVYDEYNH**********RAFAYFVLTGGSIEPGSTVTVKWRGKPVFIRRRTEEDIKLA*******************NPEWLVVVGVCTHLGFARDQHHTIWKYPLTPSWMRTRCSLVDKCDVLY*
****************************************************************************LVPGVPATVAAVKNPTSKIVYDEYNHERYP******RAFAYFVLTGGSIEPGSTVTVKWRGKPVFIRRRT**********************ERVKNPEWLVVVGVCTHLGFARDQHHTIWKYPLTPSWMRTRCSLVDKCDVLYR
********************MASSRNIINGAGSSSSSNDDFRSNGFYGSGYLGPQFQLPCRGDFSSESLTPRNEESLVPGVPATVAAVKNPTSKIVYDEYNHERYPPGDPSKRAFAYFVLTGGSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVGVCTHLGFARDQHHTIWKYPLTPSWMRTRCSLVDKCDVLYR
*************************************************************************EESLVPGVPATVAAVKNPTSKIVYDEYNHERYPPGDPSKRAFAYFVLTGGSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVGVCTHLGFARDQHHTIWKYPLTPSWMRTRCSLVDKCDVLYR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRVAARRLLSPSSSSSLRPMASSRNIINGAGSSSSSNDDFRSNGFYGSGYLGPQFQLPCRGDFSSESLTPRNEESLVPGVPATVAAVKNPTSKIVYDEYNHERYPPGDPSKRAFAYFVLTGGSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVGVCTHLGFARDQHHTIWKYPLTPSWMRTRCSLVDKCDVLYR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query221 2.2.26 [Sep-21-2011]
P49727273 Cytochrome b-c1 complex s N/A no 0.828 0.670 0.558 3e-56
P49729258 Cytochrome b-c1 complex s N/A no 0.610 0.523 0.645 5e-54
P51133268 Cytochrome b-c1 complex s N/A no 0.610 0.503 0.645 7e-54
P51135268 Cytochrome b-c1 complex s N/A no 0.610 0.503 0.639 2e-53
P37841265 Cytochrome b-c1 complex s N/A no 0.561 0.467 0.662 7e-53
P51132272 Cytochrome b-c1 complex s N/A no 0.610 0.496 0.633 1e-52
P51134236 Cytochrome b-c1 complex s N/A no 0.542 0.508 0.653 1e-50
Q09154228 Cytochrome b-c1 complex s yes no 0.285 0.276 0.650 1e-19
P08067215 Cytochrome b-c1 complex s yes no 0.334 0.344 0.554 2e-19
P07056231 Cytochrome b-c1 complex s N/A no 0.289 0.277 0.625 8e-19
>sp|P49727|UCRI_MAIZE Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Zea mays PE=2 SV=1 Back     alignment and function desciption
 Score =  218 bits (554), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 125/224 (55%), Positives = 145/224 (64%), Gaps = 41/224 (18%)

Query: 1   MLRVAARRLLSPSSSSSLRPMAS-SRNIINGAGSSSSSNDDFRSNGFYGSGYLGPQFQLP 59
           MLRVA RRL   SSS S RP A+ +R  + GAG     +D  R           P F + 
Sbjct: 1   MLRVAGRRL---SSSLSWRPAAAVARGPLAGAGVPDRDDDSARGRSQPRFSIDSPFF-VA 56

Query: 60  CRGDFSSESLTPRNEESLVPGVPATVAAVKNPTSKIVYDEYNHERYPPGDPSKRAFAYFV 119
            RG  S+E++ PRN+++ +  +PATVAAVKNP  K+VYDEYNHERYPPGDPSKRAFAYFV
Sbjct: 57  SRGFSSTETVVPRNQDAGLADLPATVAAVKNPNPKVVYDEYNHERYPPGDPSKRAFAYFV 116

Query: 120 LTGG------------------------------------SIEPGSTVTVKWRGKPVFIR 143
           L+GG                                    SIEPG+TVTVKWRGKPVFIR
Sbjct: 117 LSGGRFIYASLLRLLVLKFVLSMSASKDVLALASLEVDLSSIEPGTTVTVKWRGKPVFIR 176

Query: 144 RRTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVGVCTHLG 187
           RRTE+DIKLANSVD+ SLR P+QDAERVKNPEWLVV+GVCTHLG
Sbjct: 177 RRTEDDIKLANSVDVASLRHPEQDAERVKNPEWLVVIGVCTHLG 220
Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.
Zea mays (taxid: 4577)
EC: 1EC: .EC: 1EC: 0EC: .EC: 2EC: .EC: 2
>sp|P49729|UCRI1_TOBAC Cytochrome b-c1 complex subunit Rieske-1, mitochondrial (Fragment) OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|P51133|UCRI3_TOBAC Cytochrome b-c1 complex subunit Rieske-3, mitochondrial OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|P51135|UCRI5_TOBAC Cytochrome b-c1 complex subunit Rieske-5, mitochondrial OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|P37841|UCRI_SOLTU Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Solanum tuberosum GN=FES1 PE=1 SV=1 Back     alignment and function description
>sp|P51132|UCRI2_TOBAC Cytochrome b-c1 complex subunit Rieske-2, mitochondrial OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|P51134|UCRI4_TOBAC Cytochrome b-c1 complex subunit Rieske-4, mitochondrial OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|Q09154|UCRI_SCHPO Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rip1 PE=2 SV=2 Back     alignment and function description
>sp|P08067|UCRI_YEAST Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIP1 PE=1 SV=1 Back     alignment and function description
>sp|P07056|UCRI_NEUCR Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06606 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query221
449452028274 PREDICTED: cytochrome b-c1 complex subun 0.755 0.609 0.599 3e-58
255543531280 ubiquinol-cytochrome C reductase iron-su 0.832 0.657 0.595 5e-58
449452030274 PREDICTED: cytochrome b-c1 complex subun 0.719 0.580 0.582 3e-55
388498708273 unknown [Lotus japonicus] 0.823 0.666 0.568 4e-55
357508447273 Ubiquinol-cytochrome c reductase iron-su 0.823 0.666 0.568 5e-55
388516897273 unknown [Medicago truncatula] 0.823 0.666 0.568 1e-54
194691146273 unknown [Zea mays] gi|413918191|gb|AFW58 0.828 0.670 0.558 1e-54
162458481273 cytochrome b-c1 complex subunit Rieske, 0.828 0.670 0.558 2e-54
225451621274 PREDICTED: cytochrome b-c1 complex subun 0.638 0.514 0.634 6e-54
212723608273 ubiquinol-cytochrome c reductase iron-su 0.823 0.666 0.551 6e-54
>gi|449452028|ref|XP_004143762.1| PREDICTED: cytochrome b-c1 complex subunit Rieske-2, mitochondrial-like [Cucumis sativus] gi|449516924|ref|XP_004165496.1| PREDICTED: cytochrome b-c1 complex subunit Rieske-2, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  230 bits (587), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 127/212 (59%), Positives = 148/212 (69%), Gaps = 45/212 (21%)

Query: 12  PSSSSSLRPMASSRNIINGAGSSSSSNDDFRSNGFYGSGYLGPQFQLPCRGDFSSESLTP 71
           P+ +SSL P+  S NII+     S+ ++DFRS GF+ +  + P F    RG F+S++LT 
Sbjct: 19  PTIASSL-PL--SHNIID-----STDSNDFRSAGFFHTFPIRPHFDRNSRG-FASDALTS 69

Query: 72  RNEESLVPGVPATVAAVKNPTSKIVYDEYNHERYPPGDPSKRAFAYFVLTGG-------- 123
             E +LVP VPAT+AAVKNPTSKIVYDEYNHER+PPGDPSKRAFAYFVL+GG        
Sbjct: 70  TKENNLVPDVPATIAAVKNPTSKIVYDEYNHERFPPGDPSKRAFAYFVLSGGRFVYASLI 129

Query: 124 ----------------------------SIEPGSTVTVKWRGKPVFIRRRTEEDIKLANS 155
                                       SIEPG+TVTVKWRGKPVFIRRRTEEDIKLANS
Sbjct: 130 RLLVLKFVLSMSASKDVLALASLEVDLSSIEPGATVTVKWRGKPVFIRRRTEEDIKLANS 189

Query: 156 VDLGSLRDPQQDAERVKNPEWLVVVGVCTHLG 187
           VD+G+LRDPQQD ERVK+PEWLVVVGVCTHLG
Sbjct: 190 VDIGTLRDPQQDGERVKDPEWLVVVGVCTHLG 221

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255543531|ref|XP_002512828.1| ubiquinol-cytochrome C reductase iron-sulfur subunit, putative [Ricinus communis] gi|223547839|gb|EEF49331.1| ubiquinol-cytochrome C reductase iron-sulfur subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449452030|ref|XP_004143763.1| PREDICTED: cytochrome b-c1 complex subunit Rieske-2, mitochondrial-like [Cucumis sativus] gi|449516922|ref|XP_004165495.1| PREDICTED: cytochrome b-c1 complex subunit Rieske-2, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388498708|gb|AFK37420.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|357508447|ref|XP_003624512.1| Ubiquinol-cytochrome c reductase iron-sulfur subunit [Medicago truncatula] gi|355499527|gb|AES80730.1| Ubiquinol-cytochrome c reductase iron-sulfur subunit [Medicago truncatula] Back     alignment and taxonomy information
>gi|388516897|gb|AFK46510.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|194691146|gb|ACF79657.1| unknown [Zea mays] gi|413918191|gb|AFW58123.1| cytochrome b-c1 complex subunit Rieske, Precursor(Rieske iron-sulfur protein) [Zea mays] Back     alignment and taxonomy information
>gi|162458481|ref|NP_001105561.1| cytochrome b-c1 complex subunit Rieske, mitochondrial precursor [Zea mays] gi|1717957|sp|P49727.1|UCRI_MAIZE RecName: Full=Cytochrome b-c1 complex subunit Rieske, mitochondrial; AltName: Full=Complex III subunit 5; AltName: Full=Rieske iron-sulfur protein; Short=RISP; AltName: Full=Ubiquinol-cytochrome c reductase iron-sulfur subunit; Flags: Precursor gi|168607|gb|AAA33507.1| Rieske Fe-S protein [Zea mays] Back     alignment and taxonomy information
>gi|225451621|ref|XP_002276466.1| PREDICTED: cytochrome b-c1 complex subunit Rieske, mitochondrial [Vitis vinifera] Back     alignment and taxonomy information
>gi|212723608|ref|NP_001131229.1| ubiquinol-cytochrome c reductase iron-sulfur subunit [Zea mays] gi|194690934|gb|ACF79551.1| unknown [Zea mays] gi|194701342|gb|ACF84755.1| unknown [Zea mays] gi|414587473|tpg|DAA38044.1| TPA: ubiquinol-cytochrome c reductase iron-sulfur subunit [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query221
TAIR|locus:2181670272 AT5G13430 [Arabidopsis thalian 0.294 0.238 0.907 9.1e-29
TAIR|locus:2181675274 AT5G13440 [Arabidopsis thalian 0.294 0.237 0.892 1.2e-28
UNIPROTKB|G4N4E1236 MGG_16866 "Ubiquinol-cytochrom 0.289 0.271 0.625 1.6e-21
POMBASE|SPBC16H5.06228 rip1 "ubiquinol-cytochrome-c r 0.285 0.276 0.650 1.2e-19
UNIPROTKB|Q5ZLR5272 UQCRFS1 "Cytochrome b-c1 compl 0.285 0.231 0.571 1.9e-19
SGD|S000000750215 RIP1 "Ubiquinol-cytochrome-c r 0.289 0.297 0.609 4e-19
GENEDB_PFALCIPARUM|PF14_0373355 PF14_0373 "iron-sulphur protei 0.289 0.180 0.530 2.9e-18
UNIPROTKB|Q8IL75355 PF14_0373 "Ubiquinol-cytochrom 0.289 0.180 0.530 2.9e-18
TIGR_CMR|NSE_0624173 NSE_0624 "ubiquinol-cytochrome 0.289 0.369 0.636 3.6e-18
TIGR_CMR|APH_0401189 APH_0401 "ubiquinol-cytochrome 0.289 0.338 0.621 4.6e-18
TAIR|locus:2181670 AT5G13430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 320 (117.7 bits), Expect = 9.1e-29, P = 9.1e-29
 Identities = 59/65 (90%), Positives = 64/65 (98%)

Query:   123 GSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVGV 182
             GSIEPG+TVTVKWRGKPVFIRRRTE+DIKLANSVD+GSLRDPQ+D+ RVKNPEWLVVVGV
Sbjct:   155 GSIEPGTTVTVKWRGKPVFIRRRTEDDIKLANSVDVGSLRDPQEDSVRVKNPEWLVVVGV 214

Query:   183 CTHLG 187
             CTHLG
Sbjct:   215 CTHLG 219
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0008121 "ubiquinol-cytochrome-c reductase activity" evidence=IEA
GO:0016020 "membrane" evidence=IEA;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016679 "oxidoreductase activity, acting on diphenols and related substances as donors" evidence=IEA
GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA;TAS
GO:0046872 "metal ion binding" evidence=IDA
GO:0005750 "mitochondrial respiratory chain complex III" evidence=IDA
TAIR|locus:2181675 AT5G13440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4N4E1 MGG_16866 "Ubiquinol-cytochrome c reductase iron-sulfur subunit" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
POMBASE|SPBC16H5.06 rip1 "ubiquinol-cytochrome-c reductase complex subunit 5" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZLR5 UQCRFS1 "Cytochrome b-c1 complex subunit Rieske, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
SGD|S000000750 RIP1 "Ubiquinol-cytochrome-c reductase, a Rieske iron-sulfur protein of the" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF14_0373 PF14_0373 "iron-sulphur protein subunit of the cytochrome bc1 complex" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IL75 PF14_0373 "Ubiquinol-cytochrome C reductase iron-sulfur subunit, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
TIGR_CMR|NSE_0624 NSE_0624 "ubiquinol-cytochrome c reductase, iron-sulfur subunit" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] Back     alignment and assigned GO terms
TIGR_CMR|APH_0401 APH_0401 "ubiquinol-cytochrome c reductase, iron-sulfur subunit" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.10.2.20.914
3rd Layer1.10.20.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query221
cd03470126 cd03470, Rieske_cytochrome_bc1, Iron-sulfur protei 9e-34
TIGR01416174 TIGR01416, Rieske_proteo, ubiquinol-cytochrome c r 3e-25
COG0723177 COG0723, QcrA, Rieske Fe-S protein [Energy product 1e-11
>gnl|CDD|239552 cd03470, Rieske_cytochrome_bc1, Iron-sulfur protein (ISP) component of the bc(1) complex family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information 
 Score =  117 bits (295), Expect = 9e-34
 Identities = 39/67 (58%), Positives = 46/67 (68%), Gaps = 2/67 (2%)

Query: 123 GSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDP--QQDAERVKNPEWLVVV 180
             IE G  +TV+WRGKPVFIRRRT E+I  A +VDL  L DP    +  R   PEWLVV+
Sbjct: 7   SKIEEGQLITVEWRGKPVFIRRRTPEEIAEAKAVDLSLLDDPDPAANRVRSGKPEWLVVI 66

Query: 181 GVCTHLG 187
           G+CTHLG
Sbjct: 67  GICTHLG 73

The bc(1) complex is a multisubunit enzyme found in many different organisms including uni- and multi-cellular eukaryotes, plants (in their mitochondria) and bacteria. The cytochrome bc(1) and b6f complexes are central components of the respiratory and photosynthetic electron transport chains, respectively, which carry out similar core electron and proton transfer steps. The bc(1) and b6f complexes share a common core structure of three catalytic subunits: cyt b, the Rieske ISP, and either a cyt c1 in the bc(1) complex or cyt f in the b6f complex, which are arranged in an integral membrane-bound dimeric complex. While the core of the b6f complex is similar to that of the bc(1) complex, the domain arrangement outside the core and the complement of prosthetic groups are strikingly different. Length = 126
>gnl|CDD|233404 TIGR01416, Rieske_proteo, ubiquinol-cytochrome c reductase, iron-sulfur subunit Back     alignment and domain information
>gnl|CDD|223795 COG0723, QcrA, Rieske Fe-S protein [Energy production and conversion] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 221
KOG1671210 consensus Ubiquinol cytochrome c reductase, subuni 100.0
cd03470126 Rieske_cytochrome_bc1 Iron-sulfur protein (ISP) co 99.81
TIGR01416174 Rieske_proteo ubiquinol-cytochrome c reductase, ir 99.76
COG0723177 QcrA Rieske Fe-S protein [Energy production and co 99.5
cd03476126 Rieske_ArOX_small Small subunit of Arsenite oxidas 97.63
cd0347895 Rieske_AIFL_N AIFL (apoptosis-inducing factor like 97.11
cd0347791 Rieske_YhfW_C YhfW family, C-terminal Rieske domai 97.0
cd0352898 Rieske_RO_ferredoxin Rieske non-heme iron oxygenas 96.98
PF0035597 Rieske: Rieske [2Fe-2S] domain; InterPro: IPR01794 96.96
PF0292164 UCR_TM: Ubiquinol cytochrome reductase transmembra 96.87
cd03469118 Rieske_RO_Alpha_N Rieske non-heme iron oxygenase ( 96.82
cd03474108 Rieske_T4moC Toluene-4-monooxygenase effector prot 96.29
cd0353098 Rieske_NirD_small_Bacillus Small subunit of nitrit 96.11
TIGR02694129 arsenite_ox_S arsenite oxidase, small subunit. Thi 95.78
cd0346798 Rieske Rieske domain; a [2Fe-2S] cluster binding d 95.72
cd04337129 Rieske_RO_Alpha_Cao Cao (chlorophyll a oxygenase) 95.66
cd03548136 Rieske_RO_Alpha_OMO_CARDO Rieske non-heme iron oxy 95.57
PRK13474178 cytochrome b6-f complex iron-sulfur subunit; Provi 95.43
cd03479144 Rieske_RO_Alpha_PhDO_like Rieske non-heme iron oxy 95.36
PRK09965106 3-phenylpropionate dioxygenase ferredoxin subunit; 95.35
TIGR02377101 MocE_fam_FeS Rieske [2Fe-2S] domain protein, MocE 95.2
cd03473107 Rieske_CMP_Neu5Ac_hydrolase_N Cytidine monophospha 94.7
cd03531115 Rieske_RO_Alpha_KSH The alignment model represents 94.59
cd03545150 Rieske_RO_Alpha_OHBDO_like Rieske non-heme iron ox 94.28
cd03538146 Rieske_RO_Alpha_AntDO Rieske non-heme iron oxygena 93.9
COG2146106 {NirD} Ferredoxin subunits of nitrite reductase an 93.74
cd03475171 Rieske_SoxF_SoxL SoxF and SoxL family, Rieske doma 93.32
cd03529103 Rieske_NirD Assimilatory nitrite reductase (NirD) 93.32
cd03472128 Rieske_RO_Alpha_BPDO_like Rieske non-heme iron oxy 93.27
cd03535123 Rieske_RO_Alpha_NDO Rieske non-heme iron oxygenase 93.23
cd03471126 Rieske_cytochrome_b6f Iron-sulfur protein (ISP) co 93.1
TIGR02378105 nirD_assim_sml nitrite reductase [NAD(P)H], small 92.71
cd04338134 Rieske_RO_Alpha_Tic55 Tic55 is a 55kDa LLS1-relate 92.68
cd03536123 Rieske_RO_Alpha_DTDO This alignment model represen 92.66
cd03532116 Rieske_RO_Alpha_VanA_DdmC Rieske non-heme iron oxy 92.38
PRK09511108 nirD nitrite reductase small subunit; Provisional 92.33
cd03480138 Rieske_RO_Alpha_PaO Rieske non-heme iron oxygenase 92.08
TIGR03171321 soxL2 Rieske iron-sulfur protein SoxL2. This iron- 90.77
cd03541118 Rieske_RO_Alpha_CMO Rieske non-heme iron oxygenase 89.95
cd03539129 Rieske_RO_Alpha_S5H This alignment model represent 87.83
cd03542123 Rieske_RO_Alpha_HBDO Rieske non-heme iron oxygenas 84.5
cd03537123 Rieske_RO_Alpha_PrnD This alignment model represen 81.95
PLN00095 394 chlorophyllide a oxygenase; Provisional 81.42
>KOG1671 consensus Ubiquinol cytochrome c reductase, subunit RIP1 [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=6.5e-34  Score=246.22  Aligned_cols=114  Identities=40%  Similarity=0.715  Sum_probs=97.9

Q ss_pred             cccCCCCCCchhhhhhhcCCCccccccCCCcccCCCCCCCCcceeEEEeccC----------------------------
Q 027584           72 RNEESLVPGVPATVAAVKNPTSKIVYDEYNHERYPPGDPSKRAFAYFVLTGG----------------------------  123 (221)
Q Consensus        72 ~~~~~~~~~~p~~~~~~k~Pt~~~~y~~~~~~~~~~~~~~kr~f~y~~~~~~----------------------------  123 (221)
                      .|++.+.|+++.|++.            .++++...+++.|+.|+|+++|.+                            
T Consensus        18 ~~t~~~~p~~~~~~~~------------~~~~~~~~~~~~k~~~sy~~~g~~~~~~a~~ak~~v~~fi~smsAsadvlA~   85 (210)
T KOG1671|consen   18 SHTDLMVPDFSDYRRE------------SVKDHQDTGEERKGFRSYLMVGAGAAGRAYAAKNLVTTFISSMSASADVLAM   85 (210)
T ss_pred             ccccccCCCchhhhch------------hhhccccchhhhhceeeEEEecccceeehhhhhhhHHHHHHHhhhhhhhhhh
Confidence            3777777777776443            333334467778888899999853                            


Q ss_pred             --------CCCCCCeEEEEECCeeEEEEeCCHHHHHHhhcCCCCCCCCCcccccccCCCcEEEEEcccCCcCcccCCCCC
Q 027584          124 --------SIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVGVCTHLGFARDQHHT  195 (221)
Q Consensus       124 --------~IepGq~vtVkWRGKPVFI~rRT~eeI~~l~~vd~~~LrDPqsd~~Rs~~PEwLVvIGICTHLGCIP~~~~~  195 (221)
                              .||||++++|+||||||||+|||++||+.++.++.+.|+|||.|.+|+++|||||++||||||||||+++++
T Consensus        86 akiei~l~~IPeGk~~~~kwrGkpvfirhrt~~ei~~~r~V~~s~lrDPq~d~~rvk~~ewl~~igVCThLGCVp~~~AG  165 (210)
T KOG1671|consen   86 AKIEIKLSDIPEGKTVAFKWRGKPVFIRHRTKAEIEGERNVPQSTLRDPQDDVDRVKKPEWLVVIGVCTHLGCVPIANAG  165 (210)
T ss_pred             eeeeeeeecCCCCCCcceeccCCceEEeeccccccccccccchhhccCchhhhhhccCcceEEEEeeecccccccccccc
Confidence                    999999999999999999999999999999999999999999999999999999999999999999999876


Q ss_pred             CC
Q 027584          196 IW  197 (221)
Q Consensus       196 ~~  197 (221)
                      .+
T Consensus       166 d~  167 (210)
T KOG1671|consen  166 DY  167 (210)
T ss_pred             cc
Confidence            44

>cd03470 Rieske_cytochrome_bc1 Iron-sulfur protein (ISP) component of the bc(1) complex family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>TIGR01416 Rieske_proteo ubiquinol-cytochrome c reductase, iron-sulfur subunit Back     alignment and domain information
>COG0723 QcrA Rieske Fe-S protein [Energy production and conversion] Back     alignment and domain information
>cd03476 Rieske_ArOX_small Small subunit of Arsenite oxidase (ArOX) family, Rieske domain; ArOX is a molybdenum/iron protein involved in the detoxification of arsenic, oxidizing it to arsenate Back     alignment and domain information
>cd03478 Rieske_AIFL_N AIFL (apoptosis-inducing factor like) family, N-terminal Rieske domain; members of this family show similarity to human AIFL, containing an N-terminal Rieske domain and a C-terminal pyridine nucleotide-disulfide oxidoreductase domain (Pyr_redox) Back     alignment and domain information
>cd03477 Rieske_YhfW_C YhfW family, C-terminal Rieske domain; YhfW is a protein of unknown function with an N-terminal DadA-like (glycine/D-amino acid dehydrogenase) domain and a C-terminal Rieske domain Back     alignment and domain information
>cd03528 Rieske_RO_ferredoxin Rieske non-heme iron oxygenase (RO) family, Rieske ferredoxin component; composed of the Rieske ferredoxin component of some three-component RO systems including biphenyl dioxygenase (BPDO) and carbazole 1,9a-dioxygenase (CARDO) Back     alignment and domain information
>PF00355 Rieske: Rieske [2Fe-2S] domain; InterPro: IPR017941 There are multiple types of iron-sulphur clusters which are grouped into three main categories based on their atomic content: [2Fe-2S], [3Fe-4S], [4Fe-4S] (see PDOC00176 from PROSITEDOC), and other hybrid or mixed metal types Back     alignment and domain information
>PF02921 UCR_TM: Ubiquinol cytochrome reductase transmembrane region; InterPro: IPR004192 The ubiquinol cytochrome c reductase (cytochrome bc1) complex is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis Back     alignment and domain information
>cd03469 Rieske_RO_Alpha_N Rieske non-heme iron oxygenase (RO) family, N-terminal Rieske domain of the oxygenase alpha subunit; The RO family comprise a large class of aromatic ring-hydroxylating dioxygenases found predominantly in microorganisms Back     alignment and domain information
>cd03474 Rieske_T4moC Toluene-4-monooxygenase effector protein complex (T4mo), Rieske ferredoxin subunit; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>cd03530 Rieske_NirD_small_Bacillus Small subunit of nitrite reductase (NirD) family, Rieske domain; composed of proteins similar to the Bacillus subtilis small subunit of assimilatory nitrite reductase containing a Rieske domain Back     alignment and domain information
>TIGR02694 arsenite_ox_S arsenite oxidase, small subunit Back     alignment and domain information
>cd03467 Rieske Rieske domain; a [2Fe-2S] cluster binding domain commonly found in Rieske non-heme iron oxygenase (RO) systems such as naphthalene and biphenyl dioxygenases, as well as in plant/cyanobacterial chloroplast b6f and mitochondrial cytochrome bc(1) complexes Back     alignment and domain information
>cd04337 Rieske_RO_Alpha_Cao Cao (chlorophyll a oxygenase) is a rieske non-heme iron-sulfur protein located within the plastid-envelope inner and thylakoid membranes, that catalyzes the conversion of chlorophyllide a to chlorophyllide b Back     alignment and domain information
>cd03548 Rieske_RO_Alpha_OMO_CARDO Rieske non-heme iron oxygenase (RO) family, 2-Oxoquinoline 8-monooxygenase (OMO) and Carbazole 1,9a-dioxygenase (CARDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>PRK13474 cytochrome b6-f complex iron-sulfur subunit; Provisional Back     alignment and domain information
>cd03479 Rieske_RO_Alpha_PhDO_like Rieske non-heme iron oxygenase (RO) family, Phthalate 4,5-dioxygenase (PhDO)-like subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of PhDO and similar proteins including 3-chlorobenzoate 3,4-dioxygenase (CBDO), phenoxybenzoate dioxygenase (POB-dioxygenase) and 3-nitrobenzoate oxygenase (MnbA) Back     alignment and domain information
>PRK09965 3-phenylpropionate dioxygenase ferredoxin subunit; Provisional Back     alignment and domain information
>TIGR02377 MocE_fam_FeS Rieske [2Fe-2S] domain protein, MocE subfamily Back     alignment and domain information
>cd03473 Rieske_CMP_Neu5Ac_hydrolase_N Cytidine monophosphate-N-acetylneuraminic acid (CMP Neu5Ac) hydroxylase family, N-terminal Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>cd03531 Rieske_RO_Alpha_KSH The alignment model represents the N-terminal rieske iron-sulfur domain of KshA, the oxygenase component of 3-ketosteroid 9-alpha-hydroxylase (KSH) Back     alignment and domain information
>cd03545 Rieske_RO_Alpha_OHBDO_like Rieske non-heme iron oxygenase (RO) family, Ortho-halobenzoate-1,2-dioxygenase (OHBDO)-like subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of OHBDO, salicylate 5-hydroxylase (S5H), terephthalate 1,2-dioxygenase system (TERDOS) and similar proteins Back     alignment and domain information
>cd03538 Rieske_RO_Alpha_AntDO Rieske non-heme iron oxygenase (RO) family, Anthranilate 1,2-dioxygenase (AntDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>COG2146 {NirD} Ferredoxin subunits of nitrite reductase and ring-hydroxylating dioxygenases [Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>cd03475 Rieske_SoxF_SoxL SoxF and SoxL family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>cd03529 Rieske_NirD Assimilatory nitrite reductase (NirD) family, Rieske domain; Assimilatory nitrate and nitrite reductases convert nitrate through nitrite to ammonium Back     alignment and domain information
>cd03472 Rieske_RO_Alpha_BPDO_like Rieske non-heme iron oxygenase (RO) family, Biphenyl dioxygenase (BPDO)-like subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of BPDO and similar proteins including cumene dioxygenase (CumDO), nitrobenzene dioxygenase (NBDO), alkylbenzene dioxygenase (AkbDO) and dibenzofuran 4,4a-dioxygenase (DFDO) Back     alignment and domain information
>cd03535 Rieske_RO_Alpha_NDO Rieske non-heme iron oxygenase (RO) family, Nathphalene 1,2-dioxygenase (NDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>cd03471 Rieske_cytochrome_b6f Iron-sulfur protein (ISP) component of the b6f complex family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>TIGR02378 nirD_assim_sml nitrite reductase [NAD(P)H], small subunit Back     alignment and domain information
>cd04338 Rieske_RO_Alpha_Tic55 Tic55 is a 55kDa LLS1-related non-heme iron oxygenase associated with protein transport through the plant inner chloroplast membrane Back     alignment and domain information
>cd03536 Rieske_RO_Alpha_DTDO This alignment model represents the N-terminal rieske domain of the oxygenase alpha subunit (DitA) of diterpenoid dioxygenase (DTDO) Back     alignment and domain information
>cd03532 Rieske_RO_Alpha_VanA_DdmC Rieske non-heme iron oxygenase (RO) family, Vanillate-O-demethylase oxygenase (VanA) and dicamba O-demethylase oxygenase (DdmC) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>PRK09511 nirD nitrite reductase small subunit; Provisional Back     alignment and domain information
>cd03480 Rieske_RO_Alpha_PaO Rieske non-heme iron oxygenase (RO) family, Pheophorbide a oxygenase (PaO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of a small subfamily of enzymes found in plants as well as oxygenic cyanobacterial photosynthesizers including LLS1 (lethal leaf spot 1, also known as PaO) and ACD1 (accelerated cell death 1) Back     alignment and domain information
>TIGR03171 soxL2 Rieske iron-sulfur protein SoxL2 Back     alignment and domain information
>cd03541 Rieske_RO_Alpha_CMO Rieske non-heme iron oxygenase (RO) family, Choline monooxygenase (CMO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>cd03539 Rieske_RO_Alpha_S5H This alignment model represents the N-terminal rieske iron-sulfur domain of the oxygenase alpha subunit (NagG) of salicylate 5-hydroxylase (S5H) Back     alignment and domain information
>cd03542 Rieske_RO_Alpha_HBDO Rieske non-heme iron oxygenase (RO) family, 2-Halobenzoate 1,2-dioxygenase (HBDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>cd03537 Rieske_RO_Alpha_PrnD This alignment model represents the N-terminal rieske domain of the oxygenase alpha subunit of aminopyrrolnitrin oxygenase (PrnD) Back     alignment and domain information
>PLN00095 chlorophyllide a oxygenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query221
1ezv_E185 Structure Of The Yeast Cytochrome Bc1 Complex Co- C 7e-20
3cwb_E196 Chicken Cytochrome Bc1 Complex Inhibited By An Iodi 2e-17
1bcc_E196 Cytochrome Bc1 Complex From Chicken Length = 196 5e-17
1qcr_E196 Crystal Structure Of Bovine Mitochondrial Cytochrom 6e-17
1rie_A129 Structure Of A Water Soluble Fragment Of The Rieske 1e-16
1zrt_E191 Rhodobacter Capsulatus Cytochrome Bc1 Complex With 3e-15
2yiu_C190 X-Ray Structure Of The Dimeric Cytochrome Bc1 Compl 4e-14
2fyn_C187 Crystal Structure Analysis Of The Double Mutant Rho 7e-13
2qjk_C179 Crystal Structure Analysis Of Mutant Rhodobacter Sp 8e-13
2qjp_C179 Crystal Structure Of Wild Type Rhodobacter Sphaeroi 9e-13
2nuk_A141 Soluble Domain Of The Rieske Iron-Sulfur Protein Fr 3e-12
2nvg_A141 Soluble Domain Of Rieske Iron Sulfur Protein Length 3e-12
2num_A141 Soluble Domain Of Rieske Iron-Sulfur Protein Length 3e-12
2nve_A141 Soluble Domain Of Rieske Iron Sulfur Protein Length 3e-12
2nvf_A141 Soluble Domain Of Rieske Iron-Sulfur Protein Length 3e-12
2nwf_A141 Soluble Domain Of Rieske Iron Sulfur Protein Length 4e-12
>pdb|1EZV|E Chain E, Structure Of The Yeast Cytochrome Bc1 Complex Co- Crystallized With An Antibody Fv-Fragment Length = 185 Back     alignment and structure 
Iteration: 1

 Score = 94.0 bits (232), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 56/74 (75%)
Query: 114 AFAYFVLTGGSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKN 173
           A A   +   +I  G  V VKW+GKPVFIR RT  +I+ ANSVD+ +L+DPQ DA+RVK+
Sbjct: 60  AMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKD 119
Query: 174 PEWLVVVGVCTHLG 187
           P+WL+++G+CTHLG
Sbjct: 120 PQWLIMLGICTHLG 133
>pdb|3CWB|E Chain E, Chicken Cytochrome Bc1 Complex Inhibited By An Iodinated Analogue Of The Polyketide Crocacin-d Length = 196 Back     alignment and structure
>pdb|1BCC|E Chain E, Cytochrome Bc1 Complex From Chicken Length = 196 Back     alignment and structure
>pdb|1QCR|E Chain E, Crystal Structure Of Bovine Mitochondrial Cytochrome Bc1 Complex, Alpha Carbon Atoms Only Length = 196 Back     alignment and structure
>pdb|1RIE|A Chain A, Structure Of A Water Soluble Fragment Of The Rieske Iron- Sulfur Protein Of The Bovine Heart Mitochondrial Cytochrome Bc1-complex Length = 129 Back     alignment and structure
>pdb|1ZRT|E Chain E, Rhodobacter Capsulatus Cytochrome Bc1 Complex With Stigmatellin Bound Length = 191 Back     alignment and structure
>pdb|2YIU|C Chain C, X-Ray Structure Of The Dimeric Cytochrome Bc1 Complex From The Soil Bacterium Paracoccus Denitrificans At 2.7 Angstrom Resolution Length = 190 Back     alignment and structure
>pdb|2FYN|C Chain C, Crystal Structure Analysis Of The Double Mutant Rhodobacter Sphaeroides Bc1 Complex Length = 187 Back     alignment and structure
>pdb|2QJK|C Chain C, Crystal Structure Analysis Of Mutant Rhodobacter Sphaeroides Bc1 With Stigmatellin And Antimycin Length = 179 Back     alignment and structure
>pdb|2QJP|C Chain C, Crystal Structure Of Wild Type Rhodobacter Sphaeroides With Stigmatellin And Antimycin Inhibited Length = 179 Back     alignment and structure
>pdb|2NUK|A Chain A, Soluble Domain Of The Rieske Iron-Sulfur Protein From Rhodobacter Sphaeroides Length = 141 Back     alignment and structure
>pdb|2NVG|A Chain A, Soluble Domain Of Rieske Iron Sulfur Protein Length = 141 Back     alignment and structure
>pdb|2NUM|A Chain A, Soluble Domain Of Rieske Iron-Sulfur Protein Length = 141 Back     alignment and structure
>pdb|2NVE|A Chain A, Soluble Domain Of Rieske Iron Sulfur Protein Length = 141 Back     alignment and structure
>pdb|2NVF|A Chain A, Soluble Domain Of Rieske Iron-Sulfur Protein Length = 141 Back     alignment and structure
>pdb|2NWF|A Chain A, Soluble Domain Of Rieske Iron Sulfur Protein Length = 141 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query221
2nwf_A141 Ubiquinol-cytochrome C reductase iron-sulfur SUBU; 3e-23
1rie_A129 Rieske iron-sulfur protein; oxidoreductase, cytoch 3e-19
3azc_A133 Cytochrome B6-F complex iron-sulfur subunit; riesk 6e-19
3cx5_E185 Cytochrome B-C1 complex subunit rieske, mitochondr 2e-14
2qjy_C187 Ubiquinol-cytochrome C reductase iron-sulfur SUBU; 6e-14
1pp9_E196 Ubiquinol-cytochrome C reductase iron-sulfur SUBU 7e-14
1nyk_A165 Rieske iron-sulfur protein; beta barrel, iron sulf 4e-12
1vf5_D179 Rieske iron-sulfur protein; photosynthesis, membra 2e-07
>2nwf_A Ubiquinol-cytochrome C reductase iron-sulfur SUBU; rieske [2Fe-2S] ISP, oxidoreductase; HET: GOL; 1.10A {Rhodobacter sphaeroides} PDB: 2nuk_A 2nve_A 2num_A 2nvg_A 2nvf_A Length = 141 Back     alignment and structure
 Score = 89.9 bits (223), Expect = 3e-23
 Identities = 37/90 (41%), Positives = 46/90 (51%), Gaps = 14/90 (15%)

Query: 123 GSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERV----------- 171
            S+EPG  +TVK+ GKP+FIRRRTE DI+L  SV LG L D       +           
Sbjct: 9   SSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNR 68

Query: 172 ---KNPEWLVVVGVCTHLGFARDQHHTIWK 198
              +  EWLV+ GVCTHLG       +   
Sbjct: 69  TLDEAGEWLVMWGVCTHLGCVPIGGVSGDF 98
>1rie_A Rieske iron-sulfur protein; oxidoreductase, cytochrome BC1 complex, histidine ligands, rieske iron-sulfur cluster, electron transport; 1.50A {Bos taurus} SCOP: b.33.1.1 Length = 129 Back     alignment and structure
>3azc_A Cytochrome B6-F complex iron-sulfur subunit; rieske, thermosynechococcus elongatu photosynthesis, electron transport; 2.00A {Thermosynechococcus elongatus} Length = 133 Back     alignment and structure
>3cx5_E Cytochrome B-C1 complex subunit rieske, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: b.33.1.1 f.23.12.1 PDB: 1kb9_E* 1kyo_E* 1p84_E* 2ibz_E* 1ezv_E* 3cxh_E* Length = 185 Back     alignment and structure
>2qjy_C Ubiquinol-cytochrome C reductase iron-sulfur SUBU; cytochrome B, 8 TM helixces cytochrome C1, 1 C-TERM TM helix 1 N-TERM TM helix; HET: BGL HEM SMA LOP UQ2; 2.40A {Rhodobacter sphaeroides} PDB: 2fyn_C* 2qjk_C* 2qjp_C* 1zrt_E* 2yiu_C* Length = 187 Back     alignment and structure
>1pp9_E Ubiquinol-cytochrome C reductase iron-sulfur SUBU mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: b.33.1.1 f.23.12.1 PDB: 1bgy_E* 1be3_E* 1l0n_E* 1ntk_E* 1ntm_E* 1ntz_E* 1nu1_E* 1l0l_E* 1ppj_E* 1qcr_E* 1sqb_E* 1sqp_E* 1sqq_E* 1sqv_E* 1sqx_E* 2a06_E* 2fyu_E* 2ybb_E* 1bcc_E* 2bcc_E* ... Length = 196 Back     alignment and structure
>1nyk_A Rieske iron-sulfur protein; beta barrel, iron sulfur cluster, electron transport; 1.31A {Thermus thermophilus} SCOP: b.33.1.1 PDB: 3fou_A Length = 165 Back     alignment and structure
>1vf5_D Rieske iron-sulfur protein; photosynthesis, membrane protein complex, electron transfer complex; HET: HEM TDS PL9 OPC CLA BCR; 3.00A {Mastigocladus laminosus} SCOP: b.33.1.1 f.23.12.1 PDB: 2d2c_D* 2e74_D* 2e75_D* 2e76_D* 2zt9_D* Length = 179 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query221
1pp9_E196 Ubiquinol-cytochrome C reductase iron-sulfur SUBU 99.94
3cx5_E185 Cytochrome B-C1 complex subunit rieske, mitochondr 99.92
2nwf_A141 Ubiquinol-cytochrome C reductase iron-sulfur SUBU; 99.9
2qjy_C187 Ubiquinol-cytochrome C reductase iron-sulfur SUBU; 99.78
1rie_A129 Rieske iron-sulfur protein; oxidoreductase, cytoch 99.7
1nyk_A165 Rieske iron-sulfur protein; beta barrel, iron sulf 99.17
1jm1_A204 Rieske iron-sulfur protein SOXF; electron transpor 98.48
1g8k_B133 Arsenite oxidase; molybdopterin, [3Fe-4S] cluster, 97.61
1vf5_D179 Rieske iron-sulfur protein; photosynthesis, membra 97.55
1fqt_A112 Rieske-type ferredoxin of biphenyl dioxygenase; 2F 97.43
3gce_A121 Ferredoxin component of carbazole 1,9A- dioxygenas 97.41
2qpz_A103 Naphthalene 1,2-dioxygenase system ferredoxin subu 97.37
3dqy_A106 Toluene 1,2-dioxygenase system ferredoxin subunit; 97.32
1vm9_A111 Toluene-4-monooxygenase system protein C; structur 97.1
2de6_D115 Ferredoxin component of carbazole; electron transf 97.07
4aay_B175 AROB; oxidoreductase, rieske, iron sulfur, molybdo 97.04
2i7f_A108 Ferredoxin component of dioxygenase; rieske ferred 96.96
2jo6_A113 Nitrite reductase [NAD(P)H] small subunit; all bet 96.5
3c0d_A119 Putative nitrite reductase NADPH (small subunit) o 96.29
2jza_A130 Nitrite reductase [NAD(P)H] small subunit; ISP dom 95.97
3d89_A157 Rieske domain-containing protein; CAsp target, rie 94.73
1rfs_A139 Rieske protein; iron-sulfur protein, electron tran 94.54
2de6_A 392 Terminal oxygenase component of carbazole; electro 92.07
3gcf_A 394 Terminal oxygenase component of carbazole 1,9A- di 92.0
2zyl_A 386 Possible oxidoreductase; KSHA, cholesterol, rieske 91.8
1z01_A 446 2-OXO-1,2-dihydroquinoline 8-monooxygenase, oxygen 91.67
3gke_A 349 DDMC; rieske cluster, non-heme mononuclear iron, o 91.64
3gkq_A 389 Terminal oxygenase component of carbazole 1,9A- di 91.3
3n0q_A 409 Putative aromatic-ring hydroxylating dioxygenase; 90.57
4aiv_A119 Probable nitrite reductase [NAD(P)H] small subuni; 89.8
3vca_A 412 Ring-hydroxylating dioxygenase; rieske-type, monon 89.55
2gbw_A 454 Biphenyl 2,3-dioxygenase alpha subunit; rieske oxy 89.52
2bmo_A 447 Oxygenase-alpha NBDO; nitrobenzene dioxygenase, ni 89.21
2b1x_A 470 Naphthalene dioxygenase large subunit; rieske non- 89.14
1uli_A 460 Biphenyl dioxygenase large subunit; alpha3 BETA3 h 85.91
3azc_A133 Cytochrome B6-F complex iron-sulfur subunit; riesk 85.67
3gzx_A 457 Biphenyl dioxygenase subunit alpha; rieskie, non-h 82.96
>1pp9_E Ubiquinol-cytochrome C reductase iron-sulfur SUBU mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: b.33.1.1 f.23.12.1 PDB: 1bgy_E* 1be3_E* 1l0n_E* 1ntk_E* 1ntm_E* 1ntz_E* 1nu1_E* 1l0l_E* 1ppj_E* 1qcr_E* 1sqb_E* 1sqp_E* 1sqq_E* 1sqv_E* 1sqx_E* 2a06_E* 2fyu_E* 2ybb_E* 1bcc_E* 2bcc_E* ... Back     alignment and structure
Probab=99.94  E-value=7.4e-28  Score=202.71  Aligned_cols=113  Identities=36%  Similarity=0.725  Sum_probs=100.7

Q ss_pred             cccCCCCCCchhh-hhhhcCCCccccccCCCcccCCCCCCCCcceeEEEeccC---------------------------
Q 027584           72 RNEESLVPGVPAT-VAAVKNPTSKIVYDEYNHERYPPGDPSKRAFAYFVLTGG---------------------------  123 (221)
Q Consensus        72 ~~~~~~~~~~p~~-~~~~k~Pt~~~~y~~~~~~~~~~~~~~kr~f~y~~~~~~---------------------------  123 (221)
                      +|||+.+|||..| +..++||+.+          ..+.+.+||.|+|+++|++                           
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~----------~~~~~~~RR~fl~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~a   70 (196)
T 1pp9_E            1 SHTDIKVPDFSDYRRPEVLDSTKS----------SKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLA   70 (196)
T ss_dssp             CGGGCCCCCCTTTBCGGGCCTTSC----------THHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCHHHHC
T ss_pred             CCCCcCCCCchHhhcccccCcccc----------cccCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCCccccc
Confidence            5999999999999 6789999855          2234567999999876521                           


Q ss_pred             ---------CCCCCCeEEEEECCeeEEEEeCCHHHHHHhhcCCCCCCCCCcccccccCCCcEEEEEcccCCcCcccCCCC
Q 027584          124 ---------SIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVGVCTHLGFARDQHH  194 (221)
Q Consensus       124 ---------~IepGq~vtVkWRGKPVFI~rRT~eeI~~l~~vd~~~LrDPqsd~~Rs~~PEwLVvIGICTHLGCIP~~~~  194 (221)
                               .|+||+.++|+|+||||||+|||++||+.++++++++|+||+++..|+.+++|++++++||||||+|.+..
T Consensus        71 ~~~v~v~ls~l~~G~~~~v~~~G~pV~V~r~t~~~i~~~~~~~~~~l~dp~~~~~r~~~ge~~a~~~~CtH~G~~l~~~~  150 (196)
T 1pp9_E           71 MSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANA  150 (196)
T ss_dssp             CCCEEEEGGGSCTTCEEEEEETTEEEEEEECCHHHHHHHHHSCTTTCSSCCCGGGTCSSTTEEEEECCCTTTSCCCEETC
T ss_pred             ccccEEEHHHCCCCCeEEEEECCEEEEEEECCHHHHhhhhccccccccCcccccccccCCeEEEEECccCCCCeeccccC
Confidence                     79999999999999999999999999999999999999999999999999999999999999999997653
>3cx5_E Cytochrome B-C1 complex subunit rieske, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: b.33.1.1 f.23.12.1 PDB: 1kb9_E* 1kyo_E* 1p84_E* 2ibz_E* 1ezv_E* 3cxh_E* Back     alignment and structure
>2nwf_A Ubiquinol-cytochrome C reductase iron-sulfur SUBU; rieske [2Fe-2S] ISP, oxidoreductase; HET: GOL; 1.10A {Rhodobacter sphaeroides} PDB: 2nuk_A 2nve_A 2num_A 2nvg_A 2nvf_A Back     alignment and structure
>2qjy_C Ubiquinol-cytochrome C reductase iron-sulfur SUBU; cytochrome B, 8 TM helixces cytochrome C1, 1 C-TERM TM helix 1 N-TERM TM helix; HET: BGL HEM SMA LOP UQ2; 2.40A {Rhodobacter sphaeroides} PDB: 2fyn_C* 2qjk_C* 2qjp_C* 1zrt_E* 2yiu_C* Back     alignment and structure
>1rie_A Rieske iron-sulfur protein; oxidoreductase, cytochrome BC1 complex, histidine ligands, rieske iron-sulfur cluster, electron transport; 1.50A {Bos taurus} SCOP: b.33.1.1 Back     alignment and structure
>1nyk_A Rieske iron-sulfur protein; beta barrel, iron sulfur cluster, electron transport; 1.31A {Thermus thermophilus} SCOP: b.33.1.1 PDB: 3fou_A Back     alignment and structure
>1jm1_A Rieske iron-sulfur protein SOXF; electron transport, respiratory chain, oxidoreductase; 1.11A {Sulfolobus acidocaldarius} SCOP: b.33.1.1 Back     alignment and structure
>1g8k_B Arsenite oxidase; molybdopterin, [3Fe-4S] cluster, [2Fe-2S] rieske, oxidoreductase; HET: MGD; 1.64A {Alcaligenes faecalis} SCOP: b.33.1.1 PDB: 1g8j_B* Back     alignment and structure
>1vf5_D Rieske iron-sulfur protein; photosynthesis, membrane protein complex, electron transfer complex; HET: HEM TDS PL9 OPC CLA BCR; 3.00A {Mastigocladus laminosus} SCOP: b.33.1.1 f.23.12.1 PDB: 2d2c_D* 2e74_D* 2e75_D* 2e76_D* 2zt9_D* Back     alignment and structure
>1fqt_A Rieske-type ferredoxin of biphenyl dioxygenase; 2Fe-2S cluster, beta sandwich, oxido; 1.60A {Burkholderia xenovorans} SCOP: b.33.1.1 PDB: 2e4q_A 2e4p_A 2yvj_B* Back     alignment and structure
>3gce_A Ferredoxin component of carbazole 1,9A- dioxygenase; rieske ferredoxin, 2Fe-2S, electron transfer, oxidoreductase; 2.00A {Nocardioides aromaticivorans} Back     alignment and structure
>2qpz_A Naphthalene 1,2-dioxygenase system ferredoxin subunit; rieske ferredoxin, 2Fe-2S, aromatic hydrocarbons catabolism, electron transport, iron; 1.85A {Pseudomonas putida} Back     alignment and structure
>3dqy_A Toluene 1,2-dioxygenase system ferredoxin subunit; rieske, iron-sulfur cluster, 2Fe-2S, aromatic hydrocarbons catabolism, electron transport; 1.20A {Pseudomonas putida} SCOP: b.33.1.0 PDB: 4emj_B* Back     alignment and structure
>1vm9_A Toluene-4-monooxygenase system protein C; structural genomics, CESG, protein structure initiative, PSI, ferredoxin, FES, [2Fe-2S] cluster; 1.48A {Pseudomonas mendocina} SCOP: b.33.1.1 PDB: 2q3w_A 1sjg_A Back     alignment and structure
>2de6_D Ferredoxin component of carbazole; electron transfer complex, rieske non-heme iron oxygenase system, terminal oxygenase; 1.80A {Pseudomonas resinovorans} PDB: 2de5_D 1vck_A 2de7_D* Back     alignment and structure
>4aay_B AROB; oxidoreductase, rieske, iron sulfur, molybdopterin; HET: MGD; 2.70A {Rhizobium species} Back     alignment and structure
>2i7f_A Ferredoxin component of dioxygenase; rieske ferredoxin, oxidoreductase; HET: CIT; 1.90A {Sphingobium yanoikuyae} Back     alignment and structure
>2jo6_A Nitrite reductase [NAD(P)H] small subunit; all beta, ISP domain, rieske iron-sulfur protein, 3-layer sandwich, structural genomics, PSI-2; NMR {Escherichia coli} SCOP: b.33.1.3 Back     alignment and structure
>3c0d_A Putative nitrite reductase NADPH (small subunit) oxidoreductase protein; NESG, VPR162, Q87HB1, XRAY, structure; 2.40A {Vibrio parahaemolyticus rimd 2210633} SCOP: b.33.1.3 Back     alignment and structure
>2jza_A Nitrite reductase [NAD(P)H] small subunit; ISP domain, rieske iron-sulfur protein, 3-layer beta- sandwich; NMR {Pectobacterium atrosepticum SCRI1043} SCOP: b.33.1.3 Back     alignment and structure
>3d89_A Rieske domain-containing protein; CAsp target, rieske ferredoxin, [2Fe-2S] cluster, protein ST initiative, PSI; 2.07A {Mus musculus} Back     alignment and structure
>1rfs_A Rieske protein; iron-sulfur protein, electron transport; 1.83A {Spinacia oleracea} SCOP: b.33.1.1 PDB: 1q90_C* Back     alignment and structure
>2de6_A Terminal oxygenase component of carbazole; electron transfer complex, rieske non-heme iron oxygenase system, terminal oxygenase; 1.80A {Janthinobacterium} SCOP: b.33.1.2 d.129.3.3 PDB: 1ww9_A 2de5_A 2de7_A* Back     alignment and structure
>3gcf_A Terminal oxygenase component of carbazole 1,9A- dioxygenase; rieske oxygenase, 2Fe-2S, electron transfer, oxidoreductase; 2.30A {Nocardioides aromaticivorans} Back     alignment and structure
>2zyl_A Possible oxidoreductase; KSHA, cholesterol, rieske; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1z01_A 2-OXO-1,2-dihydroquinoline 8-monooxygenase, oxygenase component; rieske center, oxygen binding/activation, substrate bound complex; 1.80A {Pseudomonas putida} SCOP: b.33.1.2 d.129.3.3 PDB: 1z02_A 1z03_A* Back     alignment and structure
>3gke_A DDMC; rieske cluster, non-heme mononuclear iron, oxygenase, oxidoreductase; 1.75A {Stenotrophomonas maltophilia} PDB: 3gb4_A 3gl0_A* 3gl2_A* 3gob_A* 3gte_A 3gts_A* Back     alignment and structure
>3gkq_A Terminal oxygenase component of carbazole 1,9A- dioxygenase; rieske nonheme iron oxygenase, electron transfer, putidaredoxin-type ferredoxin; 2.10A {Sphingomonas} Back     alignment and structure
>3n0q_A Putative aromatic-ring hydroxylating dioxygenase; rieske [2Fe-2S] domain, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.80A {Ruegeria SP} Back     alignment and structure
>4aiv_A Probable nitrite reductase [NAD(P)H] small subuni; oxidoreductase, nitrite metabolism; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3vca_A Ring-hydroxylating dioxygenase; rieske-type, mononuclear non-heme iron, N-demethylase, oxido; 1.59A {Sinorhizobium meliloti} PDB: 3vcp_A Back     alignment and structure
>2gbw_A Biphenyl 2,3-dioxygenase alpha subunit; rieske oxygenase, oxidoreductase, non heme iron; 1.70A {Sphingobium yanoikuyae} PDB: 2gbx_A* 2ckf_A Back     alignment and structure
>2bmo_A Oxygenase-alpha NBDO; nitrobenzene dioxygenase, nitroarene, rieske non-heme dioxygenase, substrate specificity iron- sulfur, metal-binding, NAD; 1.2A {Comamonas SP} SCOP: b.33.1.2 d.129.3.3 PDB: 2bmq_A 2bmr_A* 2hmj_A 2hml_A* 2hmn_A* 1o7n_A 1ndo_A 1o7g_A* 1o7h_A 1o7m_A 1eg9_A 1o7p_A* 1o7w_A 1uuv_A 1uuw_A 2hmk_A* 2hmm_A* 2hmo_A* Back     alignment and structure
>2b1x_A Naphthalene dioxygenase large subunit; rieske non-heme iron oxygenase, oxidoreductase; 2.00A {Rhodococcus SP} SCOP: b.33.1.2 d.129.3.3 PDB: 2b24_A Back     alignment and structure
>1uli_A Biphenyl dioxygenase large subunit; alpha3 BETA3 hetero hexamer, oxidoreductase; 2.20A {Rhodococcus SP} SCOP: b.33.1.2 d.129.3.3 PDB: 1ulj_A* 3en1_A* 3eqq_A Back     alignment and structure
>3azc_A Cytochrome B6-F complex iron-sulfur subunit; rieske, thermosynechococcus elongatu photosynthesis, electron transport; 2.00A {Thermosynechococcus elongatus} Back     alignment and structure
>3gzx_A Biphenyl dioxygenase subunit alpha; rieskie, non-heme iron, 2Fe-2S, aromatic hydroc catabolism, iron, iron-sulfur, metal-binding, NAD; HET: BNL MES; 1.58A {Comamonas testosteroni} PDB: 3gzy_A* 1wql_A 2xso_A 2xsh_A 2xrx_A* 2xr8_A* 2yfi_A 2yfj_A* 2yfl_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 221
d1riea_127 b.33.1.1 (A:) ISP subunit of the mitochondrial cyt 2e-17
d3cx5e1129 b.33.1.1 (E:87-215) ISP subunit of the mitochondri 6e-15
d1nyka_156 b.33.1.1 (A:) Soluble Rieske protein {Thermus ther 6e-10
d1jm1a_202 b.33.1.1 (A:) Rieske protein II (SoxF) {Archaeon S 0.002
>d1riea_ b.33.1.1 (A:) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]} Length = 127 Back     information, alignment and structure

class: All beta proteins
fold: ISP domain
superfamily: ISP domain
family: Rieske iron-sulfur protein (ISP)
domain: ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 73.2 bits (179), Expect = 2e-17
 Identities = 34/76 (44%), Positives = 49/76 (64%)

Query: 123 GSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVGV 182
             I  G  +  KWRGKP+F+R RT+++I    +V++  LRDPQ D ERVK PEW++++GV
Sbjct: 10  SDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGV 69

Query: 183 CTHLGFARDQHHTIWK 198
           CTHLG     +   + 
Sbjct: 70  CTHLGCVPIANAGDFG 85
>d3cx5e1 b.33.1.1 (E:87-215) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 129 Back     information, alignment and structure
>d1nyka_ b.33.1.1 (A:) Soluble Rieske protein {Thermus thermophilus [TaxId: 274]} Length = 156 Back     information, alignment and structure
>d1jm1a_ b.33.1.1 (A:) Rieske protein II (SoxF) {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 202 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query221
d1riea_127 ISP subunit of the mitochondrial cytochrome bc1-co 99.95
d3cx5e1129 ISP subunit of the mitochondrial cytochrome bc1-co 99.94
d1nyka_156 Soluble Rieske protein {Thermus thermophilus [TaxI 98.72
d1jm1a_202 Rieske protein II (SoxF) {Archaeon Sulfolobus acid 98.37
d1ppje269 Iron-sulfur subunit (ISP) of cytochrome bc1 comple 97.84
d1g8kb_133 Arsenite oxidase Rieske subunit {Alcaligenes faeca 96.56
d1fqta_109 Rieske-type ferredoxin associated with biphenyl di 96.33
d1z01a1148 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygen 96.14
d3c0da1108 NADH-nitrite reductase small subunit NirD {Vibrio 95.98
d1vm9a_109 Toluene-4-monooxygenase system protein C, TmoC {Ps 95.07
d2jo6a1108 NADH-nitrite reductase small subunit NirD {Escheri 94.83
d2de6a1142 Terminal oxygenase component of carbazole CarAa {J 94.77
d2jzaa1122 NADH-nitrite reductase small subunit NirD {Erwinia 94.39
d2e74d1134 ISP subunit from the cytochrome b6f complex, solub 93.78
d1rfsa_127 ISP subunit from chloroplast cytochrome bf complex 89.7
d1ulia1154 Biphenyl dioxygenase large subunit BphA1, N-termin 88.66
d3cx5e256 Iron-sulfur subunit (ISP) of cytochrome bc1 comple 87.16
d2bmoa1150 Nitrobenzene dioxygenase alpha subunit, NBDO-alpha 86.77
d2b1xa1162 Naphthalene 1,2-dioxygenase alpha subunit, N-domai 85.88
>d1riea_ b.33.1.1 (A:) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All beta proteins
fold: ISP domain
superfamily: ISP domain
family: Rieske iron-sulfur protein (ISP)
domain: ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.95  E-value=9.6e-29  Score=196.34  Aligned_cols=80  Identities=43%  Similarity=0.864  Sum_probs=75.2

Q ss_pred             eeEEEeccCCCCCCCeEEEEECCeeEEEEeCCHHHHHHhhcCCCCCCCCCcccccccCCCcEEEEEcccCCcCcccCCCC
Q 027584          115 FAYFVLTGGSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVGVCTHLGFARDQHH  194 (221)
Q Consensus       115 f~y~~~~~~~IepGq~vtVkWRGKPVFI~rRT~eeI~~l~~vd~~~LrDPqsd~~Rs~~PEwLVvIGICTHLGCIP~~~~  194 (221)
                      .+.+.+..++|+|||+++|+||||||||+|||++||+++..++.+.|+||+.+..|+.+++|+|++|+||||||+|.+..
T Consensus         2 ~A~veVDlS~lepG~~~~V~WrGkPvfV~rRt~e~i~~~~~~~~~~l~dp~~~~~r~~~~~~~~~~~~CtHlGC~~~~~~   81 (127)
T d1riea_           2 MSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANA   81 (127)
T ss_dssp             CSSEEEEGGGSCTTCEEEEEETTEEEEEEECCHHHHHHHHTCCGGGCSSCCCGGGTCSSTTEEEEECCCTTTSCCCEETC
T ss_pred             CCCEEEehhhCCCCCEEEEEECCceeEEEecCHHHhhhhhccchhhhcCccccccccccceEEEEEeccCCCCceeeccc
Confidence            45678888899999999999999999999999999999999999999999999999999999999999999999997754
>d3cx5e1 b.33.1.1 (E:87-215) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nyka_ b.33.1.1 (A:) Soluble Rieske protein {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jm1a_ b.33.1.1 (A:) Rieske protein II (SoxF) {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1ppje2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g8kb_ b.33.1.1 (B:) Arsenite oxidase Rieske subunit {Alcaligenes faecalis [TaxId: 511]} Back     information, alignment and structure
>d1fqta_ b.33.1.1 (A:) Rieske-type ferredoxin associated with biphenyl dioxygenase {Burkholderia cepacia [TaxId: 292]} Back     information, alignment and structure
>d1z01a1 b.33.1.2 (A:16-163) 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component OxoO {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3c0da1 b.33.1.3 (A:4-111) NADH-nitrite reductase small subunit NirD {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1vm9a_ b.33.1.1 (A:) Toluene-4-monooxygenase system protein C, TmoC {Pseudomonas mendocina [TaxId: 300]} Back     information, alignment and structure
>d2jo6a1 b.33.1.3 (A:1-108) NADH-nitrite reductase small subunit NirD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2de6a1 b.33.1.2 (A:1-142) Terminal oxygenase component of carbazole CarAa {Janthinobacterium sp. j3 [TaxId: 213804]} Back     information, alignment and structure
>d2jzaa1 b.33.1.3 (A:1-122) NADH-nitrite reductase small subunit NirD {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2e74d1 b.33.1.1 (D:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus [TaxId: 83541]} Back     information, alignment and structure
>d1rfsa_ b.33.1.1 (A:) ISP subunit from chloroplast cytochrome bf complex {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1ulia1 b.33.1.2 (A:17-170) Biphenyl dioxygenase large subunit BphA1, N-terminal domain {Rhodococcus sp. (strain RHA1) [TaxId: 101510]} Back     information, alignment and structure
>d3cx5e2 f.23.12.1 (E:31-86) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmoa1 b.33.1.2 (A:3-152) Nitrobenzene dioxygenase alpha subunit, NBDO-alpha {Comamonas sp. JS765 [TaxId: 58226]} Back     information, alignment and structure
>d2b1xa1 b.33.1.2 (A:1-162) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Rhodococcus sp. ncimb12038 [TaxId: 92694]} Back     information, alignment and structure