Citrus Sinensis ID: 027793


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MELLQEIDLFLSGIKELPSSIEHIEGLKCLRLNSCTKLGFLPESLCNLKKLQKLCLSQCRCLILSGLSSLSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYLNTSDCKRLQSLPKISSCLETPSNQTRGNSYLPVMFKFVNCVKLHKGTERNFFANFQRRVHNALPGILHRKVDRKLIDGVESAFVYVEVGFHTAGSGLNL
cccccEEEccccccccccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccHHccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEEccccccc
ccccEEEEcccccHHcccccHHcHHcccEEEccccccHccccccHHcHHHHcEEEccccccccccccccHHHHHEEEcccccccccccHHHHHHcccEEEccccccHcccccccccccEEEccccccHcccccccHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHHHHccEEcccccccccccccccccccccEEEEEccccccccEccc
MELLQEIDLFLSGIkelpssiehieglkclrlnsctklgflpesLCNLKKLQKLCLSQCRClilsglsslsslkclelsghnfeslptgisQLQRLKCLHLINcnmirslpelpfclnylntsdckrlqslpkisscletpsnqtrgnsylpVMFKFVNCvklhkgternfFANFQRRVHNalpgilhrkvdrKLIDGVESAFVYVEVGFHtagsglnl
MELLQEIDLFLSGIKELPSSIEHIEGLKCLRLNSCTKLGFLPESLCNLKKLQKLCLSQCRCLILSGLSSLSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYLNTSDCKRLQSLPkisscletpsnqtrgnsYLPVMFKFVNCVKLHKGTERNFFANFQRRVHNalpgilhrkvdRKLIDGVESAFVYVEVGFHTAGSGLNL
MELLQEIDLFLSGIKELPSSIEHIEGLKCLRLNSCTKLGFLPEslcnlkklqklclsqcrclilsglsslsslkclelsGHNFESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYLNTSDCKRLQSLPKISSCLETPSNQTRGNSYLPVMFKFVNCVKLHKGTERNFFANFQRRVHNALPGILHRKVDRKLIDGVESAFVYVEVGFHTAGSGLNL
*****EIDLFLSGIKELPSSIEHIEGLKCLRLNSCTKLGFLPESLCNLKKLQKLCLSQCRCLILSGLSSLSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYLNTSDCKRLQSLPKISSCL********GNSYLPVMFKFVNCVKLHKGTERNFFANFQRRVHNALPGILHRKVDRKLIDGVESAFVYVEVGFHTA******
MELLQEIDLFLSGIKELPSSIEHIEGLKCLRLNSCTKLGFLPESLCNLKKLQKLCLSQCRCLILSGLSSLSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYLNTSDCKRLQSLPKISSCLETPSNQTRGNSYLPVMFKFVNCVKLHKGTERNFFANFQRRVHNALPGILHRKVDRKLIDGVESAFVYVEVGFHTAGS*L**
MELLQEIDLFLSGIKELPSSIEHIEGLKCLRLNSCTKLGFLPESLCNLKKLQKLCLSQCRCLILSGLSSLSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYLNTSDCKRLQSLPKISSCLETPSNQTRGNSYLPVMFKFVNCVKLHKGTERNFFANFQRRVHNALPGILHRKVDRKLIDGVESAFVYVEVGFHTAGSGLNL
*ELLQEIDLFLSGIKELPSSIEHIEGLKCLRLNSCTKLGFLPESLCNLKKLQKLCLSQCRCLILSGLSSLSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYLNTSDCKRLQSLPKISSCLETPSNQTRGNSYLPVMFKFVNCVKLHKGTERNFFANFQRRVHNALPGILHRKVDRKLIDGVESAFVYVEVGFHTAGSGLNL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELLQEIDLFLSGIKELPSSIEHIEGLKCLRLNSCTKLGFLPESLCNLKKLQKLCLSQCRCLILSGLSSLSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYLNTSDCKRLQSLPKISSCLETPSNQTRGNSYLPVMFKFVNCVKLHKGTERNFFANFQRRVHNALPGILHRKVDRKLIDGVESAFVYVEVGFHTAGSGLNL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query219 2.2.26 [Sep-21-2011]
Q6DHL5238 Leucine-rich repeat-conta yes no 0.484 0.445 0.385 1e-08
Q40392 1144 TMV resistance protein N N/A no 0.538 0.103 0.357 1e-07
P0CB16 1201 Putative disease resistan no no 0.639 0.116 0.354 1e-07
Q9FKZ0815 Probable disease resistan no no 0.529 0.142 0.361 2e-07
Q9RBS2 1024 Protein PopC OS=Ralstonia yes no 0.611 0.130 0.325 1e-06
Q5FVI3239 Leucine-rich repeat-conta yes no 0.488 0.447 0.414 2e-06
Q8BGR2859 Leucine-rich repeat-conta yes no 0.652 0.166 0.324 2e-06
Q7SXW3 601 Leucine-rich repeat-conta no no 0.520 0.189 0.328 3e-06
Q8N9N7239 Leucine-rich repeat-conta yes no 0.488 0.447 0.405 3e-06
Q9FKZ1809 Probable disease resistan no no 0.461 0.124 0.364 3e-06
>sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 Back     alignment and function desciption
 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 63/109 (57%), Gaps = 3/109 (2%)

Query: 4   LQEIDLFLSGIKELPSSIEHIEGLKCLRLNSCTKLGFLPESLCNLKKLQKLCLSQCRCLI 63
           L+ +DL  + I+ELP+ I   + LK   + SC KL  LP  +  LKKL+ L L+  +   
Sbjct: 40  LRTVDLSNNKIEELPAFIGSFQHLKSFTI-SCNKLTSLPNDIGKLKKLETLILNGNQLKQ 98

Query: 64  L-SGLSSLSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLP 111
           L S +  L SL+ L LSG+ F+  P+G+  L++L  L L + N IR +P
Sbjct: 99  LPSSIGQLKSLRTLSLSGNQFKEFPSGLGTLRQLDVLDL-SKNQIRVVP 146





Danio rerio (taxid: 7955)
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function description
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description
>sp|Q9FKZ0|DRL43_ARATH Probable disease resistance protein At5g66910 OS=Arabidopsis thaliana GN=At5g66910 PE=2 SV=1 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|Q5FVI3|LRC57_RAT Leucine-rich repeat-containing protein 57 OS=Rattus norvegicus GN=Lrrc57 PE=2 SV=1 Back     alignment and function description
>sp|Q8BGR2|LRC8D_MOUSE Leucine-rich repeat-containing protein 8D OS=Mus musculus GN=Lrrc8d PE=2 SV=1 Back     alignment and function description
>sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 Back     alignment and function description
>sp|Q9FKZ1|DRL42_ARATH Probable disease resistance protein At5g66900 OS=Arabidopsis thaliana GN=At5g66900 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query219
255563202 1158 leucine-rich repeat containing protein, 0.894 0.169 0.339 9e-21
255537139 1137 leucine-rich repeat-containing protein, 0.776 0.149 0.325 2e-16
147841678 1567 hypothetical protein VITISV_003258 [Viti 0.716 0.100 0.355 7e-16
451799084 1514 TMV resistance protein N-like protein 1 0.735 0.106 0.342 1e-15
359477827 1408 PREDICTED: TMV resistance protein N-like 0.735 0.114 0.342 1e-15
297741888 1186 unnamed protein product [Vitis vinifera] 0.735 0.135 0.342 1e-15
224145016 1254 tir-nbs-lrr resistance protein [Populus 0.639 0.111 0.388 1e-14
359493220 1481 PREDICTED: TMV resistance protein N-like 0.557 0.082 0.425 2e-14
147771313 1384 hypothetical protein VITISV_034210 [Viti 0.557 0.088 0.425 2e-14
147782877 1383 hypothetical protein VITISV_009855 [Viti 0.694 0.109 0.348 3e-14
>gi|255563202|ref|XP_002522604.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223538080|gb|EEF39691.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  106 bits (264), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 69/203 (33%), Positives = 107/203 (52%), Gaps = 7/203 (3%)

Query: 4   LQEIDLFLSGIKELPSSIEHIEGLKCLRLNSCTKLGFLPESLCNLKKLQKLCLSQCRCLI 63
           LQ + L  + +  LP +  +++ L  L  + C+KLG LP+++ NLK L +L    C    
Sbjct: 794 LQHLSLDETAMVNLPDTFCNLKALNMLNFSDCSKLGKLPKNMKNLKSLAELRAGGCNLST 853

Query: 64  L-SGLSSLSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYLNT 122
           L + L  LSS+  L LSG NF+++P GI+QL +L+ +++  C  ++SLPELP  + YLN 
Sbjct: 854 LPADLKYLSSIVELNLSGSNFDTMPAGINQLSKLRWINVTGCKRLQSLPELPPRIRYLNA 913

Query: 123 SDCKRLQSLPKISSCLETPSNQTRGNSYLPVMFKFVNCVKLHKGTERNFFANFQRRVHNA 182
            DC+ L S+  +    E   +    NS     F F NC KL +    +  A+ Q ++ + 
Sbjct: 914 RDCRSLVSISGLKQLFELGCS----NSLDDETFVFTNCFKLDQDNWADILASAQLKIQHF 969

Query: 183 LPGILHRKVDRKLIDGVESAFVY 205
             G  H   DR+L D     F Y
Sbjct: 970 AMGRKH--YDRELYDETFICFTY 990




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255537139|ref|XP_002509636.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223549535|gb|EEF51023.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147841678|emb|CAN73064.1| hypothetical protein VITISV_003258 [Vitis vinifera] Back     alignment and taxonomy information
>gi|451799084|gb|AGF69238.1| TMV resistance protein N-like protein 1 [Vitis labrusca] Back     alignment and taxonomy information
>gi|359477827|ref|XP_002282884.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297741888|emb|CBI33323.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224145016|ref|XP_002325496.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862371|gb|EEE99877.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359493220|ref|XP_002264441.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147771313|emb|CAN73963.1| hypothetical protein VITISV_034210 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147782877|emb|CAN67859.1| hypothetical protein VITISV_009855 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query219
TAIR|locus:2129670 1008 AT4G14370 [Arabidopsis thalian 0.410 0.089 0.333 3e-12
TAIR|locus:2118106 1219 AT4G12010 [Arabidopsis thalian 0.374 0.067 0.393 1.3e-09
TAIR|locus:2098145 1240 AT3G44630 [Arabidopsis thalian 0.415 0.073 0.295 9.7e-09
TAIR|locus:2152252 986 AT5G38850 [Arabidopsis thalian 0.406 0.090 0.333 4.4e-07
TAIR|locus:2827629 1355 AT2G17050 [Arabidopsis thalian 0.315 0.050 0.366 7.4e-07
TAIR|locus:21749201017 AT5G40100 [Arabidopsis thalian 0.283 0.060 0.460 7.6e-07
TAIR|locus:21001821007 AT3G44400 [Arabidopsis thalian 0.351 0.076 0.329 1.3e-06
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.429 0.072 0.333 1.8e-06
TAIR|locus:2155322 1170 LAZ5 "LAZARUS 5" [Arabidopsis 0.347 0.064 0.358 2.1e-06
TAIR|locus:2024588 997 RLM1 "RESISTANCE TO LEPTOSPHAE 0.374 0.082 0.343 2.4e-06
TAIR|locus:2129670 AT4G14370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 137 (53.3 bits), Expect = 3.0e-12, Sum P(2) = 3.0e-12
 Identities = 34/102 (33%), Positives = 51/102 (50%)

Query:    84 ESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYLNTSDCKRLQSLPKISSCLETPSN 143
             E +P  I  L  L  LH+  C  ++SLP+LP  + +LN  DC+ L+S+  +SS       
Sbjct:   730 EKIPDWIKDLHELSFLHIGGCRNLKSLPQLPLSIRWLNACDCESLESVACVSSL------ 783

Query:   144 QTRGNSYLPVMFKFVNCVKLHKGTERNFFANFQRRVHNALPG 185
                 NS++ +   F NC KL++ T R+       R    LPG
Sbjct:   784 ----NSFVDL--NFTNCFKLNQETRRDLIQQSFFRSLRILPG 819


GO:0000166 "nucleotide binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA;ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0035091 "phosphatidylinositol binding" evidence=ISS
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098145 AT3G44630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152252 AT5G38850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827629 AT2G17050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174920 AT5G40100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2100182 AT3G44400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155322 LAZ5 "LAZARUS 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024588 RLM1 "RESISTANCE TO LEPTOSPHAERIA MACULANS 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query219
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-09
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.002
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.003
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score = 57.2 bits (138), Expect = 1e-09
 Identities = 54/168 (32%), Positives = 75/168 (44%), Gaps = 20/168 (11%)

Query: 9   LFLSGIK---ELPSSIEHIEGLKCLRLNSCTKLGFLPESLCNLKKLQKLCLSQCRCL--- 62
           LFLS I    ELPSSI+++  L+ L + +C  L  LP  + NL+ L+ L LS C  L   
Sbjct: 783 LFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGCSRLRTF 841

Query: 63  --ILSGLSSLSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYL 120
             I + +S L+      LS    E +P  I +   L  L +  CN ++ +      L +L
Sbjct: 842 PDISTNISDLN------LSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHL 895

Query: 121 NT---SDCKRLQSLPKISSCLETPSNQTRGNSYLP--VMFKFVNCVKL 163
            T   SDC  L       S  E        +S LP  V   F+NC  L
Sbjct: 896 ETVDFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTVCINFINCFNL 943


syringae 6; Provisional. Length = 1153

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 219
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.66
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.58
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.46
KOG0617264 consensus Ras suppressor protein (contains leucine 99.46
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.42
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.3
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.29
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.29
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.27
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.27
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.26
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.17
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.16
PLN03150623 hypothetical protein; Provisional 99.14
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.14
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.07
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.07
PLN03150623 hypothetical protein; Provisional 99.05
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.05
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.04
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.01
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.97
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.95
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.92
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.85
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.77
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.71
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.7
PRK15386 426 type III secretion protein GogB; Provisional 98.7
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.7
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.62
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.48
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.44
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.42
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.39
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.35
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.29
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.28
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.19
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.18
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.14
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.14
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.12
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.12
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.01
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.0
KOG4237498 consensus Extracellular matrix protein slit, conta 97.98
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.96
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.9
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.87
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.8
PRK15386 426 type III secretion protein GogB; Provisional 97.75
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.56
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.54
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.52
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.91
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.85
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.84
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.81
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.74
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.72
KOG4341 483 consensus F-box protein containing LRR [General fu 96.56
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.38
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.17
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.16
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.12
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.93
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.18
KOG4341483 consensus F-box protein containing LRR [General fu 95.09
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.63
smart0037026 LRR Leucine-rich repeats, outliers. 94.63
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.56
smart0037026 LRR Leucine-rich repeats, outliers. 94.5
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.5
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.14
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 93.94
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.93
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.09
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.75
KOG0473 326 consensus Leucine-rich repeat protein [Function un 89.38
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 89.22
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 89.08
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 84.92
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 80.27
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.66  E-value=2.6e-16  Score=145.93  Aligned_cols=133  Identities=29%  Similarity=0.377  Sum_probs=74.2

Q ss_pred             CCccEEEeecCCCcc-cCccccCCCCCcEEeccCCCCCCCCccccCCCCCCcEEeccccccc--ccccCCCCCCCCEEEe
Q 027793            2 ELLQEIDLFLSGIKE-LPSSIEHIEGLKCLRLNSCTKLGFLPESLCNLKKLQKLCLSQCRCL--ILSGLSSLSSLKCLEL   78 (219)
Q Consensus         2 ~~L~~L~l~~~~i~~-lp~~~~~l~~L~~L~l~~~~~~~~~p~~~~~l~~L~~L~l~~~~~~--~p~~~~~l~~L~~L~l   78 (219)
                      ++|++|++++|.+.. +|..++.+++|++|++++|.+.+.+|..++++++|++|++++|.+.  +|..++.+++|++|++
T Consensus       140 ~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L  219 (968)
T PLN00113        140 PNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYL  219 (968)
T ss_pred             CCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEEC
Confidence            345555555555543 4555566666666666666555556656666666666666666543  4555555666666666


Q ss_pred             cCCcCC-ccchhhhCCCCCCEEeccCCCCCCcCCCC---CCCCCeEeccCCcCCCcCCcc
Q 027793           79 SGHNFE-SLPTGISQLQRLKCLHLINCNMIRSLPEL---PFCLNYLNTSDCKRLQSLPKI  134 (219)
Q Consensus        79 ~~n~l~-~lp~~l~~l~~L~~L~l~~~~~l~~lp~~---~~~L~~L~l~~~~~l~~lp~~  134 (219)
                      ++|.++ .+|..++++++|++|++++|+..+.+|..   +++|+.|++++|.....+|..
T Consensus       220 ~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~  279 (968)
T PLN00113        220 GYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPS  279 (968)
T ss_pred             cCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchh
Confidence            666654 55555566666666666655544444432   245555555555443444433



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query219
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-09
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-09
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-04
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 82.7 bits (205), Expect = 5e-19
 Identities = 40/144 (27%), Positives = 65/144 (45%), Gaps = 15/144 (10%)

Query: 4   LQEIDLFLSGIKELPSSIEHIEGLKCLRLNSCTKLGFLPESLCN---------LKKLQKL 54
           L+ + L  + ++ LP+SI  +  L+ L + +C +L  LPE L +         L  LQ L
Sbjct: 129 LETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSL 188

Query: 55  CLSQCRCLIL-SGLSSLSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPE- 112
            L       L + +++L +LK L++      +L   I  L +L+ L L  C  +R+ P  
Sbjct: 189 RLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPI 248

Query: 113 ---LPFCLNYLNTSDCKRLQSLPK 133
                  L  L   DC  L +LP 
Sbjct: 249 FGGRA-PLKRLILKDCSNLLTLPL 271


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query219
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.84
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.76
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.75
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.74
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.74
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.73
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.73
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.73
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.72
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.72
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.71
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.71
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.71
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.7
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.7
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.7
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.7
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.7
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.7
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.69
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.69
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.69
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.69
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.69
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.69
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.68
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.68
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.68
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.68
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.68
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.67
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.67
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.67
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.67
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.66
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.66
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.66
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.65
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.65
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.65
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.65
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.65
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.65
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.65
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.64
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.64
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.64
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.64
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.63
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.63
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.63
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.62
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.62
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.62
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.62
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.62
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.62
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.62
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.62
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.62
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.62
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.61
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.61
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.61
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.61
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.61
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.61
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.61
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.61
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.6
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.59
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.59
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.59
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.59
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.58
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.58
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.58
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.58
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.57
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.57
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.57
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.57
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.57
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.56
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.56
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.56
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.56
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.56
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.56
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.56
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.56
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.55
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.55
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.54
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.54
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.54
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.54
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.52
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.52
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.52
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.52
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.52
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.52
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.51
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.51
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.5
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.5
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.5
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.48
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.48
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.46
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.46
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.39
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.35
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.34
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.34
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.3
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.28
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.26
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.25
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.23
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.23
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.21
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.12
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.02
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.99
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.98
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.95
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.92
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.92
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.76
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.75
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.7
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.67
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.41
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.41
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.4
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.31
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.28
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.19
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.14
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.1
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.71
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.4
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.26
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.13
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.92
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.81
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.77
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.76
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.59
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.49
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.93
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.88  E-value=2.7e-22  Score=163.55  Aligned_cols=171  Identities=26%  Similarity=0.404  Sum_probs=91.1

Q ss_pred             CccEEEeecCCCcccCccccCCCCCcEEeccCCCCCCCCccccCC---------CCCCcEEeccccccc-ccccCCCCCC
Q 027793            3 LLQEIDLFLSGIKELPSSIEHIEGLKCLRLNSCTKLGFLPESLCN---------LKKLQKLCLSQCRCL-ILSGLSSLSS   72 (219)
Q Consensus         3 ~L~~L~l~~~~i~~lp~~~~~l~~L~~L~l~~~~~~~~~p~~~~~---------l~~L~~L~l~~~~~~-~p~~~~~l~~   72 (219)
                      +|++|++++|.++.+|..++.+++|++|++++|...+.+|..+..         +++|++|++++|.+. +|..++.+++
T Consensus       128 ~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~L~~n~~~~~~p~~~~~~~~~~~~~~l~~L~~L~L~~n~l~~lp~~l~~l~~  207 (328)
T 4fcg_A          128 GLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQN  207 (328)
T ss_dssp             TCSEEEEESCCCCCCCGGGGGCTTCCEEEEEEETTCCCCCSCSEEEC-CCCEEESTTCCEEEEEEECCCCCCGGGGGCTT
T ss_pred             CCCEEECCCCccccCcHHHhcCcCCCEEECCCCCCccccChhHhhccchhhhccCCCCCEEECcCCCcCcchHhhcCCCC
Confidence            344444444444444444444444444444444444444443322         444444444444433 4555556666


Q ss_pred             CCEEEecCCcCCccchhhhCCCCCCEEeccCCCCCCcCCCC---CCCCCeEeccCCcCCCcCCccccCCCCCccccCCCC
Q 027793           73 LKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPEL---PFCLNYLNTSDCKRLQSLPKISSCLETPSNQTRGNS  149 (219)
Q Consensus        73 L~~L~l~~n~l~~lp~~l~~l~~L~~L~l~~~~~l~~lp~~---~~~L~~L~l~~~~~l~~lp~~~~~~~~~~~~~~~~~  149 (219)
                      |++|++++|.++.+|..+..+++|++|++++|+..+.+|..   +++|+.|++++|..++.+|..+..+           
T Consensus       208 L~~L~L~~N~l~~l~~~l~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~~p~~~~~l-----------  276 (328)
T 4fcg_A          208 LKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRL-----------  276 (328)
T ss_dssp             CCEEEEESSCCCCCCGGGGGCTTCCEEECTTCTTCCBCCCCTTCCCCCCEEECTTCTTCCBCCTTGGGC-----------
T ss_pred             CCEEEccCCCCCcCchhhccCCCCCEEECcCCcchhhhHHHhcCCCCCCEEECCCCCchhhcchhhhcC-----------
Confidence            66666666666666666666666666666666666666543   2466666666666666666554433           


Q ss_pred             CCCeEEEEcCCcccccccccchhHhHHHHHhhhCCCc
Q 027793          150 YLPVMFKFVNCVKLHKGTERNFFANFQRRVHNALPGI  186 (219)
Q Consensus       150 ~~l~~l~~~~c~~l~~~~~~~~~~~~~~~~~~~lp~~  186 (219)
                      ..++.+++++|+.+...+.  .+..+..+....+|..
T Consensus       277 ~~L~~L~L~~n~~~~~iP~--~l~~L~~L~~l~l~~~  311 (328)
T 4fcg_A          277 TQLEKLDLRGCVNLSRLPS--LIAQLPANCIILVPPH  311 (328)
T ss_dssp             TTCCEEECTTCTTCCCCCG--GGGGSCTTCEEECCGG
T ss_pred             CCCCEEeCCCCCchhhccH--HHhhccCceEEeCCHH
Confidence            1445777777766666553  3334444444444433



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 219
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Leucine rich effector protein YopM
domain: Leucine rich effector protein YopM
species: Yersinia pestis [TaxId: 632]
 Score = 46.0 bits (107), Expect = 1e-06
 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 5/70 (7%)

Query: 70  LSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYLNTSDCKRLQ 129
             SL+ L +S +    LP    +L+RL      + N +  +PELP  L  L+      L+
Sbjct: 283 PPSLEELNVSNNKLIELPALPPRLERLI----ASFNHLAEVPELPQNLKQLHVEYNP-LR 337

Query: 130 SLPKISSCLE 139
             P I   +E
Sbjct: 338 EFPDIPESVE 347


>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query219
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.68
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.64
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.62
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.6
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.56
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.55
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.55
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.53
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.51
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.49
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.49
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.46
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.45
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.44
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.41
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.4
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.38
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.37
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.37
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.37
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.33
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.33
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.32
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.25
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.23
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.12
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.06
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.96
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.72
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.48
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.32
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.24
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.18
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.12
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.11
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.6
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.58
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.68
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.68  E-value=2.6e-16  Score=122.53  Aligned_cols=150  Identities=20%  Similarity=0.109  Sum_probs=76.5

Q ss_pred             CccEEEeecCCCcccCc-cccCCCCCcEEeccCCCCCCCCccccCCCCCCcEEeccccccc-ccccCCCCCCCCEEEecC
Q 027793            3 LLQEIDLFLSGIKELPS-SIEHIEGLKCLRLNSCTKLGFLPESLCNLKKLQKLCLSQCRCL-ILSGLSSLSSLKCLELSG   80 (219)
Q Consensus         3 ~L~~L~l~~~~i~~lp~-~~~~l~~L~~L~l~~~~~~~~~p~~~~~l~~L~~L~l~~~~~~-~p~~~~~l~~L~~L~l~~   80 (219)
                      ++++|++++|.|+.+|. .|..+++|++|++++|.+ +.+| .++.+++|++|++++|.+. .+..+..+++|+.|++++
T Consensus        32 ~l~~L~Ls~N~i~~l~~~~f~~l~~L~~L~L~~N~l-~~l~-~~~~l~~L~~L~Ls~N~l~~~~~~~~~l~~L~~L~l~~  109 (266)
T d1p9ag_          32 DTTILHLSENLLYTFSLATLMPYTRLTQLNLDRAEL-TKLQ-VDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSF  109 (266)
T ss_dssp             TCCEEECTTSCCSEEEGGGGTTCTTCCEEECTTSCC-CEEE-CCSCCTTCCEEECCSSCCSSCCCCTTTCTTCCEEECCS
T ss_pred             CCCEEECcCCcCCCcCHHHhhccccccccccccccc-cccc-cccccccccccccccccccccccccccccccccccccc
Confidence            45556666666555543 255555666666655533 2333 2345555666666655544 444455555666666665


Q ss_pred             CcCCccc-hhhhCCCCCCEEeccCCCCCCcCCCC----CCCCCeEeccCCcCCCcCCcc-ccCCCCCccccCCCCCCCeE
Q 027793           81 HNFESLP-TGISQLQRLKCLHLINCNMIRSLPEL----PFCLNYLNTSDCKRLQSLPKI-SSCLETPSNQTRGNSYLPVM  154 (219)
Q Consensus        81 n~l~~lp-~~l~~l~~L~~L~l~~~~~l~~lp~~----~~~L~~L~l~~~~~l~~lp~~-~~~~~~~~~~~~~~~~~l~~  154 (219)
                      |.+..++ ..+..+.+++.|++++| .+..+|..    .+.++.+++++| .++.++.. +..+           ..++.
T Consensus       110 ~~~~~~~~~~~~~l~~l~~L~l~~n-~l~~l~~~~~~~l~~l~~l~l~~N-~l~~~~~~~~~~l-----------~~L~~  176 (266)
T d1p9ag_         110 NRLTSLPLGALRGLGELQELYLKGN-ELKTLPPGLLTPTPKLEKLSLANN-NLTELPAGLLNGL-----------ENLDT  176 (266)
T ss_dssp             SCCCCCCSSTTTTCTTCCEEECTTS-CCCCCCTTTTTTCTTCCEEECTTS-CCSCCCTTTTTTC-----------TTCCE
T ss_pred             cccceeecccccccccccccccccc-ccceeccccccccccchhcccccc-cccccCccccccc-----------cccce
Confidence            5555433 23345555666666553 23333321    245666666664 34444432 2222           14456


Q ss_pred             EEEcCCcccccccc
Q 027793          155 FKFVNCVKLHKGTE  168 (219)
Q Consensus       155 l~~~~c~~l~~~~~  168 (219)
                      ++++++ .++.++.
T Consensus       177 L~Ls~N-~L~~lp~  189 (266)
T d1p9ag_         177 LLLQEN-SLYTIPK  189 (266)
T ss_dssp             EECCSS-CCCCCCT
T ss_pred             eecccC-CCcccCh
Confidence            777665 4555543



>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure