Citrus Sinensis ID: 027708
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 220 | ||||||
| 255570457 | 388 | protease C56, putative [Ricinus communis | 0.954 | 0.541 | 0.770 | 4e-96 | |
| 224134735 | 386 | predicted protein [Populus trichocarpa] | 0.95 | 0.541 | 0.769 | 1e-93 | |
| 118483416 | 386 | unknown [Populus trichocarpa] | 0.95 | 0.541 | 0.769 | 1e-93 | |
| 359476496 | 529 | PREDICTED: uncharacterized protein LOC10 | 0.913 | 0.379 | 0.806 | 1e-92 | |
| 297738171 | 386 | unnamed protein product [Vitis vinifera] | 0.913 | 0.520 | 0.806 | 2e-92 | |
| 449469102 | 390 | PREDICTED: uncharacterized protein LOC10 | 0.940 | 0.530 | 0.780 | 2e-92 | |
| 255570459 | 386 | protease C56, putative [Ricinus communis | 0.95 | 0.541 | 0.741 | 2e-88 | |
| 357166678 | 388 | PREDICTED: uncharacterized protein LOC10 | 0.913 | 0.518 | 0.757 | 3e-88 | |
| 115461240 | 387 | Os04g0671700 [Oryza sativa Japonica Grou | 0.913 | 0.519 | 0.747 | 1e-86 | |
| 226498180 | 387 | YLS5 [Zea mays] gi|194688460|gb|ACF78314 | 0.913 | 0.519 | 0.747 | 3e-86 |
| >gi|255570457|ref|XP_002526187.1| protease C56, putative [Ricinus communis] gi|223534491|gb|EEF36191.1| protease C56, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 356 bits (914), Expect = 4e-96, Method: Compositional matrix adjust.
Identities = 168/218 (77%), Positives = 197/218 (90%), Gaps = 8/218 (3%)
Query: 8 KRSVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQQTYSE 67
+++V LLCGDYMEDYEAMVPFQALLA+GV+VDAACPGKK+GD C TA+H+S+GHQ TYSE
Sbjct: 4 QKTVFLLCGDYMEDYEAMVPFQALLAYGVAVDAACPGKKAGDYCRTAIHESSGHQ-TYSE 62
Query: 68 TRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHG 127
+RGHNF LN+TFD+ID KYDGLVIPGGRAPEYLAMN+SV+D VRKF+++GK IAS+CHG
Sbjct: 63 SRGHNFTLNSTFDDIDFGKYDGLVIPGGRAPEYLAMNESVLDCVRKFADAGKPIASVCHG 122
Query: 128 QLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGATYEGHPEFI 187
QLILAAA +VKGRKCTAYPPV+PVLIAAGA W+EPETMA+CV DGN+ITGATYEGHPEFI
Sbjct: 123 QLILAAAGLVKGRKCTAYPPVRPVLIAAGAHWVEPETMASCVADGNLITGATYEGHPEFI 182
Query: 188 RLFLKALGGTITGSDKRILFLCG-------VSFCFQNL 218
+LF+KALGG+ITG+DKRILFLCG V+ FQ+L
Sbjct: 183 QLFVKALGGSITGADKRILFLCGDYMEDYEVTVPFQSL 220
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224134735|ref|XP_002327476.1| predicted protein [Populus trichocarpa] gi|222836030|gb|EEE74451.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|118483416|gb|ABK93608.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359476496|ref|XP_002272841.2| PREDICTED: uncharacterized protein LOC100247956 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297738171|emb|CBI27372.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449469102|ref|XP_004152260.1| PREDICTED: uncharacterized protein LOC101208672 [Cucumis sativus] gi|449484302|ref|XP_004156844.1| PREDICTED: uncharacterized LOC101208672 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255570459|ref|XP_002526188.1| protease C56, putative [Ricinus communis] gi|223534492|gb|EEF36192.1| protease C56, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|357166678|ref|XP_003580796.1| PREDICTED: uncharacterized protein LOC100841497 [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|115461240|ref|NP_001054220.1| Os04g0671700 [Oryza sativa Japonica Group] gi|70663940|emb|CAE03602.2| OSJNBb0004A17.4 [Oryza sativa Japonica Group] gi|90265250|emb|CAH67703.1| H0624F09.11 [Oryza sativa Indica Group] gi|113565791|dbj|BAF16134.1| Os04g0671700 [Oryza sativa Japonica Group] gi|125592020|gb|EAZ32370.1| hypothetical protein OsJ_16581 [Oryza sativa Japonica Group] gi|215704721|dbj|BAG94749.1| unnamed protein product [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|226498180|ref|NP_001146927.1| YLS5 [Zea mays] gi|194688460|gb|ACF78314.1| unknown [Zea mays] gi|195605312|gb|ACG24486.1| YLS5 [Zea mays] gi|414584851|tpg|DAA35422.1| TPA: YLS5 [Zea mays] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 220 | ||||||
| TAIR|locus:2075532 | 388 | DJ1D [Arabidopsis thaliana (ta | 0.931 | 0.528 | 0.738 | 1.2e-81 | |
| DICTYBASE|DDB_G0276405 | 194 | pfp1 "DJ-1/ThiJ/PfpI family pr | 0.863 | 0.979 | 0.445 | 3.2e-42 | |
| UNIPROTKB|Q8EH52 | 186 | SO_1378 "Peptidase family 56" | 0.831 | 0.983 | 0.470 | 3.6e-41 | |
| TIGR_CMR|SO_1378 | 186 | SO_1378 "ThiJ/PfpI family prot | 0.831 | 0.983 | 0.470 | 3.6e-41 | |
| TAIR|locus:2064955 | 398 | YLS5 [Arabidopsis thaliana (ta | 0.845 | 0.467 | 0.428 | 4.4e-36 | |
| TIGR_CMR|GSU_1159 | 167 | GSU_1159 "intracellular protea | 0.568 | 0.748 | 0.335 | 2.4e-19 | |
| UNIPROTKB|P45470 | 172 | yhbO "protein involved in stre | 0.640 | 0.819 | 0.352 | 1.7e-18 | |
| UNIPROTKB|Q81UM2 | 171 | BAS0802 "ThiJ/pfpI family prot | 0.763 | 0.982 | 0.263 | 1.5e-12 | |
| TIGR_CMR|BA_0842 | 171 | BA_0842 "thiJ/pfpI family prot | 0.763 | 0.982 | 0.263 | 1.5e-12 | |
| UNIPROTKB|Q3ZA81 | 180 | DET0118 "DJ-1 family protein" | 0.509 | 0.622 | 0.305 | 4.1e-10 |
| TAIR|locus:2075532 DJ1D [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 819 (293.4 bits), Expect = 1.2e-81, P = 1.2e-81
Identities = 155/210 (73%), Positives = 176/210 (83%)
Query: 1 MANSKGGKRSVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTG 60
MANS R+VL+LCGDYMEDYE MVPFQAL AFG++V CPGKK+GD CPTAVH G
Sbjct: 1 MANS----RTVLILCGDYMEDYEVMVPFQALQAFGITVHTVCPGKKAGDSCPTAVHDFCG 56
Query: 61 HQQTYSETRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKT 120
HQ TY E+RGHNF LNATFDE+D +KYDGLVIPGGRAPEYLA+ SV++LV++FS SGK
Sbjct: 57 HQ-TYFESRGHNFTLNATFDEVDLSKYDGLVIPGGRAPEYLALTASVVELVKEFSRSGKP 115
Query: 121 IASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGATY 180
IASICHGQLILAAAD V GRKCTAY V P L+AAGA W+EP T CVVDG++IT ATY
Sbjct: 116 IASICHGQLILAAADTVNGRKCTAYATVGPSLVAAGAKWVEPITPDVCVVDGSLITAATY 175
Query: 181 EGHPEFIRLFLKALGGTITGSDKRILFLCG 210
EGHPEFI+LF+KALGG ITG++KRILFLCG
Sbjct: 176 EGHPEFIQLFVKALGGKITGANKRILFLCG 205
|
|
| DICTYBASE|DDB_G0276405 pfp1 "DJ-1/ThiJ/PfpI family protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8EH52 SO_1378 "Peptidase family 56" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_1378 SO_1378 "ThiJ/PfpI family protein" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2064955 YLS5 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1159 GSU_1159 "intracellular protease, PfpI family" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P45470 yhbO "protein involved in stress response" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q81UM2 BAS0802 "ThiJ/pfpI family protein" [Bacillus anthracis (taxid:1392)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_0842 BA_0842 "thiJ/pfpI family protein" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3ZA81 DET0118 "DJ-1 family protein" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00440207 | SubName- Full=Putative uncharacterized protein; (387 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 220 | |||
| cd03169 | 180 | cd03169, GATase1_PfpI_1, Type 1 glutamine amidotra | 3e-95 | |
| TIGR01382 | 166 | TIGR01382, PfpI, intracellular protease, PfpI fami | 1e-53 | |
| cd03134 | 165 | cd03134, GATase1_PfpI_like, A type 1 glutamine ami | 3e-44 | |
| COG0693 | 188 | COG0693, ThiJ, Putative intracellular protease/ami | 4e-38 | |
| pfam01965 | 142 | pfam01965, DJ-1_PfpI, DJ-1/PfpI family | 7e-35 | |
| cd03135 | 163 | cd03135, GATase1_DJ-1, Type 1 glutamine amidotrans | 1e-21 | |
| cd03141 | 221 | cd03141, GATase1_Hsp31_like, Type 1 glutamine amid | 6e-17 | |
| cd03139 | 183 | cd03139, GATase1_PfpI_2, Type 1 glutamine amidotra | 1e-15 | |
| TIGR01383 | 179 | TIGR01383, not_thiJ, DJ-1 family protein | 3e-14 | |
| cd03140 | 170 | cd03140, GATase1_PfpI_3, Type 1 glutamine amidotra | 7e-11 | |
| pfam13278 | 164 | pfam13278, DUF4066, Putative amidotransferase | 1e-09 | |
| cd01653 | 115 | cd01653, GATase1, Type 1 glutamine amidotransferas | 3e-08 | |
| cd03128 | 92 | cd03128, GAT_1, Type 1 glutamine amidotransferase | 6e-08 | |
| cd03138 | 195 | cd03138, GATase1_AraC_2, AraC transcriptional regu | 2e-06 | |
| cd03137 | 187 | cd03137, GATase1_AraC_1, AraC transcriptional regu | 3e-06 | |
| cd03136 | 185 | cd03136, GATase1_AraC_ArgR_like, AraC transcriptio | 9e-06 | |
| cd03147 | 231 | cd03147, GATase1_Ydr533c_like, Type 1 glutamine am | 9e-06 | |
| COG4977 | 328 | COG4977, COG4977, Transcriptional regulator contai | 1e-05 | |
| cd01744 | 178 | cd01744, GATase1_CPSase, Small chain of the glutam | 5e-05 | |
| pfam00117 | 186 | pfam00117, GATase, Glutamine amidotransferase clas | 0.001 | |
| TIGR01737 | 227 | TIGR01737, FGAM_synth_I, phosphoribosylformylglyci | 0.003 |
| >gnl|CDD|153243 cd03169, GATase1_PfpI_1, Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus | Back alignment and domain information |
|---|
Score = 275 bits (706), Expect = 3e-95
Identities = 98/185 (52%), Positives = 125/185 (67%), Gaps = 5/185 (2%)
Query: 10 SVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQQTYSETR 69
+L+L GD++EDYE MVPFQAL G VD PGKK GD TA+H G Q TY+E
Sbjct: 1 KILILTGDFVEDYEVMVPFQALQEVGHEVDVVAPGKKKGDTVVTAIHDFPGWQ-TYTEKP 59
Query: 70 GHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQL 129
GH FA+ A FDE+DP YD LVIPGGRAPEYL +++ V+ +VR F+ + K +A+ICHG
Sbjct: 60 GHRFAVTADFDEVDPDDYDALVIPGGRAPEYLRLDEKVLAIVRHFAEANKPVAAICHGPQ 119
Query: 130 ILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGATYEGHPEFIRL 189
ILAAA V+KGR+CTAYP KP + AG + ++ VVDGN++T + HP F+R
Sbjct: 120 ILAAAGVLKGRRCTAYPACKPEVELAGGTVVDD----GVVVDGNLVTAQAWPDHPAFLRE 175
Query: 190 FLKAL 194
FLK L
Sbjct: 176 FLKLL 180
|
Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. PfpI is an ATP-independent intracellular proteases which may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. Length = 180 |
| >gnl|CDD|233389 TIGR01382, PfpI, intracellular protease, PfpI family | Back alignment and domain information |
|---|
| >gnl|CDD|153228 cd03134, GATase1_PfpI_like, A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus | Back alignment and domain information |
|---|
| >gnl|CDD|223765 COG0693, ThiJ, Putative intracellular protease/amidase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|216814 pfam01965, DJ-1_PfpI, DJ-1/PfpI family | Back alignment and domain information |
|---|
| >gnl|CDD|153229 cd03135, GATase1_DJ-1, Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1 | Back alignment and domain information |
|---|
| >gnl|CDD|153235 cd03141, GATase1_Hsp31_like, Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein | Back alignment and domain information |
|---|
| >gnl|CDD|153233 cd03139, GATase1_PfpI_2, Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus | Back alignment and domain information |
|---|
| >gnl|CDD|213612 TIGR01383, not_thiJ, DJ-1 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|153234 cd03140, GATase1_PfpI_3, Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus | Back alignment and domain information |
|---|
| >gnl|CDD|222020 pfam13278, DUF4066, Putative amidotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|153210 cd01653, GATase1, Type 1 glutamine amidotransferase (GATase1)-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|153222 cd03128, GAT_1, Type 1 glutamine amidotransferase (GATase1)-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|153232 cd03138, GATase1_AraC_2, AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|153231 cd03137, GATase1_AraC_1, AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|153230 cd03136, GATase1_AraC_ArgR_like, AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|153241 cd03147, GATase1_Ydr533c_like, Type 1 glutamine amidotransferase (GATase1)-like domain found in Saccharomyces cerevisiae Ydr533c protein | Back alignment and domain information |
|---|
| >gnl|CDD|227311 COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|153215 cd01744, GATase1_CPSase, Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II | Back alignment and domain information |
|---|
| >gnl|CDD|215729 pfam00117, GATase, Glutamine amidotransferase class-I | Back alignment and domain information |
|---|
| >gnl|CDD|233553 TIGR01737, FGAM_synth_I, phosphoribosylformylglycinamidine synthase I | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 220 | |||
| TIGR01382 | 166 | PfpI intracellular protease, PfpI family. The memb | 100.0 | |
| cd03134 | 165 | GATase1_PfpI_like A type 1 glutamine amidotransfer | 100.0 | |
| cd03135 | 163 | GATase1_DJ-1 Type 1 glutamine amidotransferase (GA | 100.0 | |
| cd03169 | 180 | GATase1_PfpI_1 Type 1 glutamine amidotransferase ( | 100.0 | |
| TIGR01383 | 179 | not_thiJ DJ-1 family protein. This model represent | 100.0 | |
| cd03137 | 187 | GATase1_AraC_1 AraC transcriptional regulators hav | 100.0 | |
| cd03139 | 183 | GATase1_PfpI_2 Type 1 glutamine amidotransferase ( | 100.0 | |
| cd03136 | 185 | GATase1_AraC_ArgR_like AraC transcriptional regula | 100.0 | |
| PRK09393 | 322 | ftrA transcriptional activator FtrA; Provisional | 100.0 | |
| PF13278 | 166 | DUF4066: Putative amidotransferase; PDB: 3BHN_A 3M | 100.0 | |
| cd03138 | 195 | GATase1_AraC_2 AraC transcriptional regulators hav | 100.0 | |
| cd03140 | 170 | GATase1_PfpI_3 Type 1 glutamine amidotransferase ( | 100.0 | |
| COG4977 | 328 | Transcriptional regulator containing an amidase do | 100.0 | |
| PRK11574 | 196 | oxidative-stress-resistance chaperone; Provisional | 100.0 | |
| KOG2764 | 247 | consensus Putative transcriptional regulator DJ-1 | 99.98 | |
| cd03147 | 231 | GATase1_Ydr533c_like Type 1 glutamine amidotransfe | 99.97 | |
| cd03141 | 221 | GATase1_Hsp31_like Type 1 glutamine amidotransfera | 99.97 | |
| PRK04155 | 287 | chaperone protein HchA; Provisional | 99.97 | |
| COG0693 | 188 | ThiJ Putative intracellular protease/amidase [Gene | 99.97 | |
| cd03148 | 232 | GATase1_EcHsp31_like Type 1 glutamine amidotransfe | 99.97 | |
| PF01965 | 147 | DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 T | 99.96 | |
| PRK11780 | 217 | isoprenoid biosynthesis protein with amidotransfer | 99.95 | |
| cd03133 | 213 | GATase1_ES1 Type 1 glutamine amidotransferase (GAT | 99.94 | |
| cd03132 | 142 | GATase1_catalase Type 1 glutamine amidotransferase | 99.91 | |
| PRK11249 | 752 | katE hydroperoxidase II; Provisional | 99.75 | |
| cd01740 | 238 | GATase1_FGAR_AT Type 1 glutamine amidotransferase | 99.42 | |
| PRK03619 | 219 | phosphoribosylformylglycinamidine synthase I; Prov | 99.41 | |
| COG3155 | 217 | ElbB Uncharacterized protein involved in an early | 99.37 | |
| PRK01175 | 261 | phosphoribosylformylglycinamidine synthase I; Prov | 99.35 | |
| TIGR01737 | 227 | FGAM_synth_I phosphoribosylformylglycinamidine syn | 99.25 | |
| COG0047 | 231 | PurL Phosphoribosylformylglycinamidine (FGAM) synt | 99.24 | |
| cd01653 | 115 | GATase1 Type 1 glutamine amidotransferase (GATase1 | 99.03 | |
| PRK13526 | 179 | glutamine amidotransferase subunit PdxT; Provision | 98.98 | |
| TIGR03800 | 184 | PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, gl | 98.97 | |
| PRK13527 | 200 | glutamine amidotransferase subunit PdxT; Provision | 98.92 | |
| PF13507 | 259 | GATase_5: CobB/CobQ-like glutamine amidotransferas | 98.85 | |
| cd03128 | 92 | GAT_1 Type 1 glutamine amidotransferase (GATase1)- | 98.81 | |
| PRK13525 | 189 | glutamine amidotransferase subunit PdxT; Provision | 98.75 | |
| PLN02832 | 248 | glutamine amidotransferase subunit of pyridoxal 5' | 98.59 | |
| cd03130 | 198 | GATase1_CobB Type 1 glutamine amidotransferase (GA | 98.53 | |
| PRK08250 | 235 | glutamine amidotransferase; Provisional | 98.51 | |
| cd01750 | 194 | GATase1_CobQ Type 1 glutamine amidotransferase (GA | 98.46 | |
| PRK13143 | 200 | hisH imidazole glycerol phosphate synthase subunit | 98.46 | |
| PRK07053 | 234 | glutamine amidotransferase; Provisional | 98.45 | |
| cd01749 | 183 | GATase1_PB Glutamine Amidotransferase (GATase_I) i | 98.41 | |
| TIGR01857 | 1239 | FGAM-synthase phosphoribosylformylglycinamidine sy | 98.4 | |
| PLN03206 | 1307 | phosphoribosylformylglycinamidine synthase; Provis | 98.34 | |
| COG0311 | 194 | PDX2 Predicted glutamine amidotransferase involved | 98.3 | |
| CHL00188 | 210 | hisH imidazole glycerol phosphate synthase subunit | 98.28 | |
| cd01741 | 188 | GATase1_1 Subgroup of proteins having the Type 1 g | 98.26 | |
| TIGR01735 | 1310 | FGAM_synt phosphoribosylformylglycinamidine syntha | 98.26 | |
| PRK05297 | 1290 | phosphoribosylformylglycinamidine synthase; Provis | 98.25 | |
| PRK01077 | 451 | cobyrinic acid a,c-diamide synthase; Validated | 98.23 | |
| PRK06490 | 239 | glutamine amidotransferase; Provisional | 98.23 | |
| PHA03366 | 1304 | FGAM-synthase; Provisional | 98.14 | |
| cd01748 | 198 | GATase1_IGP_Synthase Type 1 glutamine amidotransfe | 98.12 | |
| PRK06895 | 190 | putative anthranilate synthase component II; Provi | 98.12 | |
| PRK13141 | 205 | hisH imidazole glycerol phosphate synthase subunit | 98.11 | |
| PRK13146 | 209 | hisH imidazole glycerol phosphate synthase subunit | 98.07 | |
| TIGR01739 | 1202 | tegu_FGAM_synt herpesvirus tegument protein/v-FGAM | 98.06 | |
| cd01744 | 178 | GATase1_CPSase Small chain of the glutamine-depend | 98.03 | |
| PRK09065 | 237 | glutamine amidotransferase; Provisional | 97.99 | |
| PRK05665 | 240 | amidotransferase; Provisional | 97.97 | |
| PF07685 | 158 | GATase_3: CobB/CobQ-like glutamine amidotransferas | 97.89 | |
| TIGR00888 | 188 | guaA_Nterm GMP synthase (glutamine-hydrolyzing), N | 97.85 | |
| PF01174 | 188 | SNO: SNO glutamine amidotransferase family; InterP | 97.84 | |
| TIGR00379 | 449 | cobB cobyrinic acid a,c-diamide synthase. This mod | 97.83 | |
| PRK13170 | 196 | hisH imidazole glycerol phosphate synthase subunit | 97.78 | |
| PRK00784 | 488 | cobyric acid synthase; Provisional | 97.76 | |
| PRK07567 | 242 | glutamine amidotransferase; Provisional | 97.76 | |
| PRK08007 | 187 | para-aminobenzoate synthase component II; Provisio | 97.76 | |
| PRK13181 | 199 | hisH imidazole glycerol phosphate synthase subunit | 97.75 | |
| PRK07765 | 214 | para-aminobenzoate synthase component II; Provisio | 97.75 | |
| TIGR01855 | 196 | IMP_synth_hisH imidazole glycerol phosphate syntha | 97.75 | |
| PRK06774 | 191 | para-aminobenzoate synthase component II; Provisio | 97.74 | |
| COG0518 | 198 | GuaA GMP synthase - Glutamine amidotransferase dom | 97.74 | |
| COG0118 | 204 | HisH Glutamine amidotransferase [Amino acid transp | 97.68 | |
| TIGR00566 | 188 | trpG_papA glutamine amidotransferase of anthranila | 97.67 | |
| PLN02617 | 538 | imidazole glycerol phosphate synthase hisHF | 97.66 | |
| cd01742 | 181 | GATase1_GMP_Synthase Type 1 glutamine amidotransfe | 97.61 | |
| PRK05670 | 189 | anthranilate synthase component II; Provisional | 97.54 | |
| PRK12564 | 360 | carbamoyl phosphate synthase small subunit; Review | 97.54 | |
| PRK05637 | 208 | anthranilate synthase component II; Provisional | 97.46 | |
| PRK08857 | 193 | para-aminobenzoate synthase component II; Provisio | 97.46 | |
| CHL00101 | 190 | trpG anthranilate synthase component 2 | 97.45 | |
| PRK07649 | 195 | para-aminobenzoate/anthranilate synthase glutamine | 97.42 | |
| CHL00197 | 382 | carA carbamoyl-phosphate synthase arginine-specifi | 97.4 | |
| PRK13152 | 201 | hisH imidazole glycerol phosphate synthase subunit | 97.4 | |
| PLN02335 | 222 | anthranilate synthase | 97.39 | |
| cd01743 | 184 | GATase1_Anthranilate_Synthase Type 1 glutamine ami | 97.35 | |
| PRK13566 | 720 | anthranilate synthase; Provisional | 97.34 | |
| PRK00758 | 184 | GMP synthase subunit A; Validated | 97.32 | |
| PRK13142 | 192 | hisH imidazole glycerol phosphate synthase subunit | 97.31 | |
| PRK13896 | 433 | cobyrinic acid a,c-diamide synthase; Provisional | 97.31 | |
| TIGR01368 | 358 | CPSaseIIsmall carbamoyl-phosphate synthase, small | 97.28 | |
| PRK14004 | 210 | hisH imidazole glycerol phosphate synthase subunit | 97.28 | |
| cd01745 | 189 | GATase1_2 Subgroup of proteins having the Type 1 g | 97.24 | |
| PF00117 | 192 | GATase: Glutamine amidotransferase class-I; InterP | 97.23 | |
| COG1797 | 451 | CobB Cobyrinic acid a,c-diamide synthase [Coenzyme | 97.2 | |
| cd03146 | 212 | GAT1_Peptidase_E Type 1 glutamine amidotransferase | 97.18 | |
| TIGR01815 | 717 | TrpE-clade3 anthranilate synthase, alpha proteobac | 97.15 | |
| PRK06278 | 476 | cobyrinic acid a,c-diamide synthase; Validated | 97.15 | |
| cd03144 | 114 | GATase1_ScBLP_like Type 1 glutamine amidotransfera | 97.15 | |
| TIGR00313 | 475 | cobQ cobyric acid synthase CobQ. | 97.1 | |
| PRK05282 | 233 | (alpha)-aspartyl dipeptidase; Validated | 97.05 | |
| PRK12838 | 354 | carbamoyl phosphate synthase small subunit; Review | 97.04 | |
| cd01746 | 235 | GATase1_CTP_Synthase Type 1 glutamine amidotransfe | 96.72 | |
| PF09825 | 367 | BPL_N: Biotin-protein ligase, N terminal; InterPro | 96.69 | |
| KOG3210 | 226 | consensus Imidazoleglycerol-phosphate synthase sub | 96.64 | |
| PLN02347 | 536 | GMP synthetase | 96.57 | |
| PLN02771 | 415 | carbamoyl-phosphate synthase (glutamine-hydrolyzin | 96.51 | |
| COG0512 | 191 | PabA Anthranilate/para-aminobenzoate synthases com | 96.47 | |
| PRK11366 | 254 | puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; | 96.46 | |
| PRK09522 | 531 | bifunctional glutamine amidotransferase/anthranila | 96.24 | |
| PRK14607 | 534 | bifunctional glutamine amidotransferase/anthranila | 96.23 | |
| PRK00074 | 511 | guaA GMP synthase; Reviewed | 96.21 | |
| PRK05380 | 533 | pyrG CTP synthetase; Validated | 95.91 | |
| COG2071 | 243 | Predicted glutamine amidotransferases [General fun | 95.88 | |
| PRK06186 | 229 | hypothetical protein; Validated | 95.77 | |
| cd03129 | 210 | GAT1_Peptidase_E_like Type 1 glutamine amidotransf | 95.74 | |
| cd01747 | 273 | GATase1_Glutamyl_Hydrolase Type 1 glutamine amidot | 95.18 | |
| COG0505 | 368 | CarA Carbamoylphosphate synthase small subunit [Am | 95.17 | |
| COG3442 | 250 | Predicted glutamine amidotransferase [General func | 94.99 | |
| COG1492 | 486 | CobQ Cobyric acid synthase [Coenzyme metabolism] | 94.98 | |
| PLN02327 | 557 | CTP synthase | 94.8 | |
| TIGR00337 | 525 | PyrG CTP synthase. CTP synthase is involved in pyr | 94.72 | |
| PF13587 | 38 | DJ-1_PfpI_N: N-terminal domain of DJ-1_PfpI family | 94.62 | |
| KOG3179 | 245 | consensus Predicted glutamine synthetase [Nucleoti | 94.5 | |
| PRK05368 | 302 | homoserine O-succinyltransferase; Provisional | 94.42 | |
| TIGR02069 | 250 | cyanophycinase cyanophycinase. This model describe | 94.02 | |
| PF07722 | 217 | Peptidase_C26: Peptidase C26; InterPro: IPR011697 | 93.45 | |
| TIGR01823 | 742 | PabB-fungal aminodeoxychorismate synthase, fungal | 93.35 | |
| PF03575 | 154 | Peptidase_S51: Peptidase family S51; InterPro: IPR | 93.11 | |
| PLN02889 | 918 | oxo-acid-lyase/anthranilate synthase | 93.01 | |
| KOG1907 | 1320 | consensus Phosphoribosylformylglycinamidine syntha | 92.75 | |
| KOG0370 | 1435 | consensus Multifunctional pyrimidine synthesis pro | 92.58 | |
| cd03145 | 217 | GAT1_cyanophycinase Type 1 glutamine amidotransfer | 92.04 | |
| COG0504 | 533 | PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide | 91.93 | |
| cd03131 | 175 | GATase1_HTS Type 1 glutamine amidotransferase (GAT | 90.95 | |
| KOG2764 | 247 | consensus Putative transcriptional regulator DJ-1 | 90.89 | |
| PF09822 | 271 | ABC_transp_aux: ABC-type uncharacterized transport | 89.61 | |
| COG4285 | 253 | Uncharacterized conserved protein [Function unknow | 89.3 | |
| PRK02645 | 305 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 89.16 | |
| COG4635 | 175 | HemG Flavodoxin [Energy production and conversion | 88.97 | |
| COG3340 | 224 | PepE Peptidase E [Amino acid transport and metabol | 88.7 | |
| PRK01231 | 295 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 87.19 | |
| KOG2387 | 585 | consensus CTP synthase (UTP-ammonia lyase) [Nucleo | 85.79 | |
| PRK11104 | 177 | hemG protoporphyrinogen oxidase; Provisional | 84.59 | |
| PRK02155 | 291 | ppnK NAD(+)/NADH kinase family protein; Provisiona | 84.39 | |
| PF08532 | 207 | Glyco_hydro_42M: Beta-galactosidase trimerisation | 82.71 | |
| KOG0623 | 541 | consensus Glutamine amidotransferase/cyclase [Amin | 82.22 | |
| cd03143 | 154 | A4_beta-galactosidase_middle_domain A4 beta-galact | 81.9 | |
| PRK03378 | 292 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 80.35 | |
| PF03698 | 80 | UPF0180: Uncharacterised protein family (UPF0180); | 80.15 |
| >TIGR01382 PfpI intracellular protease, PfpI family | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.2e-36 Score=229.96 Aligned_cols=166 Identities=42% Similarity=0.731 Sum_probs=152.1
Q ss_pred eEEEEecCCCCchhhHHHHHHHHhCCCeEEEEcCCCCCCCCCCcccccCCCcccccccccCcccccCcCcCCCCCCCccE
Q 027708 10 SVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQQTYSETRGHNFALNATFDEIDPTKYDG 89 (220)
Q Consensus 10 kI~il~~~g~~~~e~~~~~~~l~~ag~~v~~~s~~~~~~~~~~~~~~~~~~~~~~v~~~~g~~i~~~~~l~~~~~~~~D~ 89 (220)
||+|++++||+..|+..|+++|+.+|+++.++|++++ ++.++.|..+.++.++++.+..+||+
T Consensus 1 ~v~il~~~g~~~~e~~~~~~~l~~ag~~v~~vs~~~~-----------------~v~~~~g~~i~~~~~~~~~~~~~~D~ 63 (166)
T TIGR01382 1 KLLVLTTDEFEDSELLYPLDRLREAGHEVDTVSKEAG-----------------TTVGKHGYSVTVDATIDEVNPEEYDA 63 (166)
T ss_pred CEEEEecCCchHHHHHHHHHHHHHCCCEEEEEecCCC-----------------ceeccCCceeeccCChhhCCHHHCcE
Confidence 6999999999999999999999999999999998765 78889999999999998876668999
Q ss_pred EEEcCCCCcccccCChHHHHHHHHHHhCCCeEEEEehHHHHHHhCcccCCceEecCCCCHHHHHHCCCeEecCCCCceEE
Q 027708 90 LVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACV 169 (220)
Q Consensus 90 liipGG~~~~~~~~~~~l~~~l~~~~~~g~~i~aic~G~~~La~aglL~g~~~T~~~~~~~~l~~~g~~~~~~~~~~~~v 169 (220)
|+||||.++..+..++.+.+||+++++++++|+++|+|+++|+++|+|+||++|+||...+.+++.+.++.+.+ .++
T Consensus 64 vvv~Gg~~~~~~~~~~~l~~~l~~~~~~~~~i~~ic~G~~~La~aglL~g~~~T~~~~~~~~~~~~~~~~~~~~---~~v 140 (166)
T TIGR01382 64 LVIPGGRAPEYLRLNNKAVRLVREFVEKGKPVAAICHGPQLLISAGVLRGKKLTSYPAIIDDVKNAGAEYVDIE---VVV 140 (166)
T ss_pred EEECCCCCHHHhccCHHHHHHHHHHHHcCCEEEEEChHHHHHHhcCccCCCEEEcCccHHHHHHHCCCeEEcCC---CEE
Confidence 99999977555567899999999999999999999999999999999999999999999999998888888743 399
Q ss_pred EcCCEEeCCCCCCHHHHHHHHHHHHc
Q 027708 170 VDGNIITGATYEGHPEFIRLFLKALG 195 (220)
Q Consensus 170 ~dg~iiTs~g~~s~~~~~~~li~~l~ 195 (220)
+|||+|||+|+.++.+|+..+++.++
T Consensus 141 ~dg~iiT~~~~~~~~~fa~~~~~~l~ 166 (166)
T TIGR01382 141 VDGNLVTSRVPDDLPAFNREFLKLLG 166 (166)
T ss_pred EECCEEEeCCcccHHHHHHHHHHHhC
Confidence 99999999999999999999999874
|
The member of this family from Pyrococcus horikoshii has been solved to 2 Angstrom resolution. It is an ATP-independent intracellular protease that crystallizes as a hexameric ring. Cys-101 is proposed as the active site residue in a catalytic triad with the adjacent His-102 and a Glu residue from an adjacent monomer. A member of this family from Bacillus subtilis, GSP18, has been shown to be expressed in response to several forms of stress. A role in the degradation of small peptides has been suggested. A closely related family consists of the thiamine biosynthesis protein ThiJ and its homologs. |
| >cd03134 GATase1_PfpI_like A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus | Back alignment and domain information |
|---|
| >cd03135 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1 | Back alignment and domain information |
|---|
| >cd03169 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus | Back alignment and domain information |
|---|
| >TIGR01383 not_thiJ DJ-1 family protein | Back alignment and domain information |
|---|
| >cd03137 GATase1_AraC_1 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain | Back alignment and domain information |
|---|
| >cd03139 GATase1_PfpI_2 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus | Back alignment and domain information |
|---|
| >cd03136 GATase1_AraC_ArgR_like AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain | Back alignment and domain information |
|---|
| >PRK09393 ftrA transcriptional activator FtrA; Provisional | Back alignment and domain information |
|---|
| >PF13278 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3MGK_B 3NOV_A 3NON_B 3NOO_B 3NOQ_A 3NOR_A 3GRA_A 3EWN_A 3ER6_C | Back alignment and domain information |
|---|
| >cd03138 GATase1_AraC_2 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain | Back alignment and domain information |
|---|
| >cd03140 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus | Back alignment and domain information |
|---|
| >COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription] | Back alignment and domain information |
|---|
| >PRK11574 oxidative-stress-resistance chaperone; Provisional | Back alignment and domain information |
|---|
| >KOG2764 consensus Putative transcriptional regulator DJ-1 [General function prediction only; Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03147 GATase1_Ydr533c_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Saccharomyces cerevisiae Ydr533c protein | Back alignment and domain information |
|---|
| >cd03141 GATase1_Hsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein | Back alignment and domain information |
|---|
| >PRK04155 chaperone protein HchA; Provisional | Back alignment and domain information |
|---|
| >COG0693 ThiJ Putative intracellular protease/amidase [General function prediction only] | Back alignment and domain information |
|---|
| >cd03148 GATase1_EcHsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Escherichia coli Hsp31 protein (EcHsp31) | Back alignment and domain information |
|---|
| >PF01965 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 This signature defines a diverse group of protein families which include proteins involved in RNA-protein interaction regulation, thiamine biosynthesis, Ras-related signal transduction, and those with protease activity | Back alignment and domain information |
|---|
| >PRK11780 isoprenoid biosynthesis protein with amidotransferase-like domain; Provisional | Back alignment and domain information |
|---|
| >cd03133 GATase1_ES1 Type 1 glutamine amidotransferase (GATase1)-like domain found in zebrafish ES1 | Back alignment and domain information |
|---|
| >cd03132 GATase1_catalase Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases | Back alignment and domain information |
|---|
| >PRK11249 katE hydroperoxidase II; Provisional | Back alignment and domain information |
|---|
| >cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase | Back alignment and domain information |
|---|
| >PRK03619 phosphoribosylformylglycinamidine synthase I; Provisional | Back alignment and domain information |
|---|
| >COG3155 ElbB Uncharacterized protein involved in an early stage of isoprenoid biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional | Back alignment and domain information |
|---|
| >TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I | Back alignment and domain information |
|---|
| >COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd01653 GATase1 Type 1 glutamine amidotransferase (GATase1)-like domain | Back alignment and domain information |
|---|
| >PRK13526 glutamine amidotransferase subunit PdxT; Provisional | Back alignment and domain information |
|---|
| >TIGR03800 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 | Back alignment and domain information |
|---|
| >PRK13527 glutamine amidotransferase subunit PdxT; Provisional | Back alignment and domain information |
|---|
| >PF13507 GATase_5: CobB/CobQ-like glutamine amidotransferase domain; PDB: 3D54_L 3UMM_A 3UJN_A 3UGJ_A 1T3T_A | Back alignment and domain information |
|---|
| >cd03128 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like domain | Back alignment and domain information |
|---|
| >PRK13525 glutamine amidotransferase subunit PdxT; Provisional | Back alignment and domain information |
|---|
| >PLN02832 glutamine amidotransferase subunit of pyridoxal 5'-phosphate synthase complex | Back alignment and domain information |
|---|
| >cd03130 GATase1_CobB Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase | Back alignment and domain information |
|---|
| >PRK08250 glutamine amidotransferase; Provisional | Back alignment and domain information |
|---|
| >cd01750 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ) | Back alignment and domain information |
|---|
| >PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >PRK07053 glutamine amidotransferase; Provisional | Back alignment and domain information |
|---|
| >cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis | Back alignment and domain information |
|---|
| >TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase, clade II | Back alignment and domain information |
|---|
| >PLN03206 phosphoribosylformylglycinamidine synthase; Provisional | Back alignment and domain information |
|---|
| >COG0311 PDX2 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional | Back alignment and domain information |
|---|
| >cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain | Back alignment and domain information |
|---|
| >TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase, single chain form | Back alignment and domain information |
|---|
| >PRK05297 phosphoribosylformylglycinamidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK01077 cobyrinic acid a,c-diamide synthase; Validated | Back alignment and domain information |
|---|
| >PRK06490 glutamine amidotransferase; Provisional | Back alignment and domain information |
|---|
| >PHA03366 FGAM-synthase; Provisional | Back alignment and domain information |
|---|
| >cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) | Back alignment and domain information |
|---|
| >PRK06895 putative anthranilate synthase component II; Provisional | Back alignment and domain information |
|---|
| >PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >TIGR01739 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synthase | Back alignment and domain information |
|---|
| >cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II | Back alignment and domain information |
|---|
| >PRK09065 glutamine amidotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05665 amidotransferase; Provisional | Back alignment and domain information |
|---|
| >PF07685 GATase_3: CobB/CobQ-like glutamine amidotransferase domain; InterPro: IPR011698 This group of enzymes was suggested to be related to the MinD family of ATPases involved in regulation of cell division in bacteria and archaea [] | Back alignment and domain information |
|---|
| >TIGR00888 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit | Back alignment and domain information |
|---|
| >PF01174 SNO: SNO glutamine amidotransferase family; InterPro: IPR002161 Members of this family are involved in the pyridoxine biosynthetic pathway [, ] | Back alignment and domain information |
|---|
| >TIGR00379 cobB cobyrinic acid a,c-diamide synthase | Back alignment and domain information |
|---|
| >PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >PRK00784 cobyric acid synthase; Provisional | Back alignment and domain information |
|---|
| >PRK07567 glutamine amidotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08007 para-aminobenzoate synthase component II; Provisional | Back alignment and domain information |
|---|
| >PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >PRK07765 para-aminobenzoate synthase component II; Provisional | Back alignment and domain information |
|---|
| >TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit | Back alignment and domain information |
|---|
| >PRK06774 para-aminobenzoate synthase component II; Provisional | Back alignment and domain information |
|---|
| >COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase | Back alignment and domain information |
|---|
| >PLN02617 imidazole glycerol phosphate synthase hisHF | Back alignment and domain information |
|---|
| >cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase | Back alignment and domain information |
|---|
| >PRK05670 anthranilate synthase component II; Provisional | Back alignment and domain information |
|---|
| >PRK12564 carbamoyl phosphate synthase small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK05637 anthranilate synthase component II; Provisional | Back alignment and domain information |
|---|
| >PRK08857 para-aminobenzoate synthase component II; Provisional | Back alignment and domain information |
|---|
| >CHL00101 trpG anthranilate synthase component 2 | Back alignment and domain information |
|---|
| >PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated | Back alignment and domain information |
|---|
| >CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >PLN02335 anthranilate synthase | Back alignment and domain information |
|---|
| >cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase | Back alignment and domain information |
|---|
| >PRK13566 anthranilate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK00758 GMP synthase subunit A; Validated | Back alignment and domain information |
|---|
| >PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >PRK13896 cobyrinic acid a,c-diamide synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit | Back alignment and domain information |
|---|
| >PRK14004 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain | Back alignment and domain information |
|---|
| >PF00117 GATase: Glutamine amidotransferase class-I; InterPro: IPR017926 Glutamine amidotransferase (GATase) enzymes catalyse the removal of the ammonia group from glutamine and then transfer this group to a substrate to form a new carbon-nitrogen group [] | Back alignment and domain information |
|---|
| >COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd03146 GAT1_Peptidase_E Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E | Back alignment and domain information |
|---|
| >TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade | Back alignment and domain information |
|---|
| >PRK06278 cobyrinic acid a,c-diamide synthase; Validated | Back alignment and domain information |
|---|
| >cd03144 GATase1_ScBLP_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Saccharomyces cerevisiae biotin-apoprotein ligase (ScBLP) | Back alignment and domain information |
|---|
| >TIGR00313 cobQ cobyric acid synthase CobQ | Back alignment and domain information |
|---|
| >PRK05282 (alpha)-aspartyl dipeptidase; Validated | Back alignment and domain information |
|---|
| >PRK12838 carbamoyl phosphate synthase small subunit; Reviewed | Back alignment and domain information |
|---|
| >cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase | Back alignment and domain information |
|---|
| >PF09825 BPL_N: Biotin-protein ligase, N terminal; InterPro: IPR019197 The function of this structural domain is unknown | Back alignment and domain information |
|---|
| >KOG3210 consensus Imidazoleglycerol-phosphate synthase subunit H-like [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02347 GMP synthetase | Back alignment and domain information |
|---|
| >PLN02771 carbamoyl-phosphate synthase (glutamine-hydrolyzing) | Back alignment and domain information |
|---|
| >COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK09522 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14607 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00074 guaA GMP synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK05380 pyrG CTP synthetase; Validated | Back alignment and domain information |
|---|
| >COG2071 Predicted glutamine amidotransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06186 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd03129 GAT1_Peptidase_E_like Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E_like proteins | Back alignment and domain information |
|---|
| >cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase | Back alignment and domain information |
|---|
| >COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG3442 Predicted glutamine amidotransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN02327 CTP synthase | Back alignment and domain information |
|---|
| >TIGR00337 PyrG CTP synthase | Back alignment and domain information |
|---|
| >PF13587 DJ-1_PfpI_N: N-terminal domain of DJ-1_PfpI family; PDB: 1U9C_A 1QVW_B 1QVV_D 1QVZ_A 1RW7_A | Back alignment and domain information |
|---|
| >KOG3179 consensus Predicted glutamine synthetase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05368 homoserine O-succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02069 cyanophycinase cyanophycinase | Back alignment and domain information |
|---|
| >PF07722 Peptidase_C26: Peptidase C26; InterPro: IPR011697 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >TIGR01823 PabB-fungal aminodeoxychorismate synthase, fungal clade | Back alignment and domain information |
|---|
| >PF03575 Peptidase_S51: Peptidase family S51; InterPro: IPR005320 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PLN02889 oxo-acid-lyase/anthranilate synthase | Back alignment and domain information |
|---|
| >KOG1907 consensus Phosphoribosylformylglycinamidine synthase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0370 consensus Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] | Back alignment and domain information |
|---|
| >cd03145 GAT1_cyanophycinase Type 1 glutamine amidotransferase (GATase1)-like domain found in cyanophycinase | Back alignment and domain information |
|---|
| >COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd03131 GATase1_HTS Type 1 glutamine amidotransferase (GATase1)-like domain found in homoserine trans-succinylase (HTS) | Back alignment and domain information |
|---|
| >KOG2764 consensus Putative transcriptional regulator DJ-1 [General function prediction only; Defense mechanisms] | Back alignment and domain information |
|---|
| >PF09822 ABC_transp_aux: ABC-type uncharacterized transport system; InterPro: IPR019196 This domain is found in various eukaryotic and prokaryotic intra-flagellar transport proteins involved in gliding motility, as well as in several hypothetical proteins | Back alignment and domain information |
|---|
| >COG4285 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK02645 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >COG4635 HemG Flavodoxin [Energy production and conversion / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG3340 PepE Peptidase E [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK01231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2387 consensus CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11104 hemG protoporphyrinogen oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK02155 ppnK NAD(+)/NADH kinase family protein; Provisional | Back alignment and domain information |
|---|
| >PF08532 Glyco_hydro_42M: Beta-galactosidase trimerisation domain; InterPro: IPR013738 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >KOG0623 consensus Glutamine amidotransferase/cyclase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03143 A4_beta-galactosidase_middle_domain A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain | Back alignment and domain information |
|---|
| >PRK03378 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PF03698 UPF0180: Uncharacterised protein family (UPF0180); InterPro: IPR005370 The members of this family are small uncharacterised proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 220 | ||||
| 3uk7_A | 396 | Crystal Structure Of Arabidopsis Thaliana Dj-1d Len | 2e-85 | ||
| 1g2i_A | 166 | Crystal Structure Of A Novel Intracellular Protease | 1e-25 | ||
| 3l18_A | 168 | Ton1285, An Intracellular Protease From Thermococcu | 4e-23 | ||
| 1oi4_A | 193 | Crystal Structure Of Yhbo From Escherichia Coli Len | 7e-19 | ||
| 2vrn_A | 190 | The Structure Of The Stress Response Protein Dr1199 | 4e-14 | ||
| 3fse_A | 365 | Crystal Structure Of A Two-Domain Protein Containin | 5e-13 | ||
| 4e08_A | 190 | Crystal Structure Of Drosophila Melanogaster Dj-1be | 3e-08 | ||
| 3nor_A | 231 | Crystal Structure Of T102s Isocyanide Hydratase Fro | 2e-05 | ||
| 3nov_A | 231 | Crystal Structure Of D17e Isocyanide Hydratase From | 2e-05 | ||
| 3noo_A | 231 | Crystal Structure Of C101a Isocyanide Hydratase Fro | 3e-04 | ||
| 3noq_A | 231 | Crystal Structure Of C101s Isocyanide Hydratase Fro | 3e-04 | ||
| 3non_A | 231 | Crystal Structure Of Isocyanide Hydratase From Pseu | 4e-04 |
| >pdb|3UK7|A Chain A, Crystal Structure Of Arabidopsis Thaliana Dj-1d Length = 396 | Back alignment and structure |
|
| >pdb|1G2I|A Chain A, Crystal Structure Of A Novel Intracellular Protease From Pyrococcus Horikoshii At 2 A Resolution Length = 166 | Back alignment and structure |
| >pdb|3L18|A Chain A, Ton1285, An Intracellular Protease From Thermococcus Onnurineus Na1 Length = 168 | Back alignment and structure |
| >pdb|1OI4|A Chain A, Crystal Structure Of Yhbo From Escherichia Coli Length = 193 | Back alignment and structure |
| >pdb|2VRN|A Chain A, The Structure Of The Stress Response Protein Dr1199 From Deinococcus Radiodurans: A Member Of The Dj-1 Superfamily Length = 190 | Back alignment and structure |
| >pdb|3FSE|A Chain A, Crystal Structure Of A Two-Domain Protein Containing Dj-1THIJPFPI- Like And Ferritin-Like Domains (Ava_4496) From Anabaena Variabilis Atcc 29413 At 1.90 A Resolution Length = 365 | Back alignment and structure |
| >pdb|4E08|A Chain A, Crystal Structure Of Drosophila Melanogaster Dj-1beta Length = 190 | Back alignment and structure |
| >pdb|3NOR|A Chain A, Crystal Structure Of T102s Isocyanide Hydratase From Pseudomonas Fluorescens Length = 231 | Back alignment and structure |
| >pdb|3NOV|A Chain A, Crystal Structure Of D17e Isocyanide Hydratase From Pseudomonas Fluorescens Length = 231 | Back alignment and structure |
| >pdb|3NOO|A Chain A, Crystal Structure Of C101a Isocyanide Hydratase From Pseudomonas Fluorescens Length = 231 | Back alignment and structure |
| >pdb|3NOQ|A Chain A, Crystal Structure Of C101s Isocyanide Hydratase From Pseudomonas Fluorescens Length = 231 | Back alignment and structure |
| >pdb|3NON|A Chain A, Crystal Structure Of Isocyanide Hydratase From Pseudomonas Fluorescens Length = 231 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 220 | |||
| 3uk7_A | 396 | Class I glutamine amidotransferase-like domain-CO | 2e-87 | |
| 3uk7_A | 396 | Class I glutamine amidotransferase-like domain-CO | 5e-81 | |
| 3l18_A | 168 | Intracellular protease I; gatase1_PFPI_LIKE, hydro | 2e-72 | |
| 2vrn_A | 190 | Protease I, DR1199; cysteine sulfenic acid, DJ-1/T | 5e-72 | |
| 3fse_A | 365 | Two-domain protein containing DJ-1/THIJ/PFPI-like | 2e-71 | |
| 1oi4_A | 193 | Hypothetical protein YHBO; PFPI/THIJ family, compl | 7e-70 | |
| 3cne_A | 175 | Putative protease I; structural genomics, PSI-2, M | 1e-44 | |
| 4e08_A | 190 | DJ-1 beta; flavodoxin-like fold, stress response, | 2e-36 | |
| 3ot1_A | 208 | 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate | 5e-34 | |
| 3efe_A | 212 | THIJ/PFPI family protein; structural GEN csgid, ce | 2e-33 | |
| 3l3b_A | 242 | ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, | 9e-33 | |
| 2rk3_A | 197 | Protein DJ-1; parkinson'S disease, THIJ, PFPI, cha | 1e-32 | |
| 2fex_A | 188 | Conserved hypothetical protein; structural genomic | 2e-30 | |
| 4gdh_A | 194 | DJ-1, uncharacterized protein C22E12.03C; unknown | 2e-30 | |
| 2ab0_A | 205 | YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase | 3e-30 | |
| 3f5d_A | 206 | Protein YDEA; unknow protein, PSI-II, nysgrc, stru | 7e-29 | |
| 1vhq_A | 232 | Enhancing lycopene biosynthesis protein 2; structu | 3e-26 | |
| 1n57_A | 291 | Chaperone HSP31, protein YEDU; alpha-beta sandwich | 3e-24 | |
| 1u9c_A | 224 | APC35852; structural genomics, protein structure i | 3e-23 | |
| 3bhn_A | 236 | THIJ/PFPI domain protein; structural genomics, joi | 3e-21 | |
| 1rw7_A | 243 | YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI supe | 3e-19 | |
| 3n7t_A | 247 | Macrophage binding protein; seattle structural gen | 4e-18 | |
| 3kkl_A | 244 | Probable chaperone protein HSP33; peptidase, heat | 4e-18 | |
| 3mgk_A | 211 | Intracellular protease/amidase related enzyme (THI | 5e-14 | |
| 3noq_A | 231 | THIJ/PFPI family protein; DJ-1 superfamily, isocya | 3e-13 | |
| 3ewn_A | 253 | THIJ/PFPI family protein; monomer, PSI nysgrc, str | 1e-12 | |
| 3gra_A | 202 | Transcriptional regulator, ARAC family; transcript | 1e-08 | |
| 3er6_A | 209 | Putative transcriptional regulator protein; struct | 1e-08 |
| >3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Length = 396 | Back alignment and structure |
|---|
Score = 262 bits (671), Expect = 2e-87
Identities = 150/210 (71%), Positives = 172/210 (81%), Gaps = 2/210 (0%)
Query: 1 MANSKGGKRSVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTG 60
+ + VL+LCGDYMEDYE MVPFQAL AFG++V CPGKK+GD CPTAVH G
Sbjct: 6 RGSMANSRT-VLILCGDYMEDYEVMVPFQALQAFGITVHTVCPGKKAGDSCPTAVHDFCG 64
Query: 61 HQQTYSETRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKT 120
HQ TY E+RGHNF LNATFDE+D +KYDGLVIPGGRAPEYLA+ SV++LV++FS SGK
Sbjct: 65 HQ-TYFESRGHNFTLNATFDEVDLSKYDGLVIPGGRAPEYLALTASVVELVKEFSRSGKP 123
Query: 121 IASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGATY 180
IASICHGQLILAAAD V GRKCTAY V P L+AAGA W+EP T CVVDG++IT ATY
Sbjct: 124 IASICHGQLILAAADTVNGRKCTAYATVGPSLVAAGAKWVEPITPDVCVVDGSLITAATY 183
Query: 181 EGHPEFIRLFLKALGGTITGSDKRILFLCG 210
EGHPEFI+LF+KALGG ITG++KRILFLCG
Sbjct: 184 EGHPEFIQLFVKALGGKITGANKRILFLCG 213
|
| >3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Length = 396 | Back alignment and structure |
|---|
| >3l18_A Intracellular protease I; gatase1_PFPI_LIKE, hydrolase; 1.78A {Thermococcus onnurineus} PDB: 1g2i_A Length = 168 | Back alignment and structure |
|---|
| >2vrn_A Protease I, DR1199; cysteine sulfenic acid, DJ-1/THIJ/PFPI superfamily, protease hydrolase, stress response; 2.15A {Deinococcus radiodurans} Length = 190 | Back alignment and structure |
|---|
| >3fse_A Two-domain protein containing DJ-1/THIJ/PFPI-like ferritin-like domains; structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413} Length = 365 | Back alignment and structure |
|---|
| >1oi4_A Hypothetical protein YHBO; PFPI/THIJ family, complete proteome, PFPI, THIJ, bacterial targets at IGS-CNRS, france, BIGS, structural genomics; 2.03A {Escherichia coli} SCOP: c.23.16.2 Length = 193 | Back alignment and structure |
|---|
| >3cne_A Putative protease I; structural genomics, PSI-2, MCSG, protein struct initiative, midwest center for structural genomics; HET: FMN; 1.99A {Bacteroides thetaiotaomicron vpi-5482} Length = 175 | Back alignment and structure |
|---|
| >4e08_A DJ-1 beta; flavodoxin-like fold, stress response, motor protein; 2.00A {Drosophila melanogaster} Length = 190 | Back alignment and structure |
|---|
| >3ot1_A 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme; csgid, structural genomics; HET: MSE CSX; 1.16A {Vibrio cholerae o1 biovar el tor} Length = 208 | Back alignment and structure |
|---|
| >3efe_A THIJ/PFPI family protein; structural GEN csgid, center for structural genomics of infectious disease chaperone; 2.30A {Bacillus anthracis} Length = 212 | Back alignment and structure |
|---|
| >3l3b_A ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography, isopr biosynthesis; 1.90A {Ehrlichia chaffeensis} Length = 242 | Back alignment and structure |
|---|
| >2rk3_A Protein DJ-1; parkinson'S disease, THIJ, PFPI, chaperone, cytoplasm, disease mutation, nucleus, oncogene, oxidation, parkinson disease; 1.05A {Homo sapiens} PDB: 1pdv_A 1pdw_A 3cy6_A 1pe0_A 3cza_A 3cyf_A 2rk4_A 3cz9_A* 3ezg_A 3f71_A 3sf8_A 1p5f_A 1ps4_A 1q2u_A 1soa_A 1ucf_A 2or3_A 3bwe_A 3b38_A 3b36_A ... Length = 197 | Back alignment and structure |
|---|
| >2fex_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, MIDW center for structural genomics, MCSG; 1.70A {Agrobacterium tumefaciens} SCOP: c.23.16.2 Length = 188 | Back alignment and structure |
|---|
| >4gdh_A DJ-1, uncharacterized protein C22E12.03C; unknown function, cysteine oxidation; 1.05A {Schizosaccharomyces pombe} PDB: 4ge3_A 4ge0_A Length = 194 | Back alignment and structure |
|---|
| >2ab0_A YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase fold, unknown function; 1.10A {Escherichia coli} SCOP: c.23.16.2 Length = 205 | Back alignment and structure |
|---|
| >3f5d_A Protein YDEA; unknow protein, PSI-II, nysgrc, structural genomics, protein structure initiative; 2.06A {Bacillus subtilis} Length = 206 | Back alignment and structure |
|---|
| >1vhq_A Enhancing lycopene biosynthesis protein 2; structural genomics, unknown function; 1.65A {Escherichia coli} SCOP: c.23.16.2 PDB: 1oy1_A Length = 232 | Back alignment and structure |
|---|
| >1n57_A Chaperone HSP31, protein YEDU; alpha-beta sandwich; 1.60A {Escherichia coli} SCOP: c.23.16.2 PDB: 1pv2_A 1izy_A 1ons_A 1izz_A Length = 291 | Back alignment and structure |
|---|
| >1u9c_A APC35852; structural genomics, protein structure initiative, MCSG, PAR disease, chaperone, cysteine protease, PSI; 1.35A {Geobacillus stearothermophilus} SCOP: c.23.16.2 Length = 224 | Back alignment and structure |
|---|
| >3bhn_A THIJ/PFPI domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.76A {Shewanella loihica pv-4} Length = 236 | Back alignment and structure |
|---|
| >1rw7_A YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI superfamily, unknown function; 1.80A {Saccharomyces cerevisiae} SCOP: c.23.16.2 PDB: 1qvv_A* 1qvz_A 1qvw_A Length = 243 | Back alignment and structure |
|---|
| >3n7t_A Macrophage binding protein; seattle structural genomics center for infectious disease, S macrophage, pathogenic fungus, coccidioidomycosis; 2.10A {Coccidioides immitis} Length = 247 | Back alignment and structure |
|---|
| >3kkl_A Probable chaperone protein HSP33; peptidase, heat shock protein, hydrolase, protease, stress response; 2.03A {Saccharomyces cerevisiae} PDB: 3mii_A* Length = 244 | Back alignment and structure |
|---|
| >3mgk_A Intracellular protease/amidase related enzyme (THIJ family); amidotranferase-like, structural genomics, PSI; 2.00A {Clostridium acetobutylicum} Length = 211 | Back alignment and structure |
|---|
| >3noq_A THIJ/PFPI family protein; DJ-1 superfamily, isocyanide hydratase, isonitrIle hydratase; HET: NHE; 1.00A {Pseudomonas fluorescens} PDB: 3noo_A 3non_A 3nor_A* 3nov_A Length = 231 | Back alignment and structure |
|---|
| >3ewn_A THIJ/PFPI family protein; monomer, PSI nysgrc, structural genomics, protein structure initiative; 1.65A {Pseudomonas syringae PV} Length = 253 | Back alignment and structure |
|---|
| >3gra_A Transcriptional regulator, ARAC family; transcription regulator, PSI-II, structural genomics structure initiative; 2.30A {Pseudomonas putida} Length = 202 | Back alignment and structure |
|---|
| >3er6_A Putative transcriptional regulator protein; structural genomics, unknown function, DNA-binding, transcription regulation, PSI-2; 1.90A {Vibrio parahaemolyticus} Length = 209 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 220 | |||
| 4hcj_A | 177 | THIJ/PFPI domain protein; structural genomics, PSI | 100.0 | |
| 3efe_A | 212 | THIJ/PFPI family protein; structural GEN csgid, ce | 100.0 | |
| 3er6_A | 209 | Putative transcriptional regulator protein; struct | 100.0 | |
| 3ewn_A | 253 | THIJ/PFPI family protein; monomer, PSI nysgrc, str | 100.0 | |
| 3l18_A | 168 | Intracellular protease I; gatase1_PFPI_LIKE, hydro | 100.0 | |
| 3noq_A | 231 | THIJ/PFPI family protein; DJ-1 superfamily, isocya | 100.0 | |
| 3gra_A | 202 | Transcriptional regulator, ARAC family; transcript | 100.0 | |
| 4e08_A | 190 | DJ-1 beta; flavodoxin-like fold, stress response, | 100.0 | |
| 3mgk_A | 211 | Intracellular protease/amidase related enzyme (THI | 100.0 | |
| 3ot1_A | 208 | 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate | 100.0 | |
| 2vrn_A | 190 | Protease I, DR1199; cysteine sulfenic acid, DJ-1/T | 100.0 | |
| 4gdh_A | 194 | DJ-1, uncharacterized protein C22E12.03C; unknown | 100.0 | |
| 1oi4_A | 193 | Hypothetical protein YHBO; PFPI/THIJ family, compl | 100.0 | |
| 2rk3_A | 197 | Protein DJ-1; parkinson'S disease, THIJ, PFPI, cha | 100.0 | |
| 3fse_A | 365 | Two-domain protein containing DJ-1/THIJ/PFPI-like | 100.0 | |
| 3f5d_A | 206 | Protein YDEA; unknow protein, PSI-II, nysgrc, stru | 100.0 | |
| 3uk7_A | 396 | Class I glutamine amidotransferase-like domain-CO | 100.0 | |
| 2ab0_A | 205 | YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase | 100.0 | |
| 2fex_A | 188 | Conserved hypothetical protein; structural genomic | 100.0 | |
| 3bhn_A | 236 | THIJ/PFPI domain protein; structural genomics, joi | 100.0 | |
| 1u9c_A | 224 | APC35852; structural genomics, protein structure i | 100.0 | |
| 3uk7_A | 396 | Class I glutamine amidotransferase-like domain-CO | 100.0 | |
| 3cne_A | 175 | Putative protease I; structural genomics, PSI-2, M | 100.0 | |
| 3kkl_A | 244 | Probable chaperone protein HSP33; peptidase, heat | 100.0 | |
| 1rw7_A | 243 | YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI supe | 100.0 | |
| 3n7t_A | 247 | Macrophage binding protein; seattle structural gen | 100.0 | |
| 1n57_A | 291 | Chaperone HSP31, protein YEDU; alpha-beta sandwich | 100.0 | |
| 1vhq_A | 232 | Enhancing lycopene biosynthesis protein 2; structu | 100.0 | |
| 3l3b_A | 242 | ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, | 99.97 | |
| 1sy7_A | 715 | Catalase 1; heme oxidation, singlet oxygen, oxidor | 99.91 | |
| 3ttv_A | 753 | Catalase HPII; heme orientation, oxidoreductase; H | 99.83 | |
| 2iuf_A | 688 | Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen | 99.71 | |
| 3ej6_A | 688 | Catalase-3; heme, hydrogen iron, metal-binding, ox | 99.66 | |
| 3d54_D | 213 | Phosphoribosylformylglycinamidine synthase 1; alph | 99.25 | |
| 3l7n_A | 236 | Putative uncharacterized protein; glutamine amidot | 98.57 | |
| 3m3p_A | 250 | Glutamine amido transferase; structural genomics, | 98.56 | |
| 1q7r_A | 219 | Predicted amidotransferase; structural genomics, Y | 98.56 | |
| 2nv0_A | 196 | Glutamine amidotransferase subunit PDXT; 3-layer(A | 98.54 | |
| 1ka9_H | 200 | Imidazole glycerol phosphtate synthase; riken stru | 98.48 | |
| 3ugj_A | 1303 | Phosphoribosylformylglycinamidine synthase; amidot | 98.43 | |
| 2iss_D | 208 | Glutamine amidotransferase subunit PDXT; (beta/alp | 98.42 | |
| 2ywd_A | 191 | Glutamine amidotransferase subunit PDXT; pyridoxin | 98.38 | |
| 1wl8_A | 189 | GMP synthase [glutamine-hydrolyzing] subunit A; tr | 98.29 | |
| 2abw_A | 227 | PDX2 protein, glutaminase; PLP-synthase, vitamin B | 98.27 | |
| 2ywj_A | 186 | Glutamine amidotransferase subunit PDXT; uncharact | 98.07 | |
| 1gpw_B | 201 | Amidotransferase HISH; lyase/transferase, complex | 98.06 | |
| 1qdl_B | 195 | Protein (anthranilate synthase (TRPG-SUBUNIT)); tr | 98.01 | |
| 4gud_A | 211 | Imidazole glycerol phosphate synthase subunit His; | 97.99 | |
| 1o1y_A | 239 | Conserved hypothetical protein TM1158; flavodoxin- | 97.93 | |
| 1a9x_B | 379 | Carbamoyl phosphate synthetase (small chain); amid | 97.9 | |
| 3fij_A | 254 | LIN1909 protein; 11172J, uncharacterized protein, | 97.75 | |
| 2vpi_A | 218 | GMP synthase; guanine monophosphate synthetase, ph | 97.72 | |
| 2a9v_A | 212 | GMP synthase; structural genomics, joint center fo | 97.63 | |
| 1jvn_A | 555 | Glutamine, bifunctional histidine biosynthesis pro | 97.5 | |
| 3tqi_A | 527 | GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 | 97.43 | |
| 3l4e_A | 206 | Uncharacterized peptidase LMO0363; hypothetical pr | 97.43 | |
| 1l9x_A | 315 | Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO | 97.4 | |
| 2v4u_A | 289 | CTP synthase 2; pyrimidine biosynthesis, glutamine | 97.39 | |
| 1fy2_A | 229 | Aspartyl dipeptidase; serine protease, catalytic t | 97.34 | |
| 3r75_A | 645 | Anthranilate/para-aminobenzoate synthases compone; | 97.1 | |
| 2h2w_A | 312 | Homoserine O-succinyltransferase; TM0881, (EC 2.3. | 97.04 | |
| 2w7t_A | 273 | CTP synthetase, putative cytidine triphosphate syn | 97.0 | |
| 3uow_A | 556 | GMP synthetase; structural genomics consortium, SG | 96.99 | |
| 1gpm_A | 525 | GMP synthetase, XMP aminase; class I glutamine ami | 96.74 | |
| 2vdj_A | 301 | Homoserine O-succinyltransferase; methionine biosy | 96.69 | |
| 3nva_A | 535 | CTP synthase; rossman fold, nucleotide binding, LI | 96.45 | |
| 1i1q_B | 192 | Anthranilate synthase component II; tryptophan bio | 96.24 | |
| 1s1m_A | 545 | CTP synthase; CTP synthetase, UTP:ammonia ligase ( | 96.1 | |
| 1vco_A | 550 | CTP synthetase; tetramer, riken structural genomic | 96.09 | |
| 2ywb_A | 503 | GMP synthase [glutamine-hydrolyzing]; GMP syntheta | 95.33 | |
| 2vxo_A | 697 | GMP synthase [glutamine-hydrolyzing]; proto-oncoge | 95.2 | |
| 3en0_A | 291 | Cyanophycinase; serine protease, beta peptide spec | 93.92 | |
| 3rht_A | 259 | (gatase1)-like protein; structural genomics, PSI-b | 89.61 |
| >4hcj_A THIJ/PFPI domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta-alpha sandwich; HET: MSE; 1.12A {Brachyspira murdochii} | Back alignment and structure |
|---|
Probab=100.00 E-value=5.2e-43 Score=269.18 Aligned_cols=168 Identities=20% Similarity=0.260 Sum_probs=159.1
Q ss_pred CCeEEEEecCCCCchhhHHHHHHHHhCCCeEEEEcCCCCCCCCCCcccccCCCcccccccccCcccccCcCcCCCCCCCc
Q 027708 8 KRSVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQQTYSETRGHNFALNATFDEIDPTKY 87 (220)
Q Consensus 8 ~~kI~il~~~g~~~~e~~~~~~~l~~ag~~v~~~s~~~~~~~~~~~~~~~~~~~~~~v~~~~g~~i~~~~~l~~~~~~~~ 87 (220)
+++|.|++.+||++.|+..|+++|+++|++|+++|++++ +++++.|..+.+|..++++++.+|
T Consensus 8 ~~~v~il~~~gFe~~E~~~p~~~l~~ag~~V~~~s~~~~-----------------~v~~~~G~~v~~d~~l~~v~~~~y 70 (177)
T 4hcj_A 8 NNILYVMSGQNFQDEEYFESKKIFESAGYKTKVSSTFIG-----------------TAQGKLGGMTNIDLLFSEVDAVEF 70 (177)
T ss_dssp CEEEEECCSEEECHHHHHHHHHHHHHTTCEEEEEESSSE-----------------EEEETTSCEEEECEEGGGCCGGGC
T ss_pred CCEEEEECCCCccHHHHHHHHHHHHHCCCEEEEEECCCC-----------------eEeeCCCCEEecCccHHHCCHhHC
Confidence 366888889999999999999999999999999999876 899999999999999999988899
Q ss_pred cEEEEcCCCCcccccCChHHHHHHHHHHhCCCeEEEEehHHHHHHhCcccCCceEecCCCCHHHHHHCCCeEecCCCCce
Q 027708 88 DGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAA 167 (220)
Q Consensus 88 D~liipGG~~~~~~~~~~~l~~~l~~~~~~g~~i~aic~G~~~La~aglL~g~~~T~~~~~~~~l~~~g~~~~~~~~~~~ 167 (220)
|+|+||||+++..+..++.+.+||+++++++|+|++||+|+++|+++|||+||++|+||..++.+++.|+.|++++
T Consensus 71 D~liiPGG~g~~~l~~~~~~~~~l~~~~~~~k~iaaIC~g~~~La~aGlL~gr~~T~~~~~~~~l~~~ga~~~~~~---- 146 (177)
T 4hcj_A 71 DAVVFVGGIGCITLWDDWRTQGLAKLFLDNQKIVAGIGSGVVIMANAKILEEINVTCLSADESHVRHGNANIMSEN---- 146 (177)
T ss_dssp SEEEECCSGGGGGGTTCHHHHHHHHHHHHTTCEEEEETTHHHHHHHTTCCTTCEECCCGGGHHHHHHTTCEECSSS----
T ss_pred CEEEECCCccHHHHhhCHHHHHHHHHHHHhCCEEEEecccHHHHHHCCCCCCCEEEEeCCHHHHHHhCCCEEecCC----
Confidence 9999999998877889999999999999999999999999999999999999999999999999999999998876
Q ss_pred EEEcCCEEeCCCCCCHHHHHHHHHHHHcc
Q 027708 168 CVVDGNIITGATYEGHPEFIRLFLKALGG 196 (220)
Q Consensus 168 ~v~dg~iiTs~g~~s~~~~~~~li~~l~~ 196 (220)
+|+|||+|||+|+.++.+|++++|+.|.+
T Consensus 147 vV~Dg~liTs~g~~~~~~~a~~lve~L~s 175 (177)
T 4hcj_A 147 VVVSGNIVTANGPTSSKDFANAVVGVLNS 175 (177)
T ss_dssp EEEETTEEEECSGGGHHHHHHHHHHHHHT
T ss_pred EEEECCEEECCCHHHHHHHHHHHHHHHhc
Confidence 89999999999999999999999999865
|
| >3efe_A THIJ/PFPI family protein; structural GEN csgid, center for structural genomics of infectious disease chaperone; 2.30A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3er6_A Putative transcriptional regulator protein; structural genomics, unknown function, DNA-binding, transcription regulation, PSI-2; 1.90A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3ewn_A THIJ/PFPI family protein; monomer, PSI nysgrc, structural genomics, protein structure initiative; 1.65A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3l18_A Intracellular protease I; gatase1_PFPI_LIKE, hydrolase; 1.78A {Thermococcus onnurineus} SCOP: c.23.16.2 PDB: 1g2i_A | Back alignment and structure |
|---|
| >3noq_A THIJ/PFPI family protein; DJ-1 superfamily, isocyanide hydratase, isonitrIle hydratase; HET: NHE; 1.00A {Pseudomonas fluorescens} PDB: 3noo_A 3non_A 3nor_A* 3nov_A | Back alignment and structure |
|---|
| >3gra_A Transcriptional regulator, ARAC family; transcription regulator, PSI-II, structural genomics structure initiative; 2.30A {Pseudomonas putida} | Back alignment and structure |
|---|
| >4e08_A DJ-1 beta; flavodoxin-like fold, stress response, motor protein; 2.00A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3mgk_A Intracellular protease/amidase related enzyme (THIJ family); amidotranferase-like, structural genomics, PSI; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3ot1_A 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme; csgid, structural genomics; HET: MSE CSX; 1.16A {Vibrio cholerae o1 biovar el tor} SCOP: c.23.16.0 | Back alignment and structure |
|---|
| >2vrn_A Protease I, DR1199; cysteine sulfenic acid, DJ-1/THIJ/PFPI superfamily, protease hydrolase, stress response; 2.15A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >4gdh_A DJ-1, uncharacterized protein C22E12.03C; unknown function, cysteine oxidation; 1.05A {Schizosaccharomyces pombe} PDB: 4ge3_A 4ge0_A | Back alignment and structure |
|---|
| >1oi4_A Hypothetical protein YHBO; PFPI/THIJ family, complete proteome, PFPI, THIJ, bacterial targets at IGS-CNRS, france, BIGS, structural genomics; 2.03A {Escherichia coli} SCOP: c.23.16.2 | Back alignment and structure |
|---|
| >2rk3_A Protein DJ-1; parkinson'S disease, THIJ, PFPI, chaperone, cytoplasm, disease mutation, nucleus, oncogene, oxidation, parkinson disease; 1.05A {Homo sapiens} PDB: 1pdv_A 1pdw_A 3cy6_A 1pe0_A 3cza_A 3cyf_A 2rk4_A 3cz9_A* 3ezg_A 3f71_A 3sf8_A 1p5f_A 1ps4_A 1q2u_A 1soa_A 1ucf_A 2or3_A 3bwe_A 3b38_A 3b36_A ... | Back alignment and structure |
|---|
| >3fse_A Two-domain protein containing DJ-1/THIJ/PFPI-like ferritin-like domains; structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3f5d_A Protein YDEA; unknow protein, PSI-II, nysgrc, structural genomics, protein structure initiative; 2.06A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ab0_A YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase fold, unknown function; 1.10A {Escherichia coli} SCOP: c.23.16.2 | Back alignment and structure |
|---|
| >2fex_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, MIDW center for structural genomics, MCSG; 1.70A {Agrobacterium tumefaciens} SCOP: c.23.16.2 | Back alignment and structure |
|---|
| >3bhn_A THIJ/PFPI domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.76A {Shewanella loihica pv-4} | Back alignment and structure |
|---|
| >1u9c_A APC35852; structural genomics, protein structure initiative, MCSG, PAR disease, chaperone, cysteine protease, PSI; 1.35A {Geobacillus stearothermophilus} SCOP: c.23.16.2 | Back alignment and structure |
|---|
| >3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3cne_A Putative protease I; structural genomics, PSI-2, MCSG, protein struct initiative, midwest center for structural genomics; HET: FMN; 1.99A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3kkl_A Probable chaperone protein HSP33; peptidase, heat shock protein, hydrolase, protease, stress response; 2.03A {Saccharomyces cerevisiae} PDB: 3mii_A* | Back alignment and structure |
|---|
| >1rw7_A YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI superfamily, unknown function; 1.80A {Saccharomyces cerevisiae} SCOP: c.23.16.2 PDB: 1qvv_A* 1qvz_A 1qvw_A | Back alignment and structure |
|---|
| >3n7t_A Macrophage binding protein; seattle structural genomics center for infectious disease, S macrophage, pathogenic fungus, coccidioidomycosis; 2.10A {Coccidioides immitis} SCOP: c.23.16.0 | Back alignment and structure |
|---|
| >1n57_A Chaperone HSP31, protein YEDU; alpha-beta sandwich; 1.60A {Escherichia coli} SCOP: c.23.16.2 PDB: 1pv2_A 1izy_A 1ons_A 1izz_A | Back alignment and structure |
|---|
| >1vhq_A Enhancing lycopene biosynthesis protein 2; structural genomics, unknown function; 1.65A {Escherichia coli} SCOP: c.23.16.2 PDB: 1oy1_A | Back alignment and structure |
|---|
| >3l3b_A ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography, isopr biosynthesis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 | Back alignment and structure |
|---|
| >3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... | Back alignment and structure |
|---|
| >2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* | Back alignment and structure |
|---|
| >3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} | Back alignment and structure |
|---|
| >3d54_D Phosphoribosylformylglycinamidine synthase 1; alpha-beta structure, ATP-binding, cytoplasm, ligase, nucleotide-binding, purine biosynthesis; HET: CYG ADP; 3.50A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* | Back alignment and structure |
|---|
| >1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 | Back alignment and structure |
|---|
| >2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* | Back alignment and structure |
|---|
| >1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 | Back alignment and structure |
|---|
| >3ugj_A Phosphoribosylformylglycinamidine synthase; amidotransferase, glutaminase, thioester intermediate, ligas; HET: ADP; 1.78A {Salmonella enterica subsp} PDB: 1t3t_A* 3ujn_A* 3umm_A* | Back alignment and structure |
|---|
| >2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A | Back alignment and structure |
|---|
| >2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G | Back alignment and structure |
|---|
| >2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B | Back alignment and structure |
|---|
| >1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 | Back alignment and structure |
|---|
| >4gud_A Imidazole glycerol phosphate synthase subunit His; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE 1PE; 1.91A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 | Back alignment and structure |
|---|
| >1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B* | Back alignment and structure |
|---|
| >3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} | Back alignment and structure |
|---|
| >2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 | Back alignment and structure |
|---|
| >1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A | Back alignment and structure |
|---|
| >3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3l4e_A Uncharacterized peptidase LMO0363; hypothetical protein LMO0363, csgid, similar to peptidase E, hydrolase, protease, serine protease; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 | Back alignment and structure |
|---|
| >2v4u_A CTP synthase 2; pyrimidine biosynthesis, glutamine amidotransferase, glutaminase domain, 5-OXO-L-norleucine, DON, ligase, phosphoprotein; HET: CYD; 2.3A {Homo sapiens} PDB: 2vkt_A | Back alignment and structure |
|---|
| >1fy2_A Aspartyl dipeptidase; serine protease, catalytic triad, strand-helix MO hydrolase; 1.20A {Salmonella typhimurium} SCOP: c.23.16.4 PDB: 1fye_A | Back alignment and structure |
|---|
| >3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* | Back alignment and structure |
|---|
| >2h2w_A Homoserine O-succinyltransferase; TM0881, (EC 2.3.1.46), HOM O-transsuccinylase, HTS, (TM0881), structural genomics; 2.52A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2w7t_A CTP synthetase, putative cytidine triphosphate synthase; glutaminase domain, trypsanosoma brucei, ligase, acivicin; HET: 5CS; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 | Back alignment and structure |
|---|
| >2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A | Back alignment and structure |
|---|
| >3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* | Back alignment and structure |
|---|
| >1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* | Back alignment and structure |
|---|
| >1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A | Back alignment and structure |
|---|
| >2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* | Back alignment and structure |
|---|
| >2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3en0_A Cyanophycinase; serine protease, beta peptide specific, hydrolase, protease; 1.50A {Synechocystis SP} | Back alignment and structure |
|---|
| >3rht_A (gatase1)-like protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.83A {Planctomyces limnophilus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 220 | ||||
| d1vhqa_ | 217 | c.23.16.2 (A:) Putative sigma cross-reacting prote | 2e-32 | |
| d1oi4a1 | 170 | c.23.16.2 (A:23-192) Hypothetical protein YhbO {Es | 1e-31 | |
| d1g2ia_ | 166 | c.23.16.2 (A:) Intracellular protease {Archaeon Py | 8e-30 | |
| d1qvwa_ | 236 | c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Bake | 8e-26 | |
| d1n57a_ | 279 | c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia col | 6e-23 | |
| d1u9ca_ | 221 | c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothe | 6e-22 | |
| d2fexa1 | 188 | c.23.16.2 (A:1-188) Hypothetical protein Atu0886 { | 2e-19 | |
| d1sy7a1 | 184 | c.23.16.3 (A:553-736) Catalase, C-terminal domain | 3e-18 | |
| d1p80a1 | 156 | c.23.16.3 (A:598-753) Catalase, C-terminal domain | 8e-18 | |
| d2ab0a1 | 195 | c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherich | 6e-17 | |
| d1p5fa_ | 186 | c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: | 2e-16 |
| >d1vhqa_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]} Length = 217 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: Class I glutamine amidotransferase-like family: DJ-1/PfpI domain: Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) species: Escherichia coli [TaxId: 562]
Score = 114 bits (287), Expect = 2e-32
Identities = 34/193 (17%), Positives = 59/193 (30%), Gaps = 20/193 (10%)
Query: 8 KRSVLLLCG----DYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQQ 63
K+ ++L G D E +EA++ A+ G P K+ DV ++ +
Sbjct: 2 KKIGVILSGCGVYDGSEIHEAVLTLLAISRSGAQAVCFAPDKQQVDVINHLTGEAMT-ET 60
Query: 64 TYSETRGHNFALNA--TFDEIDPTKYDGLVIPGGRAP-----------EYLAMNDSVIDL 110
+ D + D L++PGG ++ + L
Sbjct: 61 RNVLIEAARITRGEIRPLAQADAAELDALIVPGGFGAAKNLSNFASLGSECTVDRELKAL 120
Query: 111 VRKFSNSGKTIASICHGQLILAAADVVKGR-KCTAYPPVKPVLIAAGASWIEPETMAACV 169
+ +GK + +C +L R VL GA + V
Sbjct: 121 AQAMHQAGKPLGFMCIAPAMLPKIFDFPLRLTIGTDIDTAEVLEEMGAEHVPCPVDDIVV 180
Query: 170 V-DGNIITGATYE 181
D I+T Y
Sbjct: 181 DEDNKIVTTPAYM 193
|
| >d1oi4a1 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]} Length = 170 | Back information, alignment and structure |
|---|
| >d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 166 | Back information, alignment and structure |
|---|
| >d1qvwa_ c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 236 | Back information, alignment and structure |
|---|
| >d1n57a_ c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} Length = 279 | Back information, alignment and structure |
|---|
| >d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]} Length = 221 | Back information, alignment and structure |
|---|
| >d2fexa1 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]} Length = 188 | Back information, alignment and structure |
|---|
| >d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Neurospora crassa [TaxId: 5141]} Length = 184 | Back information, alignment and structure |
|---|
| >d1p80a1 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]} Length = 156 | Back information, alignment and structure |
|---|
| >d2ab0a1 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]} Length = 195 | Back information, alignment and structure |
|---|
| >d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 186 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 220 | |||
| d1g2ia_ | 166 | Intracellular protease {Archaeon Pyrococcus horiko | 100.0 | |
| d1p5fa_ | 186 | DJ-1 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1oi4a1 | 170 | Hypothetical protein YhbO {Escherichia coli [TaxId | 100.0 | |
| d2ab0a1 | 195 | Protein ThiJ (YajL) {Escherichia coli [TaxId: 562] | 100.0 | |
| d2fexa1 | 188 | Hypothetical protein Atu0886 {Agrobacterium tumefa | 100.0 | |
| d1sy7a1 | 184 | Catalase, C-terminal domain {Neurospora crassa [Ta | 100.0 | |
| d1u9ca_ | 221 | GK2698 ortholog {Bacillus stearothermophilus [TaxI | 100.0 | |
| d1qvwa_ | 236 | Hypothetical protein Ydr533Cp {Baker's yeast (Sacc | 99.97 | |
| d1n57a_ | 279 | HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} | 99.97 | |
| d1vhqa_ | 217 | Putative sigma cross-reacting protein 27A (SCRP-27 | 99.94 | |
| d1p80a1 | 156 | Catalase, C-terminal domain {Escherichia coli, HPI | 99.91 | |
| d1q7ra_ | 202 | Hypothetical protein YaaE {Bacillus stearothermoph | 98.8 | |
| d2nv0a1 | 195 | Hypothetical protein YaaE {Bacillus subtilis [TaxI | 98.74 | |
| d1t3ta2 | 262 | FGAM synthase PurL, amidotransferase domain {Salmo | 98.62 | |
| d1o1ya_ | 230 | Hypothetical protein TM1158 {Thermotoga maritima [ | 98.45 | |
| d1jvna2 | 232 | GAT subunit, HisH, (or domain) of imidazoleglycero | 98.0 | |
| d2abwa1 | 218 | Pyridoxine biosynthesis protein 2, Pdx2 {Malaria p | 97.86 | |
| d1k9vf_ | 200 | GAT subunit, HisH, (or domain) of imidazoleglycero | 97.84 | |
| d2a9va1 | 196 | GMP synthase subunit A, GuaAA {Archaeon Thermoplas | 97.81 | |
| d1qdlb_ | 195 | Anthranilate synthase GAT subunit, TrpG {Archaeon | 97.47 | |
| d1wl8a1 | 188 | GMP synthase subunit A, GuaAA {Archaeon Pyrococcus | 97.47 | |
| d1a9xb2 | 228 | Carbamoyl phosphate synthetase, small subunit C-te | 97.27 | |
| d1i7qb_ | 192 | Anthranilate synthase GAT subunit, TrpG {Serratia | 97.18 | |
| d2ghra1 | 281 | Homoserine O-succinyltransferase HTS (MetA) {Bacil | 97.09 | |
| d1ka9h_ | 195 | GAT subunit, HisH, (or domain) of imidazoleglycero | 97.07 | |
| d1gpma2 | 205 | GMP synthetase {Escherichia coli [TaxId: 562]} | 97.0 | |
| d1s1ma1 | 258 | CTP synthase PyrG, C-terminal domain {Escherichia | 95.88 | |
| d1vcoa1 | 250 | CTP synthase PyrG, C-terminal domain {Thermus ther | 94.87 | |
| d1l9xa_ | 288 | gamma-glutamyl hydrolase {Human (Homo sapiens) [Ta | 92.87 | |
| d1fyea_ | 229 | Aspartyl dipeptidase PepE {Salmonella typhimurium | 88.09 | |
| d1iowa1 | 96 | D-Ala-D-Ala ligase, N-domain {Escherichia coli, ge | 87.93 |
| >d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: Class I glutamine amidotransferase-like family: DJ-1/PfpI domain: Intracellular protease species: Archaeon Pyrococcus horikoshii [TaxId: 53953]
Probab=100.00 E-value=4.1e-42 Score=260.45 Aligned_cols=165 Identities=38% Similarity=0.680 Sum_probs=156.1
Q ss_pred CeEEEEecCCCCchhhHHHHHHHHhCCCeEEEEcCCCCCCCCCCcccccCCCcccccccccCcccccCcCcCCCCCCCcc
Q 027708 9 RSVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQQTYSETRGHNFALNATFDEIDPTKYD 88 (220)
Q Consensus 9 ~kI~il~~~g~~~~e~~~~~~~l~~ag~~v~~~s~~~~~~~~~~~~~~~~~~~~~~v~~~~g~~i~~~~~l~~~~~~~~D 88 (220)
+||+|+++|||++.|+..|+++|+++|++|+++|++++ +|+++.|+.+.++.+++++++.+||
T Consensus 1 mKv~il~~dgf~~~E~~~p~~~l~~ag~~v~~vs~~~~-----------------~V~~~~g~~i~~d~~~~~~~~~~~d 63 (166)
T d1g2ia_ 1 MKVLFLTANEFEDVELIYPYHRLKEEGHEVYIASFERG-----------------TITGKHGYSVKVDLTFDKVNPEEFD 63 (166)
T ss_dssp CEEEEECCTTBCHHHHHHHHHHHHHTTCEEEEEESSSE-----------------EEECTTSCEEEECEEGGGCCGGGCS
T ss_pred CEEEEEeCCCcCHHHHHHHHHHHHHCCCEEEEEeCCCc-----------------eEeecCCcEEeccccHHHcCccccc
Confidence 38999999999999999999999999999999999875 8999999999999999999888999
Q ss_pred EEEEcCCCCcccccCChHHHHHHHHHHhCCCeEEEEehHHHHHHhCcccCCceEecCCCCHHHHHHCCCeEecCCCCceE
Q 027708 89 GLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAAC 168 (220)
Q Consensus 89 ~liipGG~~~~~~~~~~~l~~~l~~~~~~g~~i~aic~G~~~La~aglL~g~~~T~~~~~~~~l~~~g~~~~~~~~~~~~ 168 (220)
+|+||||.++.....++.+++||+++++++++|+++|+|+++|+++|||+||++|+||...+.+++.+.++++.+ +
T Consensus 64 ~viipGg~~~~~~~~~~~~~~~l~~~~~~~k~i~aiC~G~~~La~aGlL~g~~~T~~~~~~~~l~~~g~~~~~~~----v 139 (166)
T d1g2ia_ 64 ALVLPGGRAPERVRLNEKAVSIARKMFSEGKPVASICHGPQILISAGVLRGRKGTSYPGIKDDMINAGVEWVDAE----V 139 (166)
T ss_dssp EEEECCBSHHHHHTTCHHHHHHHHHHHHTTCCEEEETTTTHHHHHHTCCTTCEECCCGGGHHHHHHTTCEECCSS----C
T ss_pred EEEEecccchhhhccChHHHHHHHHHHhcCCeeeeccccchhhhhcCcccCCccccCccHHHHHHHcCCeEcCCC----E
Confidence 999999987766667999999999999999999999999999999999999999999999999999889998775 8
Q ss_pred EEcCCEEeCCCCCCHHHHHHHHHHHH
Q 027708 169 VVDGNIITGATYEGHPEFIRLFLKAL 194 (220)
Q Consensus 169 v~dg~iiTs~g~~s~~~~~~~li~~l 194 (220)
|+|||+|||+|+.++.+|++++++.|
T Consensus 140 V~Dg~iiTs~g~~~~~~f~~~~i~~L 165 (166)
T d1g2ia_ 140 VVDGNWVSSRVPADLYAWMREFVKLL 165 (166)
T ss_dssp EEETTEEEECSGGGHHHHHHHHHHHH
T ss_pred EEeCCEEECCCHHHHHHHHHHHHHhh
Confidence 99999999999999999999999987
|
| >d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oi4a1 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ab0a1 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fexa1 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qvwa_ c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1n57a_ c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vhqa_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p80a1 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1t3ta2 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1wl8a1 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s1ma1 c.23.16.1 (A:287-544) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fyea_ c.23.16.4 (A:) Aspartyl dipeptidase PepE {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1iowa1 c.30.1.2 (A:1-96) D-Ala-D-Ala ligase, N-domain {Escherichia coli, gene ddlB [TaxId: 562]} | Back information, alignment and structure |
|---|