Citrus Sinensis ID: 027708


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220
MANSKGGKRSVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQQTYSETRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGATYEGHPEFIRLFLKALGGTITGSDKRILFLCGVSFCFQNLLE
cccccccccEEEEEEccccHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccccccccccccccEEEEEcccccccccccccEEEEccccccHHHcccHHHHHHHHHHHHccccEEEEccHHHHHHHHcccccEEEEcccccHHHHHHcccEEEcccccccEEEcccEEEccccccHHHHHHHHHHHHcccccccccEEEEEcccccccccccc
ccHHHHHHcEEEEEEcccHHHHHHHHHHHHHHHHccEEEEEccccccccEEEEEEEEcccccccEccccccEEEccEEHHHccHHHccEEEEccEcHHHHHcccHHHHHHHHHHHHccccEEEEccccHHHHHHccccccEEcccHHHHHHHHHcccEEcccccEccEEEcccEEccccccccHHHHHHHHHHHcccEcccccEEEEEccHHHHHHHHcc
manskggkrSVLLLCGDYMEDYEAMVPFQALLAFGvsvdaacpgkksgdvcptavhqstghqqtysetrghnfalnatfdeidptkydglvipggrapeylamnDSVIDLVRKFSNSGKTIASICHGQLILAAADVvkgrkctayppvkpVLIAagaswiepetMAACVvdgniitgatyegHPEFIRLFLKAlggtitgsdkRILFLCGVSFCFQNLLE
manskggkrsVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQstghqqtysetRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGATYEGHPEFIRLFLKALGGTITGSDKRILFLCGVSFCFQNLLE
MANSKGGKRSVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQQTYSETRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGATYEGHPEFIRLFLKALGGTITGSDKRILFLCGVSFCFQNLLE
*********SVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAV************TRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGATYEGHPEFIRLFLKALGGTITGSDKRILFLCGVSFCFQNL**
******G****LLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQQTYSETRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGATYEGHPEFIRLFLKALGGTITGSDKRILFLCGVSFCFQNLLE
********RSVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTA***********SETRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGATYEGHPEFIRLFLKALGGTITGSDKRILFLCGVSFCFQNLLE
*ANSKGGKRSVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQQTYSETRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGATYEGHPEFIRLFLKALGGTITGSDKRILFLCGVSFCFQNLLE
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANSKGGKRSVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQQTYSETRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGATYEGHPEFIRLFLKALGGTITGSDKRILFLCGVSFCFQNLLE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query220 2.2.26 [Sep-21-2011]
Q9M8R4 388 Protein DJ-1 homolog D OS yes no 0.931 0.528 0.738 2e-87
O59413166 Intracellular protease 1 yes no 0.745 0.987 0.340 2e-25
Q9V1F8166 Intracellular protease 1 yes no 0.722 0.957 0.353 3e-24
Q51732166 Intracellular protease 1 yes no 0.727 0.963 0.335 3e-24
Q5JGM7166 Intracellular protease 1 yes no 0.718 0.951 0.347 2e-22
O28987168 Uncharacterized protein A yes no 0.745 0.976 0.313 1e-18
P45470172 Protein YhbO OS=Escherich N/A no 0.522 0.668 0.388 9e-18
O06006169 Putative cysteine proteas yes no 0.754 0.982 0.279 7e-14
Q58377205 Uncharacterized protein M yes no 0.595 0.639 0.34 8e-14
P80876172 General stress protein 18 no no 0.636 0.813 0.274 1e-11
>sp|Q9M8R4|DJ1D_ARATH Protein DJ-1 homolog D OS=Arabidopsis thaliana GN=DJ1D PE=1 SV=1 Back     alignment and function desciption
 Score =  321 bits (823), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 155/210 (73%), Positives = 176/210 (83%), Gaps = 5/210 (2%)

Query: 1   MANSKGGKRSVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTG 60
           MANS    R+VL+LCGDYMEDYE MVPFQAL AFG++V   CPGKK+GD CPTAVH   G
Sbjct: 1   MANS----RTVLILCGDYMEDYEVMVPFQALQAFGITVHTVCPGKKAGDSCPTAVHDFCG 56

Query: 61  HQQTYSETRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKT 120
           HQ TY E+RGHNF LNATFDE+D +KYDGLVIPGGRAPEYLA+  SV++LV++FS SGK 
Sbjct: 57  HQ-TYFESRGHNFTLNATFDEVDLSKYDGLVIPGGRAPEYLALTASVVELVKEFSRSGKP 115

Query: 121 IASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGATY 180
           IASICHGQLILAAAD V GRKCTAY  V P L+AAGA W+EP T   CVVDG++IT ATY
Sbjct: 116 IASICHGQLILAAADTVNGRKCTAYATVGPSLVAAGAKWVEPITPDVCVVDGSLITAATY 175

Query: 181 EGHPEFIRLFLKALGGTITGSDKRILFLCG 210
           EGHPEFI+LF+KALGG ITG++KRILFLCG
Sbjct: 176 EGHPEFIQLFVKALGGKITGANKRILFLCG 205




May be involved in oxidative stress response.
Arabidopsis thaliana (taxid: 3702)
>sp|O59413|PFPI_PYRHO Intracellular protease 1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pfpI PE=1 SV=1 Back     alignment and function description
>sp|Q9V1F8|PFPI_PYRAB Intracellular protease 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pfpI PE=3 SV=1 Back     alignment and function description
>sp|Q51732|PFPI_PYRFU Intracellular protease 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pfpI PE=1 SV=1 Back     alignment and function description
>sp|Q5JGM7|PFPI_PYRKO Intracellular protease 1 OS=Pyrococcus kodakaraensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pfpI PE=3 SV=1 Back     alignment and function description
>sp|O28987|Y1281_ARCFU Uncharacterized protein AF_1281 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1281 PE=3 SV=1 Back     alignment and function description
>sp|P45470|YHBO_ECOLI Protein YhbO OS=Escherichia coli (strain K12) GN=yhbO PE=1 SV=2 Back     alignment and function description
>sp|O06006|YRAA_BACSU Putative cysteine protease YraA OS=Bacillus subtilis (strain 168) GN=yraA PE=2 SV=2 Back     alignment and function description
>sp|Q58377|Y967_METJA Uncharacterized protein MJ0967 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0967 PE=3 SV=1 Back     alignment and function description
>sp|P80876|GS18_BACSU General stress protein 18 OS=Bacillus subtilis (strain 168) GN=yfkM PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query220
255570457 388 protease C56, putative [Ricinus communis 0.954 0.541 0.770 4e-96
224134735 386 predicted protein [Populus trichocarpa] 0.95 0.541 0.769 1e-93
118483416 386 unknown [Populus trichocarpa] 0.95 0.541 0.769 1e-93
359476496 529 PREDICTED: uncharacterized protein LOC10 0.913 0.379 0.806 1e-92
297738171 386 unnamed protein product [Vitis vinifera] 0.913 0.520 0.806 2e-92
449469102 390 PREDICTED: uncharacterized protein LOC10 0.940 0.530 0.780 2e-92
255570459 386 protease C56, putative [Ricinus communis 0.95 0.541 0.741 2e-88
357166678 388 PREDICTED: uncharacterized protein LOC10 0.913 0.518 0.757 3e-88
115461240 387 Os04g0671700 [Oryza sativa Japonica Grou 0.913 0.519 0.747 1e-86
226498180 387 YLS5 [Zea mays] gi|194688460|gb|ACF78314 0.913 0.519 0.747 3e-86
>gi|255570457|ref|XP_002526187.1| protease C56, putative [Ricinus communis] gi|223534491|gb|EEF36191.1| protease C56, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  356 bits (914), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 168/218 (77%), Positives = 197/218 (90%), Gaps = 8/218 (3%)

Query: 8   KRSVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQQTYSE 67
           +++V LLCGDYMEDYEAMVPFQALLA+GV+VDAACPGKK+GD C TA+H+S+GHQ TYSE
Sbjct: 4   QKTVFLLCGDYMEDYEAMVPFQALLAYGVAVDAACPGKKAGDYCRTAIHESSGHQ-TYSE 62

Query: 68  TRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHG 127
           +RGHNF LN+TFD+ID  KYDGLVIPGGRAPEYLAMN+SV+D VRKF+++GK IAS+CHG
Sbjct: 63  SRGHNFTLNSTFDDIDFGKYDGLVIPGGRAPEYLAMNESVLDCVRKFADAGKPIASVCHG 122

Query: 128 QLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGATYEGHPEFI 187
           QLILAAA +VKGRKCTAYPPV+PVLIAAGA W+EPETMA+CV DGN+ITGATYEGHPEFI
Sbjct: 123 QLILAAAGLVKGRKCTAYPPVRPVLIAAGAHWVEPETMASCVADGNLITGATYEGHPEFI 182

Query: 188 RLFLKALGGTITGSDKRILFLCG-------VSFCFQNL 218
           +LF+KALGG+ITG+DKRILFLCG       V+  FQ+L
Sbjct: 183 QLFVKALGGSITGADKRILFLCGDYMEDYEVTVPFQSL 220




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224134735|ref|XP_002327476.1| predicted protein [Populus trichocarpa] gi|222836030|gb|EEE74451.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118483416|gb|ABK93608.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359476496|ref|XP_002272841.2| PREDICTED: uncharacterized protein LOC100247956 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297738171|emb|CBI27372.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449469102|ref|XP_004152260.1| PREDICTED: uncharacterized protein LOC101208672 [Cucumis sativus] gi|449484302|ref|XP_004156844.1| PREDICTED: uncharacterized LOC101208672 [Cucumis sativus] Back     alignment and taxonomy information
>gi|255570459|ref|XP_002526188.1| protease C56, putative [Ricinus communis] gi|223534492|gb|EEF36192.1| protease C56, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357166678|ref|XP_003580796.1| PREDICTED: uncharacterized protein LOC100841497 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|115461240|ref|NP_001054220.1| Os04g0671700 [Oryza sativa Japonica Group] gi|70663940|emb|CAE03602.2| OSJNBb0004A17.4 [Oryza sativa Japonica Group] gi|90265250|emb|CAH67703.1| H0624F09.11 [Oryza sativa Indica Group] gi|113565791|dbj|BAF16134.1| Os04g0671700 [Oryza sativa Japonica Group] gi|125592020|gb|EAZ32370.1| hypothetical protein OsJ_16581 [Oryza sativa Japonica Group] gi|215704721|dbj|BAG94749.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|226498180|ref|NP_001146927.1| YLS5 [Zea mays] gi|194688460|gb|ACF78314.1| unknown [Zea mays] gi|195605312|gb|ACG24486.1| YLS5 [Zea mays] gi|414584851|tpg|DAA35422.1| TPA: YLS5 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query220
TAIR|locus:2075532 388 DJ1D [Arabidopsis thaliana (ta 0.931 0.528 0.738 1.2e-81
DICTYBASE|DDB_G0276405194 pfp1 "DJ-1/ThiJ/PfpI family pr 0.863 0.979 0.445 3.2e-42
UNIPROTKB|Q8EH52186 SO_1378 "Peptidase family 56" 0.831 0.983 0.470 3.6e-41
TIGR_CMR|SO_1378186 SO_1378 "ThiJ/PfpI family prot 0.831 0.983 0.470 3.6e-41
TAIR|locus:2064955398 YLS5 [Arabidopsis thaliana (ta 0.845 0.467 0.428 4.4e-36
TIGR_CMR|GSU_1159167 GSU_1159 "intracellular protea 0.568 0.748 0.335 2.4e-19
UNIPROTKB|P45470172 yhbO "protein involved in stre 0.640 0.819 0.352 1.7e-18
UNIPROTKB|Q81UM2171 BAS0802 "ThiJ/pfpI family prot 0.763 0.982 0.263 1.5e-12
TIGR_CMR|BA_0842171 BA_0842 "thiJ/pfpI family prot 0.763 0.982 0.263 1.5e-12
UNIPROTKB|Q3ZA81180 DET0118 "DJ-1 family protein" 0.509 0.622 0.305 4.1e-10
TAIR|locus:2075532 DJ1D [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 819 (293.4 bits), Expect = 1.2e-81, P = 1.2e-81
 Identities = 155/210 (73%), Positives = 176/210 (83%)

Query:     1 MANSKGGKRSVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTG 60
             MANS    R+VL+LCGDYMEDYE MVPFQAL AFG++V   CPGKK+GD CPTAVH   G
Sbjct:     1 MANS----RTVLILCGDYMEDYEVMVPFQALQAFGITVHTVCPGKKAGDSCPTAVHDFCG 56

Query:    61 HQQTYSETRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKT 120
             HQ TY E+RGHNF LNATFDE+D +KYDGLVIPGGRAPEYLA+  SV++LV++FS SGK 
Sbjct:    57 HQ-TYFESRGHNFTLNATFDEVDLSKYDGLVIPGGRAPEYLALTASVVELVKEFSRSGKP 115

Query:   121 IASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGATY 180
             IASICHGQLILAAAD V GRKCTAY  V P L+AAGA W+EP T   CVVDG++IT ATY
Sbjct:   116 IASICHGQLILAAADTVNGRKCTAYATVGPSLVAAGAKWVEPITPDVCVVDGSLITAATY 175

Query:   181 EGHPEFIRLFLKALGGTITGSDKRILFLCG 210
             EGHPEFI+LF+KALGG ITG++KRILFLCG
Sbjct:   176 EGHPEFIQLFVKALGGKITGANKRILFLCG 205


GO:0005737 "cytoplasm" evidence=ISM
GO:0016798 "hydrolase activity, acting on glycosyl bonds" evidence=IEA
DICTYBASE|DDB_G0276405 pfp1 "DJ-1/ThiJ/PfpI family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q8EH52 SO_1378 "Peptidase family 56" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1378 SO_1378 "ThiJ/PfpI family protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TAIR|locus:2064955 YLS5 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1159 GSU_1159 "intracellular protease, PfpI family" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|P45470 yhbO "protein involved in stress response" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q81UM2 BAS0802 "ThiJ/pfpI family protein" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0842 BA_0842 "thiJ/pfpI family protein" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZA81 DET0118 "DJ-1 family protein" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M8R4DJ1D_ARATHNo assigned EC number0.73800.93180.5283yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00440207
SubName- Full=Putative uncharacterized protein; (387 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query220
cd03169180 cd03169, GATase1_PfpI_1, Type 1 glutamine amidotra 3e-95
TIGR01382166 TIGR01382, PfpI, intracellular protease, PfpI fami 1e-53
cd03134165 cd03134, GATase1_PfpI_like, A type 1 glutamine ami 3e-44
COG0693188 COG0693, ThiJ, Putative intracellular protease/ami 4e-38
pfam01965142 pfam01965, DJ-1_PfpI, DJ-1/PfpI family 7e-35
cd03135163 cd03135, GATase1_DJ-1, Type 1 glutamine amidotrans 1e-21
cd03141221 cd03141, GATase1_Hsp31_like, Type 1 glutamine amid 6e-17
cd03139183 cd03139, GATase1_PfpI_2, Type 1 glutamine amidotra 1e-15
TIGR01383179 TIGR01383, not_thiJ, DJ-1 family protein 3e-14
cd03140170 cd03140, GATase1_PfpI_3, Type 1 glutamine amidotra 7e-11
pfam13278164 pfam13278, DUF4066, Putative amidotransferase 1e-09
cd01653115 cd01653, GATase1, Type 1 glutamine amidotransferas 3e-08
cd0312892 cd03128, GAT_1, Type 1 glutamine amidotransferase 6e-08
cd03138195 cd03138, GATase1_AraC_2, AraC transcriptional regu 2e-06
cd03137187 cd03137, GATase1_AraC_1, AraC transcriptional regu 3e-06
cd03136185 cd03136, GATase1_AraC_ArgR_like, AraC transcriptio 9e-06
cd03147231 cd03147, GATase1_Ydr533c_like, Type 1 glutamine am 9e-06
COG4977 328 COG4977, COG4977, Transcriptional regulator contai 1e-05
cd01744178 cd01744, GATase1_CPSase, Small chain of the glutam 5e-05
pfam00117186 pfam00117, GATase, Glutamine amidotransferase clas 0.001
TIGR01737227 TIGR01737, FGAM_synth_I, phosphoribosylformylglyci 0.003
>gnl|CDD|153243 cd03169, GATase1_PfpI_1, Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
 Score =  275 bits (706), Expect = 3e-95
 Identities = 98/185 (52%), Positives = 125/185 (67%), Gaps = 5/185 (2%)

Query: 10  SVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQQTYSETR 69
            +L+L GD++EDYE MVPFQAL   G  VD   PGKK GD   TA+H   G Q TY+E  
Sbjct: 1   KILILTGDFVEDYEVMVPFQALQEVGHEVDVVAPGKKKGDTVVTAIHDFPGWQ-TYTEKP 59

Query: 70  GHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQL 129
           GH FA+ A FDE+DP  YD LVIPGGRAPEYL +++ V+ +VR F+ + K +A+ICHG  
Sbjct: 60  GHRFAVTADFDEVDPDDYDALVIPGGRAPEYLRLDEKVLAIVRHFAEANKPVAAICHGPQ 119

Query: 130 ILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGATYEGHPEFIRL 189
           ILAAA V+KGR+CTAYP  KP +  AG + ++       VVDGN++T   +  HP F+R 
Sbjct: 120 ILAAAGVLKGRRCTAYPACKPEVELAGGTVVDD----GVVVDGNLVTAQAWPDHPAFLRE 175

Query: 190 FLKAL 194
           FLK L
Sbjct: 176 FLKLL 180


Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. PfpI is an ATP-independent intracellular proteases which may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. Length = 180

>gnl|CDD|233389 TIGR01382, PfpI, intracellular protease, PfpI family Back     alignment and domain information
>gnl|CDD|153228 cd03134, GATase1_PfpI_like, A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus Back     alignment and domain information
>gnl|CDD|223765 COG0693, ThiJ, Putative intracellular protease/amidase [General function prediction only] Back     alignment and domain information
>gnl|CDD|216814 pfam01965, DJ-1_PfpI, DJ-1/PfpI family Back     alignment and domain information
>gnl|CDD|153229 cd03135, GATase1_DJ-1, Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1 Back     alignment and domain information
>gnl|CDD|153235 cd03141, GATase1_Hsp31_like, Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein Back     alignment and domain information
>gnl|CDD|153233 cd03139, GATase1_PfpI_2, Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>gnl|CDD|213612 TIGR01383, not_thiJ, DJ-1 family protein Back     alignment and domain information
>gnl|CDD|153234 cd03140, GATase1_PfpI_3, Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>gnl|CDD|222020 pfam13278, DUF4066, Putative amidotransferase Back     alignment and domain information
>gnl|CDD|153210 cd01653, GATase1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|153222 cd03128, GAT_1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|153232 cd03138, GATase1_AraC_2, AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|153231 cd03137, GATase1_AraC_1, AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|153230 cd03136, GATase1_AraC_ArgR_like, AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|153241 cd03147, GATase1_Ydr533c_like, Type 1 glutamine amidotransferase (GATase1)-like domain found in Saccharomyces cerevisiae Ydr533c protein Back     alignment and domain information
>gnl|CDD|227311 COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription] Back     alignment and domain information
>gnl|CDD|153215 cd01744, GATase1_CPSase, Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>gnl|CDD|215729 pfam00117, GATase, Glutamine amidotransferase class-I Back     alignment and domain information
>gnl|CDD|233553 TIGR01737, FGAM_synth_I, phosphoribosylformylglycinamidine synthase I Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 220
TIGR01382166 PfpI intracellular protease, PfpI family. The memb 100.0
cd03134165 GATase1_PfpI_like A type 1 glutamine amidotransfer 100.0
cd03135163 GATase1_DJ-1 Type 1 glutamine amidotransferase (GA 100.0
cd03169180 GATase1_PfpI_1 Type 1 glutamine amidotransferase ( 100.0
TIGR01383179 not_thiJ DJ-1 family protein. This model represent 100.0
cd03137187 GATase1_AraC_1 AraC transcriptional regulators hav 100.0
cd03139183 GATase1_PfpI_2 Type 1 glutamine amidotransferase ( 100.0
cd03136185 GATase1_AraC_ArgR_like AraC transcriptional regula 100.0
PRK09393 322 ftrA transcriptional activator FtrA; Provisional 100.0
PF13278166 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3M 100.0
cd03138195 GATase1_AraC_2 AraC transcriptional regulators hav 100.0
cd03140170 GATase1_PfpI_3 Type 1 glutamine amidotransferase ( 100.0
COG4977 328 Transcriptional regulator containing an amidase do 100.0
PRK11574196 oxidative-stress-resistance chaperone; Provisional 100.0
KOG2764247 consensus Putative transcriptional regulator DJ-1 99.98
cd03147231 GATase1_Ydr533c_like Type 1 glutamine amidotransfe 99.97
cd03141221 GATase1_Hsp31_like Type 1 glutamine amidotransfera 99.97
PRK04155287 chaperone protein HchA; Provisional 99.97
COG0693188 ThiJ Putative intracellular protease/amidase [Gene 99.97
cd03148232 GATase1_EcHsp31_like Type 1 glutamine amidotransfe 99.97
PF01965147 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 T 99.96
PRK11780217 isoprenoid biosynthesis protein with amidotransfer 99.95
cd03133213 GATase1_ES1 Type 1 glutamine amidotransferase (GAT 99.94
cd03132142 GATase1_catalase Type 1 glutamine amidotransferase 99.91
PRK11249752 katE hydroperoxidase II; Provisional 99.75
cd01740238 GATase1_FGAR_AT Type 1 glutamine amidotransferase 99.42
PRK03619219 phosphoribosylformylglycinamidine synthase I; Prov 99.41
COG3155217 ElbB Uncharacterized protein involved in an early 99.37
PRK01175261 phosphoribosylformylglycinamidine synthase I; Prov 99.35
TIGR01737227 FGAM_synth_I phosphoribosylformylglycinamidine syn 99.25
COG0047231 PurL Phosphoribosylformylglycinamidine (FGAM) synt 99.24
cd01653115 GATase1 Type 1 glutamine amidotransferase (GATase1 99.03
PRK13526179 glutamine amidotransferase subunit PdxT; Provision 98.98
TIGR03800184 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, gl 98.97
PRK13527200 glutamine amidotransferase subunit PdxT; Provision 98.92
PF13507259 GATase_5: CobB/CobQ-like glutamine amidotransferas 98.85
cd0312892 GAT_1 Type 1 glutamine amidotransferase (GATase1)- 98.81
PRK13525189 glutamine amidotransferase subunit PdxT; Provision 98.75
PLN02832248 glutamine amidotransferase subunit of pyridoxal 5' 98.59
cd03130198 GATase1_CobB Type 1 glutamine amidotransferase (GA 98.53
PRK08250235 glutamine amidotransferase; Provisional 98.51
cd01750194 GATase1_CobQ Type 1 glutamine amidotransferase (GA 98.46
PRK13143200 hisH imidazole glycerol phosphate synthase subunit 98.46
PRK07053234 glutamine amidotransferase; Provisional 98.45
cd01749183 GATase1_PB Glutamine Amidotransferase (GATase_I) i 98.41
TIGR018571239 FGAM-synthase phosphoribosylformylglycinamidine sy 98.4
PLN032061307 phosphoribosylformylglycinamidine synthase; Provis 98.34
COG0311194 PDX2 Predicted glutamine amidotransferase involved 98.3
CHL00188210 hisH imidazole glycerol phosphate synthase subunit 98.28
cd01741188 GATase1_1 Subgroup of proteins having the Type 1 g 98.26
TIGR017351310 FGAM_synt phosphoribosylformylglycinamidine syntha 98.26
PRK052971290 phosphoribosylformylglycinamidine synthase; Provis 98.25
PRK01077451 cobyrinic acid a,c-diamide synthase; Validated 98.23
PRK06490239 glutamine amidotransferase; Provisional 98.23
PHA033661304 FGAM-synthase; Provisional 98.14
cd01748198 GATase1_IGP_Synthase Type 1 glutamine amidotransfe 98.12
PRK06895190 putative anthranilate synthase component II; Provi 98.12
PRK13141205 hisH imidazole glycerol phosphate synthase subunit 98.11
PRK13146209 hisH imidazole glycerol phosphate synthase subunit 98.07
TIGR017391202 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM 98.06
cd01744178 GATase1_CPSase Small chain of the glutamine-depend 98.03
PRK09065237 glutamine amidotransferase; Provisional 97.99
PRK05665240 amidotransferase; Provisional 97.97
PF07685158 GATase_3: CobB/CobQ-like glutamine amidotransferas 97.89
TIGR00888188 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N 97.85
PF01174188 SNO: SNO glutamine amidotransferase family; InterP 97.84
TIGR00379449 cobB cobyrinic acid a,c-diamide synthase. This mod 97.83
PRK13170196 hisH imidazole glycerol phosphate synthase subunit 97.78
PRK00784488 cobyric acid synthase; Provisional 97.76
PRK07567242 glutamine amidotransferase; Provisional 97.76
PRK08007187 para-aminobenzoate synthase component II; Provisio 97.76
PRK13181199 hisH imidazole glycerol phosphate synthase subunit 97.75
PRK07765214 para-aminobenzoate synthase component II; Provisio 97.75
TIGR01855196 IMP_synth_hisH imidazole glycerol phosphate syntha 97.75
PRK06774191 para-aminobenzoate synthase component II; Provisio 97.74
COG0518198 GuaA GMP synthase - Glutamine amidotransferase dom 97.74
COG0118204 HisH Glutamine amidotransferase [Amino acid transp 97.68
TIGR00566188 trpG_papA glutamine amidotransferase of anthranila 97.67
PLN02617 538 imidazole glycerol phosphate synthase hisHF 97.66
cd01742181 GATase1_GMP_Synthase Type 1 glutamine amidotransfe 97.61
PRK05670189 anthranilate synthase component II; Provisional 97.54
PRK12564360 carbamoyl phosphate synthase small subunit; Review 97.54
PRK05637208 anthranilate synthase component II; Provisional 97.46
PRK08857193 para-aminobenzoate synthase component II; Provisio 97.46
CHL00101190 trpG anthranilate synthase component 2 97.45
PRK07649195 para-aminobenzoate/anthranilate synthase glutamine 97.42
CHL00197382 carA carbamoyl-phosphate synthase arginine-specifi 97.4
PRK13152201 hisH imidazole glycerol phosphate synthase subunit 97.4
PLN02335222 anthranilate synthase 97.39
cd01743184 GATase1_Anthranilate_Synthase Type 1 glutamine ami 97.35
PRK13566720 anthranilate synthase; Provisional 97.34
PRK00758184 GMP synthase subunit A; Validated 97.32
PRK13142192 hisH imidazole glycerol phosphate synthase subunit 97.31
PRK13896433 cobyrinic acid a,c-diamide synthase; Provisional 97.31
TIGR01368358 CPSaseIIsmall carbamoyl-phosphate synthase, small 97.28
PRK14004210 hisH imidazole glycerol phosphate synthase subunit 97.28
cd01745189 GATase1_2 Subgroup of proteins having the Type 1 g 97.24
PF00117192 GATase: Glutamine amidotransferase class-I; InterP 97.23
COG1797451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme 97.2
cd03146212 GAT1_Peptidase_E Type 1 glutamine amidotransferase 97.18
TIGR01815717 TrpE-clade3 anthranilate synthase, alpha proteobac 97.15
PRK06278 476 cobyrinic acid a,c-diamide synthase; Validated 97.15
cd03144114 GATase1_ScBLP_like Type 1 glutamine amidotransfera 97.15
TIGR00313475 cobQ cobyric acid synthase CobQ. 97.1
PRK05282233 (alpha)-aspartyl dipeptidase; Validated 97.05
PRK12838354 carbamoyl phosphate synthase small subunit; Review 97.04
cd01746235 GATase1_CTP_Synthase Type 1 glutamine amidotransfe 96.72
PF09825 367 BPL_N: Biotin-protein ligase, N terminal; InterPro 96.69
KOG3210226 consensus Imidazoleglycerol-phosphate synthase sub 96.64
PLN02347 536 GMP synthetase 96.57
PLN02771415 carbamoyl-phosphate synthase (glutamine-hydrolyzin 96.51
COG0512191 PabA Anthranilate/para-aminobenzoate synthases com 96.47
PRK11366254 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; 96.46
PRK09522 531 bifunctional glutamine amidotransferase/anthranila 96.24
PRK14607 534 bifunctional glutamine amidotransferase/anthranila 96.23
PRK00074 511 guaA GMP synthase; Reviewed 96.21
PRK05380533 pyrG CTP synthetase; Validated 95.91
COG2071243 Predicted glutamine amidotransferases [General fun 95.88
PRK06186229 hypothetical protein; Validated 95.77
cd03129210 GAT1_Peptidase_E_like Type 1 glutamine amidotransf 95.74
cd01747273 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidot 95.18
COG0505368 CarA Carbamoylphosphate synthase small subunit [Am 95.17
COG3442250 Predicted glutamine amidotransferase [General func 94.99
COG1492486 CobQ Cobyric acid synthase [Coenzyme metabolism] 94.98
PLN02327557 CTP synthase 94.8
TIGR00337525 PyrG CTP synthase. CTP synthase is involved in pyr 94.72
PF1358738 DJ-1_PfpI_N: N-terminal domain of DJ-1_PfpI family 94.62
KOG3179245 consensus Predicted glutamine synthetase [Nucleoti 94.5
PRK05368302 homoserine O-succinyltransferase; Provisional 94.42
TIGR02069250 cyanophycinase cyanophycinase. This model describe 94.02
PF07722217 Peptidase_C26: Peptidase C26; InterPro: IPR011697 93.45
TIGR01823 742 PabB-fungal aminodeoxychorismate synthase, fungal 93.35
PF03575154 Peptidase_S51: Peptidase family S51; InterPro: IPR 93.11
PLN02889 918 oxo-acid-lyase/anthranilate synthase 93.01
KOG19071320 consensus Phosphoribosylformylglycinamidine syntha 92.75
KOG0370 1435 consensus Multifunctional pyrimidine synthesis pro 92.58
cd03145217 GAT1_cyanophycinase Type 1 glutamine amidotransfer 92.04
COG0504533 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide 91.93
cd03131175 GATase1_HTS Type 1 glutamine amidotransferase (GAT 90.95
KOG2764247 consensus Putative transcriptional regulator DJ-1 90.89
PF09822271 ABC_transp_aux: ABC-type uncharacterized transport 89.61
COG4285253 Uncharacterized conserved protein [Function unknow 89.3
PRK02645 305 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 89.16
COG4635175 HemG Flavodoxin [Energy production and conversion 88.97
COG3340224 PepE Peptidase E [Amino acid transport and metabol 88.7
PRK01231 295 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 87.19
KOG2387585 consensus CTP synthase (UTP-ammonia lyase) [Nucleo 85.79
PRK11104177 hemG protoporphyrinogen oxidase; Provisional 84.59
PRK02155 291 ppnK NAD(+)/NADH kinase family protein; Provisiona 84.39
PF08532207 Glyco_hydro_42M: Beta-galactosidase trimerisation 82.71
KOG0623 541 consensus Glutamine amidotransferase/cyclase [Amin 82.22
cd03143154 A4_beta-galactosidase_middle_domain A4 beta-galact 81.9
PRK03378 292 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 80.35
PF0369880 UPF0180: Uncharacterised protein family (UPF0180); 80.15
>TIGR01382 PfpI intracellular protease, PfpI family Back     alignment and domain information
Probab=100.00  E-value=4.2e-36  Score=229.96  Aligned_cols=166  Identities=42%  Similarity=0.731  Sum_probs=152.1

Q ss_pred             eEEEEecCCCCchhhHHHHHHHHhCCCeEEEEcCCCCCCCCCCcccccCCCcccccccccCcccccCcCcCCCCCCCccE
Q 027708           10 SVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQQTYSETRGHNFALNATFDEIDPTKYDG   89 (220)
Q Consensus        10 kI~il~~~g~~~~e~~~~~~~l~~ag~~v~~~s~~~~~~~~~~~~~~~~~~~~~~v~~~~g~~i~~~~~l~~~~~~~~D~   89 (220)
                      ||+|++++||+..|+..|+++|+.+|+++.++|++++                 ++.++.|..+.++.++++.+..+||+
T Consensus         1 ~v~il~~~g~~~~e~~~~~~~l~~ag~~v~~vs~~~~-----------------~v~~~~g~~i~~~~~~~~~~~~~~D~   63 (166)
T TIGR01382         1 KLLVLTTDEFEDSELLYPLDRLREAGHEVDTVSKEAG-----------------TTVGKHGYSVTVDATIDEVNPEEYDA   63 (166)
T ss_pred             CEEEEecCCchHHHHHHHHHHHHHCCCEEEEEecCCC-----------------ceeccCCceeeccCChhhCCHHHCcE
Confidence            6999999999999999999999999999999998765                 78889999999999998876668999


Q ss_pred             EEEcCCCCcccccCChHHHHHHHHHHhCCCeEEEEehHHHHHHhCcccCCceEecCCCCHHHHHHCCCeEecCCCCceEE
Q 027708           90 LVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACV  169 (220)
Q Consensus        90 liipGG~~~~~~~~~~~l~~~l~~~~~~g~~i~aic~G~~~La~aglL~g~~~T~~~~~~~~l~~~g~~~~~~~~~~~~v  169 (220)
                      |+||||.++..+..++.+.+||+++++++++|+++|+|+++|+++|+|+||++|+||...+.+++.+.++.+.+   .++
T Consensus        64 vvv~Gg~~~~~~~~~~~l~~~l~~~~~~~~~i~~ic~G~~~La~aglL~g~~~T~~~~~~~~~~~~~~~~~~~~---~~v  140 (166)
T TIGR01382        64 LVIPGGRAPEYLRLNNKAVRLVREFVEKGKPVAAICHGPQLLISAGVLRGKKLTSYPAIIDDVKNAGAEYVDIE---VVV  140 (166)
T ss_pred             EEECCCCCHHHhccCHHHHHHHHHHHHcCCEEEEEChHHHHHHhcCccCCCEEEcCccHHHHHHHCCCeEEcCC---CEE
Confidence            99999977555567899999999999999999999999999999999999999999999999998888888743   399


Q ss_pred             EcCCEEeCCCCCCHHHHHHHHHHHHc
Q 027708          170 VDGNIITGATYEGHPEFIRLFLKALG  195 (220)
Q Consensus       170 ~dg~iiTs~g~~s~~~~~~~li~~l~  195 (220)
                      +|||+|||+|+.++.+|+..+++.++
T Consensus       141 ~dg~iiT~~~~~~~~~fa~~~~~~l~  166 (166)
T TIGR01382       141 VDGNLVTSRVPDDLPAFNREFLKLLG  166 (166)
T ss_pred             EECCEEEeCCcccHHHHHHHHHHHhC
Confidence            99999999999999999999999874



The member of this family from Pyrococcus horikoshii has been solved to 2 Angstrom resolution. It is an ATP-independent intracellular protease that crystallizes as a hexameric ring. Cys-101 is proposed as the active site residue in a catalytic triad with the adjacent His-102 and a Glu residue from an adjacent monomer. A member of this family from Bacillus subtilis, GSP18, has been shown to be expressed in response to several forms of stress. A role in the degradation of small peptides has been suggested. A closely related family consists of the thiamine biosynthesis protein ThiJ and its homologs.

>cd03134 GATase1_PfpI_like A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus Back     alignment and domain information
>cd03135 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1 Back     alignment and domain information
>cd03169 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>TIGR01383 not_thiJ DJ-1 family protein Back     alignment and domain information
>cd03137 GATase1_AraC_1 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>cd03139 GATase1_PfpI_2 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>cd03136 GATase1_AraC_ArgR_like AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK09393 ftrA transcriptional activator FtrA; Provisional Back     alignment and domain information
>PF13278 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3MGK_B 3NOV_A 3NON_B 3NOO_B 3NOQ_A 3NOR_A 3GRA_A 3EWN_A 3ER6_C Back     alignment and domain information
>cd03138 GATase1_AraC_2 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>cd03140 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription] Back     alignment and domain information
>PRK11574 oxidative-stress-resistance chaperone; Provisional Back     alignment and domain information
>KOG2764 consensus Putative transcriptional regulator DJ-1 [General function prediction only; Defense mechanisms] Back     alignment and domain information
>cd03147 GATase1_Ydr533c_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Saccharomyces cerevisiae Ydr533c protein Back     alignment and domain information
>cd03141 GATase1_Hsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein Back     alignment and domain information
>PRK04155 chaperone protein HchA; Provisional Back     alignment and domain information
>COG0693 ThiJ Putative intracellular protease/amidase [General function prediction only] Back     alignment and domain information
>cd03148 GATase1_EcHsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Escherichia coli Hsp31 protein (EcHsp31) Back     alignment and domain information
>PF01965 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 This signature defines a diverse group of protein families which include proteins involved in RNA-protein interaction regulation, thiamine biosynthesis, Ras-related signal transduction, and those with protease activity Back     alignment and domain information
>PRK11780 isoprenoid biosynthesis protein with amidotransferase-like domain; Provisional Back     alignment and domain information
>cd03133 GATase1_ES1 Type 1 glutamine amidotransferase (GATase1)-like domain found in zebrafish ES1 Back     alignment and domain information
>cd03132 GATase1_catalase Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases Back     alignment and domain information
>PRK11249 katE hydroperoxidase II; Provisional Back     alignment and domain information
>cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase Back     alignment and domain information
>PRK03619 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>COG3155 ElbB Uncharacterized protein involved in an early stage of isoprenoid biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I Back     alignment and domain information
>COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01653 GATase1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK13526 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>TIGR03800 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 Back     alignment and domain information
>PRK13527 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PF13507 GATase_5: CobB/CobQ-like glutamine amidotransferase domain; PDB: 3D54_L 3UMM_A 3UJN_A 3UGJ_A 1T3T_A Back     alignment and domain information
>cd03128 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK13525 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PLN02832 glutamine amidotransferase subunit of pyridoxal 5'-phosphate synthase complex Back     alignment and domain information
>cd03130 GATase1_CobB Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase Back     alignment and domain information
>PRK08250 glutamine amidotransferase; Provisional Back     alignment and domain information
>cd01750 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ) Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK07053 glutamine amidotransferase; Provisional Back     alignment and domain information
>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis Back     alignment and domain information
>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase, clade II Back     alignment and domain information
>PLN03206 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>COG0311 PDX2 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase, single chain form Back     alignment and domain information
>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>PRK06490 glutamine amidotransferase; Provisional Back     alignment and domain information
>PHA03366 FGAM-synthase; Provisional Back     alignment and domain information
>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>PRK06895 putative anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>TIGR01739 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synthase Back     alignment and domain information
>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>PRK09065 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK05665 amidotransferase; Provisional Back     alignment and domain information
>PF07685 GATase_3: CobB/CobQ-like glutamine amidotransferase domain; InterPro: IPR011698 This group of enzymes was suggested to be related to the MinD family of ATPases involved in regulation of cell division in bacteria and archaea [] Back     alignment and domain information
>TIGR00888 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>PF01174 SNO: SNO glutamine amidotransferase family; InterPro: IPR002161 Members of this family are involved in the pyridoxine biosynthetic pathway [, ] Back     alignment and domain information
>TIGR00379 cobB cobyrinic acid a,c-diamide synthase Back     alignment and domain information
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK00784 cobyric acid synthase; Provisional Back     alignment and domain information
>PRK07567 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK08007 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK07765 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Back     alignment and domain information
>PRK06774 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>PRK05670 anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK08857 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>CHL00101 trpG anthranilate synthase component 2 Back     alignment and domain information
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PLN02335 anthranilate synthase Back     alignment and domain information
>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>PRK00758 GMP synthase subunit A; Validated Back     alignment and domain information
>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information
>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit Back     alignment and domain information
>PRK14004 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>PF00117 GATase: Glutamine amidotransferase class-I; InterPro: IPR017926 Glutamine amidotransferase (GATase) enzymes catalyse the removal of the ammonia group from glutamine and then transfer this group to a substrate to form a new carbon-nitrogen group [] Back     alignment and domain information
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>cd03146 GAT1_Peptidase_E Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade Back     alignment and domain information
>PRK06278 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>cd03144 GATase1_ScBLP_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Saccharomyces cerevisiae biotin-apoprotein ligase (ScBLP) Back     alignment and domain information
>TIGR00313 cobQ cobyric acid synthase CobQ Back     alignment and domain information
>PRK05282 (alpha)-aspartyl dipeptidase; Validated Back     alignment and domain information
>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase Back     alignment and domain information
>PF09825 BPL_N: Biotin-protein ligase, N terminal; InterPro: IPR019197 The function of this structural domain is unknown Back     alignment and domain information
>KOG3210 consensus Imidazoleglycerol-phosphate synthase subunit H-like [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02347 GMP synthetase Back     alignment and domain information
>PLN02771 carbamoyl-phosphate synthase (glutamine-hydrolyzing) Back     alignment and domain information
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional Back     alignment and domain information
>PRK09522 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK14607 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>PRK05380 pyrG CTP synthetase; Validated Back     alignment and domain information
>COG2071 Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>PRK06186 hypothetical protein; Validated Back     alignment and domain information
>cd03129 GAT1_Peptidase_E_like Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E_like proteins Back     alignment and domain information
>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information
>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>COG3442 Predicted glutamine amidotransferase [General function prediction only] Back     alignment and domain information
>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] Back     alignment and domain information
>PLN02327 CTP synthase Back     alignment and domain information
>TIGR00337 PyrG CTP synthase Back     alignment and domain information
>PF13587 DJ-1_PfpI_N: N-terminal domain of DJ-1_PfpI family; PDB: 1U9C_A 1QVW_B 1QVV_D 1QVZ_A 1RW7_A Back     alignment and domain information
>KOG3179 consensus Predicted glutamine synthetase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05368 homoserine O-succinyltransferase; Provisional Back     alignment and domain information
>TIGR02069 cyanophycinase cyanophycinase Back     alignment and domain information
>PF07722 Peptidase_C26: Peptidase C26; InterPro: IPR011697 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR01823 PabB-fungal aminodeoxychorismate synthase, fungal clade Back     alignment and domain information
>PF03575 Peptidase_S51: Peptidase family S51; InterPro: IPR005320 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN02889 oxo-acid-lyase/anthranilate synthase Back     alignment and domain information
>KOG1907 consensus Phosphoribosylformylglycinamidine synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0370 consensus Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>cd03145 GAT1_cyanophycinase Type 1 glutamine amidotransferase (GATase1)-like domain found in cyanophycinase Back     alignment and domain information
>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03131 GATase1_HTS Type 1 glutamine amidotransferase (GATase1)-like domain found in homoserine trans-succinylase (HTS) Back     alignment and domain information
>KOG2764 consensus Putative transcriptional regulator DJ-1 [General function prediction only; Defense mechanisms] Back     alignment and domain information
>PF09822 ABC_transp_aux: ABC-type uncharacterized transport system; InterPro: IPR019196 This domain is found in various eukaryotic and prokaryotic intra-flagellar transport proteins involved in gliding motility, as well as in several hypothetical proteins Back     alignment and domain information
>COG4285 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK02645 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>COG4635 HemG Flavodoxin [Energy production and conversion / Coenzyme metabolism] Back     alignment and domain information
>COG3340 PepE Peptidase E [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>KOG2387 consensus CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11104 hemG protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK02155 ppnK NAD(+)/NADH kinase family protein; Provisional Back     alignment and domain information
>PF08532 Glyco_hydro_42M: Beta-galactosidase trimerisation domain; InterPro: IPR013738 O-Glycosyl hydrolases 3 Back     alignment and domain information
>KOG0623 consensus Glutamine amidotransferase/cyclase [Amino acid transport and metabolism] Back     alignment and domain information
>cd03143 A4_beta-galactosidase_middle_domain A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK03378 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PF03698 UPF0180: Uncharacterised protein family (UPF0180); InterPro: IPR005370 The members of this family are small uncharacterised proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query220
3uk7_A 396 Crystal Structure Of Arabidopsis Thaliana Dj-1d Len 2e-85
1g2i_A166 Crystal Structure Of A Novel Intracellular Protease 1e-25
3l18_A168 Ton1285, An Intracellular Protease From Thermococcu 4e-23
1oi4_A193 Crystal Structure Of Yhbo From Escherichia Coli Len 7e-19
2vrn_A190 The Structure Of The Stress Response Protein Dr1199 4e-14
3fse_A 365 Crystal Structure Of A Two-Domain Protein Containin 5e-13
4e08_A190 Crystal Structure Of Drosophila Melanogaster Dj-1be 3e-08
3nor_A231 Crystal Structure Of T102s Isocyanide Hydratase Fro 2e-05
3nov_A231 Crystal Structure Of D17e Isocyanide Hydratase From 2e-05
3noo_A231 Crystal Structure Of C101a Isocyanide Hydratase Fro 3e-04
3noq_A231 Crystal Structure Of C101s Isocyanide Hydratase Fro 3e-04
3non_A231 Crystal Structure Of Isocyanide Hydratase From Pseu 4e-04
>pdb|3UK7|A Chain A, Crystal Structure Of Arabidopsis Thaliana Dj-1d Length = 396 Back     alignment and structure

Iteration: 1

Score = 311 bits (796), Expect = 2e-85, Method: Compositional matrix adjust. Identities = 149/207 (71%), Positives = 170/207 (82%), Gaps = 1/207 (0%) Query: 4 SKGGKRSVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQQ 63 S R+VL+LCGDY EDYE VPFQAL AFG++V CPGKK+GD CPTAVH GHQ Sbjct: 8 SXANSRTVLILCGDYXEDYEVXVPFQALQAFGITVHTVCPGKKAGDSCPTAVHDFCGHQ- 66 Query: 64 TYSETRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIAS 123 TY E+RGHNF LNATFDE+D +KYDGLVIPGGRAPEYLA+ SV++LV++FS SGK IAS Sbjct: 67 TYFESRGHNFTLNATFDEVDLSKYDGLVIPGGRAPEYLALTASVVELVKEFSRSGKPIAS 126 Query: 124 ICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGATYEGH 183 I HGQLILAAAD V GRKCTAY V P L+AAGA W+EP T CVVDG++IT ATYEGH Sbjct: 127 IXHGQLILAAADTVNGRKCTAYATVGPSLVAAGAKWVEPITPDVCVVDGSLITAATYEGH 186 Query: 184 PEFIRLFLKALGGTITGSDKRILFLCG 210 PEFI+LF+KALGG ITG++KRILFLCG Sbjct: 187 PEFIQLFVKALGGKITGANKRILFLCG 213
>pdb|1G2I|A Chain A, Crystal Structure Of A Novel Intracellular Protease From Pyrococcus Horikoshii At 2 A Resolution Length = 166 Back     alignment and structure
>pdb|3L18|A Chain A, Ton1285, An Intracellular Protease From Thermococcus Onnurineus Na1 Length = 168 Back     alignment and structure
>pdb|1OI4|A Chain A, Crystal Structure Of Yhbo From Escherichia Coli Length = 193 Back     alignment and structure
>pdb|2VRN|A Chain A, The Structure Of The Stress Response Protein Dr1199 From Deinococcus Radiodurans: A Member Of The Dj-1 Superfamily Length = 190 Back     alignment and structure
>pdb|3FSE|A Chain A, Crystal Structure Of A Two-Domain Protein Containing Dj-1THIJPFPI- Like And Ferritin-Like Domains (Ava_4496) From Anabaena Variabilis Atcc 29413 At 1.90 A Resolution Length = 365 Back     alignment and structure
>pdb|4E08|A Chain A, Crystal Structure Of Drosophila Melanogaster Dj-1beta Length = 190 Back     alignment and structure
>pdb|3NOR|A Chain A, Crystal Structure Of T102s Isocyanide Hydratase From Pseudomonas Fluorescens Length = 231 Back     alignment and structure
>pdb|3NOV|A Chain A, Crystal Structure Of D17e Isocyanide Hydratase From Pseudomonas Fluorescens Length = 231 Back     alignment and structure
>pdb|3NOO|A Chain A, Crystal Structure Of C101a Isocyanide Hydratase From Pseudomonas Fluorescens Length = 231 Back     alignment and structure
>pdb|3NOQ|A Chain A, Crystal Structure Of C101s Isocyanide Hydratase From Pseudomonas Fluorescens Length = 231 Back     alignment and structure
>pdb|3NON|A Chain A, Crystal Structure Of Isocyanide Hydratase From Pseudomonas Fluorescens Length = 231 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query220
3uk7_A 396 Class I glutamine amidotransferase-like domain-CO 2e-87
3uk7_A396 Class I glutamine amidotransferase-like domain-CO 5e-81
3l18_A168 Intracellular protease I; gatase1_PFPI_LIKE, hydro 2e-72
2vrn_A190 Protease I, DR1199; cysteine sulfenic acid, DJ-1/T 5e-72
3fse_A 365 Two-domain protein containing DJ-1/THIJ/PFPI-like 2e-71
1oi4_A193 Hypothetical protein YHBO; PFPI/THIJ family, compl 7e-70
3cne_A175 Putative protease I; structural genomics, PSI-2, M 1e-44
4e08_A190 DJ-1 beta; flavodoxin-like fold, stress response, 2e-36
3ot1_A208 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate 5e-34
3efe_A212 THIJ/PFPI family protein; structural GEN csgid, ce 2e-33
3l3b_A242 ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, 9e-33
2rk3_A197 Protein DJ-1; parkinson'S disease, THIJ, PFPI, cha 1e-32
2fex_A188 Conserved hypothetical protein; structural genomic 2e-30
4gdh_A194 DJ-1, uncharacterized protein C22E12.03C; unknown 2e-30
2ab0_A205 YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase 3e-30
3f5d_A206 Protein YDEA; unknow protein, PSI-II, nysgrc, stru 7e-29
1vhq_A232 Enhancing lycopene biosynthesis protein 2; structu 3e-26
1n57_A291 Chaperone HSP31, protein YEDU; alpha-beta sandwich 3e-24
1u9c_A224 APC35852; structural genomics, protein structure i 3e-23
3bhn_A236 THIJ/PFPI domain protein; structural genomics, joi 3e-21
1rw7_A243 YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI supe 3e-19
3n7t_A247 Macrophage binding protein; seattle structural gen 4e-18
3kkl_A244 Probable chaperone protein HSP33; peptidase, heat 4e-18
3mgk_A211 Intracellular protease/amidase related enzyme (THI 5e-14
3noq_A231 THIJ/PFPI family protein; DJ-1 superfamily, isocya 3e-13
3ewn_A253 THIJ/PFPI family protein; monomer, PSI nysgrc, str 1e-12
3gra_A202 Transcriptional regulator, ARAC family; transcript 1e-08
3er6_A209 Putative transcriptional regulator protein; struct 1e-08
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Length = 396 Back     alignment and structure
 Score =  262 bits (671), Expect = 2e-87
 Identities = 150/210 (71%), Positives = 172/210 (81%), Gaps = 2/210 (0%)

Query: 1   MANSKGGKRSVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTG 60
             +    +  VL+LCGDYMEDYE MVPFQAL AFG++V   CPGKK+GD CPTAVH   G
Sbjct: 6   RGSMANSRT-VLILCGDYMEDYEVMVPFQALQAFGITVHTVCPGKKAGDSCPTAVHDFCG 64

Query: 61  HQQTYSETRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKT 120
           HQ TY E+RGHNF LNATFDE+D +KYDGLVIPGGRAPEYLA+  SV++LV++FS SGK 
Sbjct: 65  HQ-TYFESRGHNFTLNATFDEVDLSKYDGLVIPGGRAPEYLALTASVVELVKEFSRSGKP 123

Query: 121 IASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGATY 180
           IASICHGQLILAAAD V GRKCTAY  V P L+AAGA W+EP T   CVVDG++IT ATY
Sbjct: 124 IASICHGQLILAAADTVNGRKCTAYATVGPSLVAAGAKWVEPITPDVCVVDGSLITAATY 183

Query: 181 EGHPEFIRLFLKALGGTITGSDKRILFLCG 210
           EGHPEFI+LF+KALGG ITG++KRILFLCG
Sbjct: 184 EGHPEFIQLFVKALGGKITGANKRILFLCG 213


>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Length = 396 Back     alignment and structure
>3l18_A Intracellular protease I; gatase1_PFPI_LIKE, hydrolase; 1.78A {Thermococcus onnurineus} PDB: 1g2i_A Length = 168 Back     alignment and structure
>2vrn_A Protease I, DR1199; cysteine sulfenic acid, DJ-1/THIJ/PFPI superfamily, protease hydrolase, stress response; 2.15A {Deinococcus radiodurans} Length = 190 Back     alignment and structure
>3fse_A Two-domain protein containing DJ-1/THIJ/PFPI-like ferritin-like domains; structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413} Length = 365 Back     alignment and structure
>1oi4_A Hypothetical protein YHBO; PFPI/THIJ family, complete proteome, PFPI, THIJ, bacterial targets at IGS-CNRS, france, BIGS, structural genomics; 2.03A {Escherichia coli} SCOP: c.23.16.2 Length = 193 Back     alignment and structure
>3cne_A Putative protease I; structural genomics, PSI-2, MCSG, protein struct initiative, midwest center for structural genomics; HET: FMN; 1.99A {Bacteroides thetaiotaomicron vpi-5482} Length = 175 Back     alignment and structure
>4e08_A DJ-1 beta; flavodoxin-like fold, stress response, motor protein; 2.00A {Drosophila melanogaster} Length = 190 Back     alignment and structure
>3ot1_A 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme; csgid, structural genomics; HET: MSE CSX; 1.16A {Vibrio cholerae o1 biovar el tor} Length = 208 Back     alignment and structure
>3efe_A THIJ/PFPI family protein; structural GEN csgid, center for structural genomics of infectious disease chaperone; 2.30A {Bacillus anthracis} Length = 212 Back     alignment and structure
>3l3b_A ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography, isopr biosynthesis; 1.90A {Ehrlichia chaffeensis} Length = 242 Back     alignment and structure
>2rk3_A Protein DJ-1; parkinson'S disease, THIJ, PFPI, chaperone, cytoplasm, disease mutation, nucleus, oncogene, oxidation, parkinson disease; 1.05A {Homo sapiens} PDB: 1pdv_A 1pdw_A 3cy6_A 1pe0_A 3cza_A 3cyf_A 2rk4_A 3cz9_A* 3ezg_A 3f71_A 3sf8_A 1p5f_A 1ps4_A 1q2u_A 1soa_A 1ucf_A 2or3_A 3bwe_A 3b38_A 3b36_A ... Length = 197 Back     alignment and structure
>2fex_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, MIDW center for structural genomics, MCSG; 1.70A {Agrobacterium tumefaciens} SCOP: c.23.16.2 Length = 188 Back     alignment and structure
>4gdh_A DJ-1, uncharacterized protein C22E12.03C; unknown function, cysteine oxidation; 1.05A {Schizosaccharomyces pombe} PDB: 4ge3_A 4ge0_A Length = 194 Back     alignment and structure
>2ab0_A YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase fold, unknown function; 1.10A {Escherichia coli} SCOP: c.23.16.2 Length = 205 Back     alignment and structure
>3f5d_A Protein YDEA; unknow protein, PSI-II, nysgrc, structural genomics, protein structure initiative; 2.06A {Bacillus subtilis} Length = 206 Back     alignment and structure
>1vhq_A Enhancing lycopene biosynthesis protein 2; structural genomics, unknown function; 1.65A {Escherichia coli} SCOP: c.23.16.2 PDB: 1oy1_A Length = 232 Back     alignment and structure
>1n57_A Chaperone HSP31, protein YEDU; alpha-beta sandwich; 1.60A {Escherichia coli} SCOP: c.23.16.2 PDB: 1pv2_A 1izy_A 1ons_A 1izz_A Length = 291 Back     alignment and structure
>1u9c_A APC35852; structural genomics, protein structure initiative, MCSG, PAR disease, chaperone, cysteine protease, PSI; 1.35A {Geobacillus stearothermophilus} SCOP: c.23.16.2 Length = 224 Back     alignment and structure
>3bhn_A THIJ/PFPI domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.76A {Shewanella loihica pv-4} Length = 236 Back     alignment and structure
>1rw7_A YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI superfamily, unknown function; 1.80A {Saccharomyces cerevisiae} SCOP: c.23.16.2 PDB: 1qvv_A* 1qvz_A 1qvw_A Length = 243 Back     alignment and structure
>3n7t_A Macrophage binding protein; seattle structural genomics center for infectious disease, S macrophage, pathogenic fungus, coccidioidomycosis; 2.10A {Coccidioides immitis} Length = 247 Back     alignment and structure
>3kkl_A Probable chaperone protein HSP33; peptidase, heat shock protein, hydrolase, protease, stress response; 2.03A {Saccharomyces cerevisiae} PDB: 3mii_A* Length = 244 Back     alignment and structure
>3mgk_A Intracellular protease/amidase related enzyme (THIJ family); amidotranferase-like, structural genomics, PSI; 2.00A {Clostridium acetobutylicum} Length = 211 Back     alignment and structure
>3noq_A THIJ/PFPI family protein; DJ-1 superfamily, isocyanide hydratase, isonitrIle hydratase; HET: NHE; 1.00A {Pseudomonas fluorescens} PDB: 3noo_A 3non_A 3nor_A* 3nov_A Length = 231 Back     alignment and structure
>3ewn_A THIJ/PFPI family protein; monomer, PSI nysgrc, structural genomics, protein structure initiative; 1.65A {Pseudomonas syringae PV} Length = 253 Back     alignment and structure
>3gra_A Transcriptional regulator, ARAC family; transcription regulator, PSI-II, structural genomics structure initiative; 2.30A {Pseudomonas putida} Length = 202 Back     alignment and structure
>3er6_A Putative transcriptional regulator protein; structural genomics, unknown function, DNA-binding, transcription regulation, PSI-2; 1.90A {Vibrio parahaemolyticus} Length = 209 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query220
4hcj_A177 THIJ/PFPI domain protein; structural genomics, PSI 100.0
3efe_A212 THIJ/PFPI family protein; structural GEN csgid, ce 100.0
3er6_A209 Putative transcriptional regulator protein; struct 100.0
3ewn_A253 THIJ/PFPI family protein; monomer, PSI nysgrc, str 100.0
3l18_A168 Intracellular protease I; gatase1_PFPI_LIKE, hydro 100.0
3noq_A231 THIJ/PFPI family protein; DJ-1 superfamily, isocya 100.0
3gra_A202 Transcriptional regulator, ARAC family; transcript 100.0
4e08_A190 DJ-1 beta; flavodoxin-like fold, stress response, 100.0
3mgk_A211 Intracellular protease/amidase related enzyme (THI 100.0
3ot1_A208 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate 100.0
2vrn_A190 Protease I, DR1199; cysteine sulfenic acid, DJ-1/T 100.0
4gdh_A194 DJ-1, uncharacterized protein C22E12.03C; unknown 100.0
1oi4_A193 Hypothetical protein YHBO; PFPI/THIJ family, compl 100.0
2rk3_A197 Protein DJ-1; parkinson'S disease, THIJ, PFPI, cha 100.0
3fse_A 365 Two-domain protein containing DJ-1/THIJ/PFPI-like 100.0
3f5d_A206 Protein YDEA; unknow protein, PSI-II, nysgrc, stru 100.0
3uk7_A 396 Class I glutamine amidotransferase-like domain-CO 100.0
2ab0_A205 YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase 100.0
2fex_A188 Conserved hypothetical protein; structural genomic 100.0
3bhn_A236 THIJ/PFPI domain protein; structural genomics, joi 100.0
1u9c_A224 APC35852; structural genomics, protein structure i 100.0
3uk7_A396 Class I glutamine amidotransferase-like domain-CO 100.0
3cne_A175 Putative protease I; structural genomics, PSI-2, M 100.0
3kkl_A244 Probable chaperone protein HSP33; peptidase, heat 100.0
1rw7_A243 YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI supe 100.0
3n7t_A247 Macrophage binding protein; seattle structural gen 100.0
1n57_A291 Chaperone HSP31, protein YEDU; alpha-beta sandwich 100.0
1vhq_A232 Enhancing lycopene biosynthesis protein 2; structu 100.0
3l3b_A242 ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, 99.97
1sy7_A715 Catalase 1; heme oxidation, singlet oxygen, oxidor 99.91
3ttv_A753 Catalase HPII; heme orientation, oxidoreductase; H 99.83
2iuf_A688 Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen 99.71
3ej6_A688 Catalase-3; heme, hydrogen iron, metal-binding, ox 99.66
3d54_D213 Phosphoribosylformylglycinamidine synthase 1; alph 99.25
3l7n_A236 Putative uncharacterized protein; glutamine amidot 98.57
3m3p_A250 Glutamine amido transferase; structural genomics, 98.56
1q7r_A219 Predicted amidotransferase; structural genomics, Y 98.56
2nv0_A196 Glutamine amidotransferase subunit PDXT; 3-layer(A 98.54
1ka9_H200 Imidazole glycerol phosphtate synthase; riken stru 98.48
3ugj_A1303 Phosphoribosylformylglycinamidine synthase; amidot 98.43
2iss_D208 Glutamine amidotransferase subunit PDXT; (beta/alp 98.42
2ywd_A191 Glutamine amidotransferase subunit PDXT; pyridoxin 98.38
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; tr 98.29
2abw_A227 PDX2 protein, glutaminase; PLP-synthase, vitamin B 98.27
2ywj_A186 Glutamine amidotransferase subunit PDXT; uncharact 98.07
1gpw_B201 Amidotransferase HISH; lyase/transferase, complex 98.06
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 98.01
4gud_A211 Imidazole glycerol phosphate synthase subunit His; 97.99
1o1y_A239 Conserved hypothetical protein TM1158; flavodoxin- 97.93
1a9x_B379 Carbamoyl phosphate synthetase (small chain); amid 97.9
3fij_A254 LIN1909 protein; 11172J, uncharacterized protein, 97.75
2vpi_A218 GMP synthase; guanine monophosphate synthetase, ph 97.72
2a9v_A212 GMP synthase; structural genomics, joint center fo 97.63
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis pro 97.5
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 97.43
3l4e_A206 Uncharacterized peptidase LMO0363; hypothetical pr 97.43
1l9x_A315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO 97.4
2v4u_A289 CTP synthase 2; pyrimidine biosynthesis, glutamine 97.39
1fy2_A229 Aspartyl dipeptidase; serine protease, catalytic t 97.34
3r75_A645 Anthranilate/para-aminobenzoate synthases compone; 97.1
2h2w_A312 Homoserine O-succinyltransferase; TM0881, (EC 2.3. 97.04
2w7t_A273 CTP synthetase, putative cytidine triphosphate syn 97.0
3uow_A 556 GMP synthetase; structural genomics consortium, SG 96.99
1gpm_A 525 GMP synthetase, XMP aminase; class I glutamine ami 96.74
2vdj_A301 Homoserine O-succinyltransferase; methionine biosy 96.69
3nva_A535 CTP synthase; rossman fold, nucleotide binding, LI 96.45
1i1q_B192 Anthranilate synthase component II; tryptophan bio 96.24
1s1m_A545 CTP synthase; CTP synthetase, UTP:ammonia ligase ( 96.1
1vco_A550 CTP synthetase; tetramer, riken structural genomic 96.09
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 95.33
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 95.2
3en0_A291 Cyanophycinase; serine protease, beta peptide spec 93.92
3rht_A259 (gatase1)-like protein; structural genomics, PSI-b 89.61
>4hcj_A THIJ/PFPI domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta-alpha sandwich; HET: MSE; 1.12A {Brachyspira murdochii} Back     alignment and structure
Probab=100.00  E-value=5.2e-43  Score=269.18  Aligned_cols=168  Identities=20%  Similarity=0.260  Sum_probs=159.1

Q ss_pred             CCeEEEEecCCCCchhhHHHHHHHHhCCCeEEEEcCCCCCCCCCCcccccCCCcccccccccCcccccCcCcCCCCCCCc
Q 027708            8 KRSVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQQTYSETRGHNFALNATFDEIDPTKY   87 (220)
Q Consensus         8 ~~kI~il~~~g~~~~e~~~~~~~l~~ag~~v~~~s~~~~~~~~~~~~~~~~~~~~~~v~~~~g~~i~~~~~l~~~~~~~~   87 (220)
                      +++|.|++.+||++.|+..|+++|+++|++|+++|++++                 +++++.|..+.+|..++++++.+|
T Consensus         8 ~~~v~il~~~gFe~~E~~~p~~~l~~ag~~V~~~s~~~~-----------------~v~~~~G~~v~~d~~l~~v~~~~y   70 (177)
T 4hcj_A            8 NNILYVMSGQNFQDEEYFESKKIFESAGYKTKVSSTFIG-----------------TAQGKLGGMTNIDLLFSEVDAVEF   70 (177)
T ss_dssp             CEEEEECCSEEECHHHHHHHHHHHHHTTCEEEEEESSSE-----------------EEEETTSCEEEECEEGGGCCGGGC
T ss_pred             CCEEEEECCCCccHHHHHHHHHHHHHCCCEEEEEECCCC-----------------eEeeCCCCEEecCccHHHCCHhHC
Confidence            366888889999999999999999999999999999876                 899999999999999999988899


Q ss_pred             cEEEEcCCCCcccccCChHHHHHHHHHHhCCCeEEEEehHHHHHHhCcccCCceEecCCCCHHHHHHCCCeEecCCCCce
Q 027708           88 DGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAA  167 (220)
Q Consensus        88 D~liipGG~~~~~~~~~~~l~~~l~~~~~~g~~i~aic~G~~~La~aglL~g~~~T~~~~~~~~l~~~g~~~~~~~~~~~  167 (220)
                      |+|+||||+++..+..++.+.+||+++++++|+|++||+|+++|+++|||+||++|+||..++.+++.|+.|++++    
T Consensus        71 D~liiPGG~g~~~l~~~~~~~~~l~~~~~~~k~iaaIC~g~~~La~aGlL~gr~~T~~~~~~~~l~~~ga~~~~~~----  146 (177)
T 4hcj_A           71 DAVVFVGGIGCITLWDDWRTQGLAKLFLDNQKIVAGIGSGVVIMANAKILEEINVTCLSADESHVRHGNANIMSEN----  146 (177)
T ss_dssp             SEEEECCSGGGGGGTTCHHHHHHHHHHHHTTCEEEEETTHHHHHHHTTCCTTCEECCCGGGHHHHHHTTCEECSSS----
T ss_pred             CEEEECCCccHHHHhhCHHHHHHHHHHHHhCCEEEEecccHHHHHHCCCCCCCEEEEeCCHHHHHHhCCCEEecCC----
Confidence            9999999998877889999999999999999999999999999999999999999999999999999999998876    


Q ss_pred             EEEcCCEEeCCCCCCHHHHHHHHHHHHcc
Q 027708          168 CVVDGNIITGATYEGHPEFIRLFLKALGG  196 (220)
Q Consensus       168 ~v~dg~iiTs~g~~s~~~~~~~li~~l~~  196 (220)
                      +|+|||+|||+|+.++.+|++++|+.|.+
T Consensus       147 vV~Dg~liTs~g~~~~~~~a~~lve~L~s  175 (177)
T 4hcj_A          147 VVVSGNIVTANGPTSSKDFANAVVGVLNS  175 (177)
T ss_dssp             EEEETTEEEECSGGGHHHHHHHHHHHHHT
T ss_pred             EEEECCEEECCCHHHHHHHHHHHHHHHhc
Confidence            89999999999999999999999999865



>3efe_A THIJ/PFPI family protein; structural GEN csgid, center for structural genomics of infectious disease chaperone; 2.30A {Bacillus anthracis} Back     alignment and structure
>3er6_A Putative transcriptional regulator protein; structural genomics, unknown function, DNA-binding, transcription regulation, PSI-2; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3ewn_A THIJ/PFPI family protein; monomer, PSI nysgrc, structural genomics, protein structure initiative; 1.65A {Pseudomonas syringae PV} Back     alignment and structure
>3l18_A Intracellular protease I; gatase1_PFPI_LIKE, hydrolase; 1.78A {Thermococcus onnurineus} SCOP: c.23.16.2 PDB: 1g2i_A Back     alignment and structure
>3noq_A THIJ/PFPI family protein; DJ-1 superfamily, isocyanide hydratase, isonitrIle hydratase; HET: NHE; 1.00A {Pseudomonas fluorescens} PDB: 3noo_A 3non_A 3nor_A* 3nov_A Back     alignment and structure
>3gra_A Transcriptional regulator, ARAC family; transcription regulator, PSI-II, structural genomics structure initiative; 2.30A {Pseudomonas putida} Back     alignment and structure
>4e08_A DJ-1 beta; flavodoxin-like fold, stress response, motor protein; 2.00A {Drosophila melanogaster} Back     alignment and structure
>3mgk_A Intracellular protease/amidase related enzyme (THIJ family); amidotranferase-like, structural genomics, PSI; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3ot1_A 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme; csgid, structural genomics; HET: MSE CSX; 1.16A {Vibrio cholerae o1 biovar el tor} SCOP: c.23.16.0 Back     alignment and structure
>2vrn_A Protease I, DR1199; cysteine sulfenic acid, DJ-1/THIJ/PFPI superfamily, protease hydrolase, stress response; 2.15A {Deinococcus radiodurans} Back     alignment and structure
>4gdh_A DJ-1, uncharacterized protein C22E12.03C; unknown function, cysteine oxidation; 1.05A {Schizosaccharomyces pombe} PDB: 4ge3_A 4ge0_A Back     alignment and structure
>1oi4_A Hypothetical protein YHBO; PFPI/THIJ family, complete proteome, PFPI, THIJ, bacterial targets at IGS-CNRS, france, BIGS, structural genomics; 2.03A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>2rk3_A Protein DJ-1; parkinson'S disease, THIJ, PFPI, chaperone, cytoplasm, disease mutation, nucleus, oncogene, oxidation, parkinson disease; 1.05A {Homo sapiens} PDB: 1pdv_A 1pdw_A 3cy6_A 1pe0_A 3cza_A 3cyf_A 2rk4_A 3cz9_A* 3ezg_A 3f71_A 3sf8_A 1p5f_A 1ps4_A 1q2u_A 1soa_A 1ucf_A 2or3_A 3bwe_A 3b38_A 3b36_A ... Back     alignment and structure
>3fse_A Two-domain protein containing DJ-1/THIJ/PFPI-like ferritin-like domains; structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3f5d_A Protein YDEA; unknow protein, PSI-II, nysgrc, structural genomics, protein structure initiative; 2.06A {Bacillus subtilis} Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>2ab0_A YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase fold, unknown function; 1.10A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>2fex_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, MIDW center for structural genomics, MCSG; 1.70A {Agrobacterium tumefaciens} SCOP: c.23.16.2 Back     alignment and structure
>3bhn_A THIJ/PFPI domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.76A {Shewanella loihica pv-4} Back     alignment and structure
>1u9c_A APC35852; structural genomics, protein structure initiative, MCSG, PAR disease, chaperone, cysteine protease, PSI; 1.35A {Geobacillus stearothermophilus} SCOP: c.23.16.2 Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>3cne_A Putative protease I; structural genomics, PSI-2, MCSG, protein struct initiative, midwest center for structural genomics; HET: FMN; 1.99A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3kkl_A Probable chaperone protein HSP33; peptidase, heat shock protein, hydrolase, protease, stress response; 2.03A {Saccharomyces cerevisiae} PDB: 3mii_A* Back     alignment and structure
>1rw7_A YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI superfamily, unknown function; 1.80A {Saccharomyces cerevisiae} SCOP: c.23.16.2 PDB: 1qvv_A* 1qvz_A 1qvw_A Back     alignment and structure
>3n7t_A Macrophage binding protein; seattle structural genomics center for infectious disease, S macrophage, pathogenic fungus, coccidioidomycosis; 2.10A {Coccidioides immitis} SCOP: c.23.16.0 Back     alignment and structure
>1n57_A Chaperone HSP31, protein YEDU; alpha-beta sandwich; 1.60A {Escherichia coli} SCOP: c.23.16.2 PDB: 1pv2_A 1izy_A 1ons_A 1izz_A Back     alignment and structure
>1vhq_A Enhancing lycopene biosynthesis protein 2; structural genomics, unknown function; 1.65A {Escherichia coli} SCOP: c.23.16.2 PDB: 1oy1_A Back     alignment and structure
>3l3b_A ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography, isopr biosynthesis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 Back     alignment and structure
>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... Back     alignment and structure
>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* Back     alignment and structure
>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} Back     alignment and structure
>3d54_D Phosphoribosylformylglycinamidine synthase 1; alpha-beta structure, ATP-binding, cytoplasm, ligase, nucleotide-binding, purine biosynthesis; HET: CYG ADP; 3.50A {Thermotoga maritima} Back     alignment and structure
>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} Back     alignment and structure
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Back     alignment and structure
>1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 Back     alignment and structure
>2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* Back     alignment and structure
>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 Back     alignment and structure
>3ugj_A Phosphoribosylformylglycinamidine synthase; amidotransferase, glutaminase, thioester intermediate, ligas; HET: ADP; 1.78A {Salmonella enterica subsp} PDB: 1t3t_A* 3ujn_A* 3umm_A* Back     alignment and structure
>2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Back     alignment and structure
>2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G Back     alignment and structure
>2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B Back     alignment and structure
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Back     alignment and structure
>4gud_A Imidazole glycerol phosphate synthase subunit His; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE 1PE; 1.91A {Vibrio cholerae} Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Back     alignment and structure
>1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B* Back     alignment and structure
>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Back     alignment and structure
>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Back     alignment and structure
>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>3l4e_A Uncharacterized peptidase LMO0363; hypothetical protein LMO0363, csgid, similar to peptidase E, hydrolase, protease, serine protease; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Back     alignment and structure
>2v4u_A CTP synthase 2; pyrimidine biosynthesis, glutamine amidotransferase, glutaminase domain, 5-OXO-L-norleucine, DON, ligase, phosphoprotein; HET: CYD; 2.3A {Homo sapiens} PDB: 2vkt_A Back     alignment and structure
>1fy2_A Aspartyl dipeptidase; serine protease, catalytic triad, strand-helix MO hydrolase; 1.20A {Salmonella typhimurium} SCOP: c.23.16.4 PDB: 1fye_A Back     alignment and structure
>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* Back     alignment and structure
>2h2w_A Homoserine O-succinyltransferase; TM0881, (EC 2.3.1.46), HOM O-transsuccinylase, HTS, (TM0881), structural genomics; 2.52A {Thermotoga maritima} Back     alignment and structure
>2w7t_A CTP synthetase, putative cytidine triphosphate synthase; glutaminase domain, trypsanosoma brucei, ligase, acivicin; HET: 5CS; 2.10A {Trypanosoma brucei} Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A Back     alignment and structure
>3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Back     alignment and structure
>1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* Back     alignment and structure
>1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>3en0_A Cyanophycinase; serine protease, beta peptide specific, hydrolase, protease; 1.50A {Synechocystis SP} Back     alignment and structure
>3rht_A (gatase1)-like protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.83A {Planctomyces limnophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 220
d1vhqa_217 c.23.16.2 (A:) Putative sigma cross-reacting prote 2e-32
d1oi4a1170 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Es 1e-31
d1g2ia_166 c.23.16.2 (A:) Intracellular protease {Archaeon Py 8e-30
d1qvwa_236 c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Bake 8e-26
d1n57a_279 c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia col 6e-23
d1u9ca_221 c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothe 6e-22
d2fexa1188 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 { 2e-19
d1sy7a1184 c.23.16.3 (A:553-736) Catalase, C-terminal domain 3e-18
d1p80a1156 c.23.16.3 (A:598-753) Catalase, C-terminal domain 8e-18
d2ab0a1195 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherich 6e-17
d1p5fa_186 c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 2e-16
>d1vhqa_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: DJ-1/PfpI
domain: Putative sigma cross-reacting protein 27A (SCRP-27A, EllB)
species: Escherichia coli [TaxId: 562]
 Score =  114 bits (287), Expect = 2e-32
 Identities = 34/193 (17%), Positives = 59/193 (30%), Gaps = 20/193 (10%)

Query: 8   KRSVLLLCG----DYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQQ 63
           K+  ++L G    D  E +EA++   A+   G       P K+  DV      ++   + 
Sbjct: 2   KKIGVILSGCGVYDGSEIHEAVLTLLAISRSGAQAVCFAPDKQQVDVINHLTGEAMT-ET 60

Query: 64  TYSETRGHNFALNA--TFDEIDPTKYDGLVIPGGRAP-----------EYLAMNDSVIDL 110
                              + D  + D L++PGG                  ++  +  L
Sbjct: 61  RNVLIEAARITRGEIRPLAQADAAELDALIVPGGFGAAKNLSNFASLGSECTVDRELKAL 120

Query: 111 VRKFSNSGKTIASICHGQLILAAADVVKGR-KCTAYPPVKPVLIAAGASWIEPETMAACV 169
            +    +GK +  +C    +L        R           VL   GA  +        V
Sbjct: 121 AQAMHQAGKPLGFMCIAPAMLPKIFDFPLRLTIGTDIDTAEVLEEMGAEHVPCPVDDIVV 180

Query: 170 V-DGNIITGATYE 181
             D  I+T   Y 
Sbjct: 181 DEDNKIVTTPAYM 193


>d1oi4a1 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]} Length = 170 Back     information, alignment and structure
>d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 166 Back     information, alignment and structure
>d1qvwa_ c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 236 Back     information, alignment and structure
>d1n57a_ c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} Length = 279 Back     information, alignment and structure
>d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]} Length = 221 Back     information, alignment and structure
>d2fexa1 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]} Length = 188 Back     information, alignment and structure
>d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Neurospora crassa [TaxId: 5141]} Length = 184 Back     information, alignment and structure
>d1p80a1 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]} Length = 156 Back     information, alignment and structure
>d2ab0a1 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]} Length = 195 Back     information, alignment and structure
>d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query220
d1g2ia_166 Intracellular protease {Archaeon Pyrococcus horiko 100.0
d1p5fa_186 DJ-1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1oi4a1170 Hypothetical protein YhbO {Escherichia coli [TaxId 100.0
d2ab0a1195 Protein ThiJ (YajL) {Escherichia coli [TaxId: 562] 100.0
d2fexa1188 Hypothetical protein Atu0886 {Agrobacterium tumefa 100.0
d1sy7a1184 Catalase, C-terminal domain {Neurospora crassa [Ta 100.0
d1u9ca_221 GK2698 ortholog {Bacillus stearothermophilus [TaxI 100.0
d1qvwa_236 Hypothetical protein Ydr533Cp {Baker's yeast (Sacc 99.97
d1n57a_279 HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} 99.97
d1vhqa_217 Putative sigma cross-reacting protein 27A (SCRP-27 99.94
d1p80a1156 Catalase, C-terminal domain {Escherichia coli, HPI 99.91
d1q7ra_202 Hypothetical protein YaaE {Bacillus stearothermoph 98.8
d2nv0a1195 Hypothetical protein YaaE {Bacillus subtilis [TaxI 98.74
d1t3ta2262 FGAM synthase PurL, amidotransferase domain {Salmo 98.62
d1o1ya_230 Hypothetical protein TM1158 {Thermotoga maritima [ 98.45
d1jvna2232 GAT subunit, HisH, (or domain) of imidazoleglycero 98.0
d2abwa1218 Pyridoxine biosynthesis protein 2, Pdx2 {Malaria p 97.86
d1k9vf_200 GAT subunit, HisH, (or domain) of imidazoleglycero 97.84
d2a9va1196 GMP synthase subunit A, GuaAA {Archaeon Thermoplas 97.81
d1qdlb_195 Anthranilate synthase GAT subunit, TrpG {Archaeon 97.47
d1wl8a1188 GMP synthase subunit A, GuaAA {Archaeon Pyrococcus 97.47
d1a9xb2228 Carbamoyl phosphate synthetase, small subunit C-te 97.27
d1i7qb_192 Anthranilate synthase GAT subunit, TrpG {Serratia 97.18
d2ghra1281 Homoserine O-succinyltransferase HTS (MetA) {Bacil 97.09
d1ka9h_195 GAT subunit, HisH, (or domain) of imidazoleglycero 97.07
d1gpma2205 GMP synthetase {Escherichia coli [TaxId: 562]} 97.0
d1s1ma1258 CTP synthase PyrG, C-terminal domain {Escherichia 95.88
d1vcoa1250 CTP synthase PyrG, C-terminal domain {Thermus ther 94.87
d1l9xa_288 gamma-glutamyl hydrolase {Human (Homo sapiens) [Ta 92.87
d1fyea_229 Aspartyl dipeptidase PepE {Salmonella typhimurium 88.09
d1iowa196 D-Ala-D-Ala ligase, N-domain {Escherichia coli, ge 87.93
>d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: DJ-1/PfpI
domain: Intracellular protease
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]
Probab=100.00  E-value=4.1e-42  Score=260.45  Aligned_cols=165  Identities=38%  Similarity=0.680  Sum_probs=156.1

Q ss_pred             CeEEEEecCCCCchhhHHHHHHHHhCCCeEEEEcCCCCCCCCCCcccccCCCcccccccccCcccccCcCcCCCCCCCcc
Q 027708            9 RSVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQQTYSETRGHNFALNATFDEIDPTKYD   88 (220)
Q Consensus         9 ~kI~il~~~g~~~~e~~~~~~~l~~ag~~v~~~s~~~~~~~~~~~~~~~~~~~~~~v~~~~g~~i~~~~~l~~~~~~~~D   88 (220)
                      +||+|+++|||++.|+..|+++|+++|++|+++|++++                 +|+++.|+.+.++.+++++++.+||
T Consensus         1 mKv~il~~dgf~~~E~~~p~~~l~~ag~~v~~vs~~~~-----------------~V~~~~g~~i~~d~~~~~~~~~~~d   63 (166)
T d1g2ia_           1 MKVLFLTANEFEDVELIYPYHRLKEEGHEVYIASFERG-----------------TITGKHGYSVKVDLTFDKVNPEEFD   63 (166)
T ss_dssp             CEEEEECCTTBCHHHHHHHHHHHHHTTCEEEEEESSSE-----------------EEECTTSCEEEECEEGGGCCGGGCS
T ss_pred             CEEEEEeCCCcCHHHHHHHHHHHHHCCCEEEEEeCCCc-----------------eEeecCCcEEeccccHHHcCccccc
Confidence            38999999999999999999999999999999999875                 8999999999999999999888999


Q ss_pred             EEEEcCCCCcccccCChHHHHHHHHHHhCCCeEEEEehHHHHHHhCcccCCceEecCCCCHHHHHHCCCeEecCCCCceE
Q 027708           89 GLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAAC  168 (220)
Q Consensus        89 ~liipGG~~~~~~~~~~~l~~~l~~~~~~g~~i~aic~G~~~La~aglL~g~~~T~~~~~~~~l~~~g~~~~~~~~~~~~  168 (220)
                      +|+||||.++.....++.+++||+++++++++|+++|+|+++|+++|||+||++|+||...+.+++.+.++++.+    +
T Consensus        64 ~viipGg~~~~~~~~~~~~~~~l~~~~~~~k~i~aiC~G~~~La~aGlL~g~~~T~~~~~~~~l~~~g~~~~~~~----v  139 (166)
T d1g2ia_          64 ALVLPGGRAPERVRLNEKAVSIARKMFSEGKPVASICHGPQILISAGVLRGRKGTSYPGIKDDMINAGVEWVDAE----V  139 (166)
T ss_dssp             EEEECCBSHHHHHTTCHHHHHHHHHHHHTTCCEEEETTTTHHHHHHTCCTTCEECCCGGGHHHHHHTTCEECCSS----C
T ss_pred             EEEEecccchhhhccChHHHHHHHHHHhcCCeeeeccccchhhhhcCcccCCccccCccHHHHHHHcCCeEcCCC----E
Confidence            999999987766667999999999999999999999999999999999999999999999999999889998775    8


Q ss_pred             EEcCCEEeCCCCCCHHHHHHHHHHHH
Q 027708          169 VVDGNIITGATYEGHPEFIRLFLKAL  194 (220)
Q Consensus       169 v~dg~iiTs~g~~s~~~~~~~li~~l  194 (220)
                      |+|||+|||+|+.++.+|++++++.|
T Consensus       140 V~Dg~iiTs~g~~~~~~f~~~~i~~L  165 (166)
T d1g2ia_         140 VVDGNWVSSRVPADLYAWMREFVKLL  165 (166)
T ss_dssp             EEETTEEEECSGGGHHHHHHHHHHHH
T ss_pred             EEeCCEEECCCHHHHHHHHHHHHHhh
Confidence            99999999999999999999999987



>d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oi4a1 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ab0a1 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fexa1 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qvwa_ c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n57a_ c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhqa_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p80a1 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]} Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1t3ta2 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wl8a1 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s1ma1 c.23.16.1 (A:287-544) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyea_ c.23.16.4 (A:) Aspartyl dipeptidase PepE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1iowa1 c.30.1.2 (A:1-96) D-Ala-D-Ala ligase, N-domain {Escherichia coli, gene ddlB [TaxId: 562]} Back     information, alignment and structure