Citrus Sinensis ID: 027810

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MGDSIDLTGDEGVIKKIVRQAKPDALSPTEDLPLVDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVKLCSVDLFSVCSLWGAKFLLLILFSSFYQVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELVACRPRKGSSLGSVSEERARLEELKRQRELAAAVKEEEKKKREEAKAAAAARIQAKMEAKKGQGKGKGKGK
ccccccccccccEEEEEEEccccccccccccccEEEEEEEEEEccccccccccccccccEEEEcccccEEEcHHHHHHcccccccccccccccccccHHHHHHHHcccccccccEEEEEEcccccccccccccccccccEEEEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
ccccccccccccEEEEEEEEcccccccccccccEEEEEEEEEEcccccEEcccccccccEEEEEccccEHHHHHHHHHHccccccHHHHEEEcccccccHHHHHHHHHHHccccEEEEEEcHHHccccccEcccEcccccEEEEEEEEEEcccccccccccHHHHHHHHHHHHHHHccccEcccccccHHHHHHHHHHHHHccEEEEccccccccccc
mgdsidltgdegVIKKIVRQakpdalsptedlplvdvhyegslaetgevfdtthedntvFSFELGKGSVIRAWDIALRSMKVKLCSVDLFSVCSLWGAKFLLLILFSSFyqvgevakltckpeyaygsagsppdvppdatLIFEVELVacrprkgsslgsVSEERARLEELKRQRELAAAVKEEEKKKREEAKAAAAARIQAKMEAkkgqgkgkgkgk
mgdsidltgdegvIKKIvrqakpdalsptedlplvDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVKLCSVDLFSVCSLWGAKFLLLILFSSFYQVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELVAcrprkgsslgsvseeraRLEELKRQRELAAAVKEEEKKKREEAKAAAAARIQAkmeakkgqgkgkgkgk
MGDSIDLTGDEGVIKKIVRQAKPDALSPTEDLPLVDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVKLCSVDLFSVCSLWGAKFLLLILFSSFYQVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELVACRPRKGSSLGSVSEERARLEELKRQrelaaavkeeekkkreeakaaaaariqakmeakkgqgkgkgkgk
*******************************LPLVDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVKLCSVDLFSVCSLWGAKFLLLILFSSFYQVGEVAKLTCKPEYAYGS*********DATLIFEVELVAC********************************************************************
*GDSIDLTGDEGVIKKIVRQAKPD*LSPTEDLPLVDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVKLCSVDLFSVCSLWGAKFLLLILFSSFYQVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELVACRP***************************AVKEEEKKKREEAKAAAAARIQ*****************
MGDSIDLTGDEGVIKKIVRQAKPDALSPTEDLPLVDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVKLCSVDLFSVCSLWGAKFLLLILFSSFYQVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELVACRPRKGSSLGSVSEERARLEELKRQ********************************************
****IDLTGDEGVIKKIVRQAKPDALSPTEDLPLVDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVKLCSVDLFSVCSLWGAKFLLLILFSSFYQVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELVACRPRKGSSLGSVSEERARLEELKRQRELAAAVKEEEKKKREEAKAAAAARIQAKMEAKKG*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDSIDLTGDEGVIKKIVRQAKPDALSPTEDLPLVDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVKLCSVDLFSVCSLWGAKFLLLILFSSFYQVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELVACRPRKGSSLGSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAKMEAKKGQGKGKGKGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query218 2.2.26 [Sep-21-2011]
Q9M2S7190 Peptidyl-prolyl cis-trans yes no 0.802 0.921 0.697 1e-67
Q02790 459 Peptidyl-prolyl cis-trans yes no 0.518 0.246 0.438 7e-23
Q9QVC8 458 Peptidyl-prolyl cis-trans yes no 0.518 0.246 0.438 2e-22
P27124 458 Peptidyl-prolyl cis-trans yes no 0.518 0.246 0.431 4e-22
P30416 458 Peptidyl-prolyl cis-trans yes no 0.518 0.246 0.431 6e-22
Q9TRY0 459 Peptidyl-prolyl cis-trans yes no 0.518 0.246 0.431 2e-21
Q9VL78 439 FK506-binding protein 59 yes no 0.646 0.321 0.356 1e-20
Q5RF88 457 Peptidyl-prolyl cis-trans no no 0.504 0.240 0.377 3e-20
Q13451 457 Peptidyl-prolyl cis-trans no no 0.504 0.240 0.377 3e-20
Q9XSH5 457 Peptidyl-prolyl cis-trans N/A no 0.504 0.240 0.364 2e-19
>sp|Q9M2S7|FK201_ARATH Peptidyl-prolyl cis-trans isomerase FKBP20-1 OS=Arabidopsis thaliana GN=FKBP20-1 PE=2 SV=1 Back     alignment and function desciption
 Score =  256 bits (653), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 143/205 (69%), Positives = 165/205 (80%), Gaps = 30/205 (14%)

Query: 1   MGDSIDLTGDEGVIKKIVRQAKPDALSPTEDLPLVDVHYEGSLAETGEVFDTTHEDNTVF 60
           MGD+IDL+GD GV+KKIVR AKPDA+SP++DLP+VDVHYEG LAE  +VFDTT EDN VF
Sbjct: 1   MGDAIDLSGDGGVLKKIVRSAKPDAISPSDDLPVVDVHYEGILAEDEKVFDTTREDNLVF 60

Query: 61  SFELGKGSVIRAWDIALRSMKVKLCSVDLFSVCSLWGAKFLLLILFSSFYQVGEVAKLTC 120
           SFELG GSVIR+WDIAL++MKV                              GEVAK+TC
Sbjct: 61  SFELGTGSVIRSWDIALKTMKV------------------------------GEVAKITC 90

Query: 121 KPEYAYGSAGSPPDVPPDATLIFEVELVACRPRKGSSLGSVSEERARLEELKRQRELAAA 180
           KPEYAYG AGSPPD+PPDATLIFEVELVACRPRKG+S+GSVSEERARLE+LK+QRE+AAA
Sbjct: 91  KPEYAYGRAGSPPDIPPDATLIFEVELVACRPRKGASVGSVSEERARLEDLKKQREIAAA 150

Query: 181 VKEEEKKKREEAKAAAAARIQAKME 205
            KE++KKKREEAKAAAAARIQAK++
Sbjct: 151 AKEDDKKKREEAKAAAAARIQAKLD 175
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q02790|FKBP4_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens GN=FKBP4 PE=1 SV=3 Back     alignment and function description
>sp|Q9QVC8|FKBP4_RAT Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Rattus norvegicus GN=Fkbp4 PE=1 SV=3 Back     alignment and function description
>sp|P27124|FKBP4_RABIT Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Oryctolagus cuniculus GN=FKBP4 PE=1 SV=3 Back     alignment and function description
>sp|P30416|FKBP4_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Mus musculus GN=Fkbp4 PE=1 SV=5 Back     alignment and function description
>sp|Q9TRY0|FKBP4_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Bos taurus GN=FKBP4 PE=1 SV=4 Back     alignment and function description
>sp|Q9VL78|FKB59_DROME FK506-binding protein 59 OS=Drosophila melanogaster GN=FKBP59 PE=1 SV=1 Back     alignment and function description
>sp|Q5RF88|FKBP5_PONAB Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Pongo abelii GN=FKBP5 PE=2 SV=1 Back     alignment and function description
>sp|Q13451|FKBP5_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens GN=FKBP5 PE=1 SV=2 Back     alignment and function description
>sp|Q9XSH5|FKBP5_SAIBB Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Saimiri boliviensis boliviensis GN=FKBP5 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
388515907183 unknown [Medicago truncatula] 0.839 1.0 0.690 3e-71
225449458188 PREDICTED: FK506-binding protein 59 isof 0.807 0.936 0.713 2e-68
388518611188 unknown [Medicago truncatula] 0.802 0.930 0.682 4e-67
357492297258 Peptidyl-prolyl cis-trans isomerase FKBP 0.802 0.678 0.682 5e-67
363806914188 uncharacterized protein LOC100815917 [Gl 0.802 0.930 0.702 1e-66
351721330188 uncharacterized protein LOC100500018 [Gl 0.802 0.930 0.721 4e-66
15233297190 FKBP-like peptidyl-prolyl cis-trans isom 0.802 0.921 0.697 5e-66
30172151156 peptidylprolyl cis-trans isomerase [Oryz 0.715 1.0 0.672 9e-66
255581541186 fk506 binding protein, putative [Ricinus 0.807 0.946 0.718 1e-65
116781718190 unknown [Picea sitchensis] 0.807 0.926 0.679 1e-65
>gi|388515907|gb|AFK46015.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
 Score =  273 bits (699), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 175/213 (82%), Gaps = 30/213 (14%)

Query: 1   MGDSIDLTGDEGVIKKIVRQAKPDALSPTEDLPLVDVHYEGSLAETGEVFDTTHEDNTVF 60
           MGD+IDL+GD GVIK IVR++K DA++PTED P+VDVHYEG+LA+TGEVFDTTHEDNT+F
Sbjct: 1   MGDAIDLSGDGGVIKTIVRKSKSDAVAPTEDFPVVDVHYEGTLADTGEVFDTTHEDNTIF 60

Query: 61  SFELGKGSVIRAWDIALRSMKVKLCSVDLFSVCSLWGAKFLLLILFSSFYQVGEVAKLTC 120
           SFE+GKGSVI+AWDIA+++MKV                              GE+AK+TC
Sbjct: 61  SFEVGKGSVIKAWDIAVKTMKV------------------------------GEIAKITC 90

Query: 121 KPEYAYGSAGSPPDVPPDATLIFEVELVACRPRKGSSLGSVSEERARLEELKRQRELAAA 180
           KPEYAYGSAGSPPD+PPD+TL+FEVELVACRPRKGS+ GSVSEERARL+ELK+QRE+AAA
Sbjct: 91  KPEYAYGSAGSPPDIPPDSTLVFEVELVACRPRKGSTTGSVSEERARLDELKKQREIAAA 150

Query: 181 VKEEEKKKREEAKAAAAARIQAKMEAKKGQGKG 213
            KEE+KKKREE KAAAAAR+QAK++AKKG GKG
Sbjct: 151 AKEEDKKKREEQKAAAAARVQAKLDAKKGHGKG 183

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225449458|ref|XP_002283206.1| PREDICTED: FK506-binding protein 59 isoform 1 [Vitis vinifera] gi|359486789|ref|XP_003633475.1| PREDICTED: FK506-binding protein 59 [Vitis vinifera] gi|296086212|emb|CBI31653.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388518611|gb|AFK47367.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357492297|ref|XP_003616437.1| Peptidyl-prolyl cis-trans isomerase FKBP4 [Medicago truncatula] gi|355517772|gb|AES99395.1| Peptidyl-prolyl cis-trans isomerase FKBP4 [Medicago truncatula] Back     alignment and taxonomy information
>gi|363806914|ref|NP_001242048.1| uncharacterized protein LOC100815917 [Glycine max] gi|255640891|gb|ACU20728.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|351721330|ref|NP_001235670.1| uncharacterized protein LOC100500018 [Glycine max] gi|255628543|gb|ACU14616.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|15233297|ref|NP_191111.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Arabidopsis thaliana] gi|75183181|sp|Q9M2S7.1|FK201_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP20-1; Short=PPIase FKBP20-1; AltName: Full=FK506-binding protein 20-1; Short=AtFKBP20-1; AltName: Full=Immunophilin FKBP20-1; AltName: Full=Rotamase gi|7076795|emb|CAB75910.1| putative protein [Arabidopsis thaliana] gi|17644173|gb|AAL38784.1| unknown protein [Arabidopsis thaliana] gi|20259075|gb|AAM14253.1| unknown protein [Arabidopsis thaliana] gi|21537391|gb|AAM61732.1| unknown [Arabidopsis thaliana] gi|332645875|gb|AEE79396.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30172151|emb|CAD89783.1| peptidylprolyl cis-trans isomerase [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|255581541|ref|XP_002531576.1| fk506 binding protein, putative [Ricinus communis] gi|223528806|gb|EEF30812.1| fk506 binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|116781718|gb|ABK22214.1| unknown [Picea sitchensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
TAIR|locus:2100016190 AT3G55520 "AT3G55520" [Arabido 0.376 0.431 0.768 2.3e-60
UNIPROTKB|Q65XG1186 OJ1362_D02.6 "Peptidyl-prolyl 0.376 0.440 0.719 9.9e-60
UNIPROTKB|Q5N9W0185 P0406G08.35 "Peptidyl-prolyl c 0.376 0.443 0.658 6.9e-57
UNIPROTKB|F1SK86 456 FKBP4 "Uncharacterized protein 0.169 0.081 0.783 7e-25
UNIPROTKB|Q02790 459 FKBP4 "Peptidyl-prolyl cis-tra 0.169 0.080 0.783 1.2e-24
UNIPROTKB|P27124 458 FKBP4 "Peptidyl-prolyl cis-tra 0.169 0.080 0.756 1.5e-24
UNIPROTKB|E2QWF5 459 FKBP4 "Uncharacterized protein 0.188 0.089 0.731 1.8e-24
RGD|628729 458 Fkbp4 "FK506 binding protein 4 0.169 0.080 0.783 1.9e-24
UNIPROTKB|F1NIM4 442 FKBP4 "Uncharacterized protein 0.169 0.083 0.729 3.5e-24
UNIPROTKB|F1NP08 464 FKBP4 "Uncharacterized protein 0.169 0.079 0.729 4.3e-24
TAIR|locus:2100016 AT3G55520 "AT3G55520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 333 (122.3 bits), Expect = 2.3e-60, Sum P(2) = 2.3e-60
 Identities = 63/82 (76%), Positives = 74/82 (90%)

Query:     1 MGDSIDLTGDEGVIKKIVRQAKPDALSPTEDLPLVDVHYEGSLAETGEVFDTTHEDNTVF 60
             MGD+IDL+GD GV+KKIVR AKPDA+SP++DLP+VDVHYEG LAE  +VFDTT EDN VF
Sbjct:     1 MGDAIDLSGDGGVLKKIVRSAKPDAISPSDDLPVVDVHYEGILAEDEKVFDTTREDNLVF 60

Query:    61 SFELGKGSVIRAWDIALRSMKV 82
             SFELG GSVIR+WDIAL++MKV
Sbjct:    61 SFELGTGSVIRSWDIALKTMKV 82
GO:0000413 "protein peptidyl-prolyl isomerization" evidence=IBA
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS;IBA
GO:0005528 "FK506 binding" evidence=ISS;IBA
GO:0006457 "protein folding" evidence=IEA
GO:0009543 "chloroplast thylakoid lumen" evidence=ISS
GO:0016020 "membrane" evidence=IBA
GO:0018208 "peptidyl-proline modification" evidence=IBA
UNIPROTKB|Q65XG1 OJ1362_D02.6 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q5N9W0 P0406G08.35 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|F1SK86 FKBP4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q02790 FKBP4 "Peptidyl-prolyl cis-trans isomerase FKBP4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P27124 FKBP4 "Peptidyl-prolyl cis-trans isomerase FKBP4" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
UNIPROTKB|E2QWF5 FKBP4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|628729 Fkbp4 "FK506 binding protein 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NIM4 FKBP4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NP08 FKBP4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M2S7FK201_ARATH5, ., 2, ., 1, ., 80.69750.80270.9210yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.691
4th Layer5.2.1.8LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 8e-26
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 5e-21
PRK11570206 PRK11570, PRK11570, peptidyl-prolyl cis-trans isom 2e-04
PRK10902269 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- 8e-04
COG1047174 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans 9e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.004
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information 
 Score = 95.8 bits (239), Expect = 8e-26
 Identities = 45/115 (39%), Positives = 52/115 (45%), Gaps = 32/115 (27%)

Query: 35  VDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVKLCSVDLFSVCS 94
           V VHY G L E G VFD++ +    F F LG G VI  WD  L  MK             
Sbjct: 11  VTVHYTGKL-EDGTVFDSSKDRGKPFEFTLGSGQVIPGWDEGLLGMK------------- 56

Query: 95  LWGAKFLLLILFSSFYQVGEVAKLTCKPEYAYGSAGS-PPDVPPDATLIFEVELV 148
                            VGE  KLT  PE AYG  G     +PP+ATL+FEVEL+
Sbjct: 57  -----------------VGEKRKLTIPPELAYGEEGLAGGVIPPNATLVFEVELL 94

Length = 94
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|183207 PRK11570, PRK11570, peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 218
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.94
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.94
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.92
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.9
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.89
KOG0552226 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.86
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.85
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.82
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.8
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.58
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.38
TIGR00115408 tig trigger factor. Trigger factor is a ribosome-a 99.37
PRK10737196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.35
PRK01490 435 tig trigger factor; Provisional 99.33
COG0544 441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 99.26
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.06
KOG0545 329 consensus Aryl-hydrocarbon receptor-interacting pr 98.12
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.24
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.94  E-value=1.2e-26  Score=200.41  Aligned_cols=108  Identities=43%  Similarity=0.718  Sum_probs=101.3

Q ss_pred             cCCCCEEEEEEEcCCCCCCCCCCCCCEEEEEEEEEEcCCCcEeeccccCCceEEEEeCCCccchhHHHHHhccccccccc
Q 027810            8 TGDEGVIKKIVRQAKPDALSPTEDLPLVDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVKLCSV   87 (218)
Q Consensus         8 t~d~gv~~kil~~G~g~~~~p~~~gd~V~V~Y~g~l~~dG~~fd~t~~~~~~~~f~lG~g~vIpg~e~aL~~mk~~~~~~   87 (218)
                      +.++||+|++++.|+|..  |+. +++|.|||+|.+. ||++||++++++.|+.|.+|  .||+||.++|.+|++     
T Consensus        98 ~~~sgl~y~~~~~G~G~~--~~~-~~~V~vhY~G~l~-~G~vFDsS~~rg~p~~f~l~--~vI~Gw~egl~~M~v-----  166 (205)
T COG0545          98 TLPSGLQYKVLKAGDGAA--PKK-GDTVTVHYTGTLI-DGTVFDSSYDRGQPAEFPLG--GVIPGWDEGLQGMKV-----  166 (205)
T ss_pred             ECCCCcEEEEEeccCCCC--CCC-CCEEEEEEEEecC-CCCccccccccCCCceeecC--CeeehHHHHHhhCCC-----
Confidence            467899999999999974  555 5999999999997 99999999999999999999  999999999999999     


Q ss_pred             cccceeeccchhhhhhhhhccccccCCEEEEEecCCCccCCCCCCCCCCCCCcEEEEEEEeeee
Q 027810           88 DLFSVCSLWGAKFLLLILFSSFYQVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELVACR  151 (218)
Q Consensus        88 ~~~~~~~~~~~~~~~~~~~~~~~~~Ge~~~l~iP~~~aYg~~g~~~~IP~~s~LiFeVeLl~i~  151 (218)
                                               |++++|+|||++|||..+.+..||||++|+|+|||++|.
T Consensus       167 -------------------------G~k~~l~IP~~laYG~~g~~g~Ippns~LvFeVeLl~v~  205 (205)
T COG0545         167 -------------------------GGKRKLTIPPELAYGERGVPGVIPPNSTLVFEVELLDVK  205 (205)
T ss_pred             -------------------------CceEEEEeCchhccCcCCCCCCCCCCCeEEEEEEEEecC
Confidence                                     999999999999999999887899999999999999874

>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
4drj_A144 O-crystal Structure Of The Ppiase Domain Of Fkbp52, 1e-22
1n1a_A140 Crystal Structure Of The N-Terminal Domain Of Human 1e-22
1q1c_A280 Crystal Structure Of N(1-260) Of Human Fkbp52 Lengt 2e-22
1rot_A149 Structure Of Fkbp59-I, The N-Terminal Domain Of A 5 1e-21
1kt0_A 457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 5e-21
3o5e_A144 Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 1e-20
4drh_A144 Co-crystal Structure Of The Ppiase Domain Of Fkbp51 2e-20
3o5g_A128 Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 2e-20
3o5l_A128 Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Le 2e-20
3o5d_A264 Crystal Structure Of A Fragment Of Fkbp51 Comprisin 2e-20
1kt1_A 457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 3e-20
1r9h_A135 Structural Genomics Of C.Elegans: Fkbp-Type Peptidy 3e-17
2ki3_A126 Structural And Biochemical Characterization Of Fk50 7e-17
3uqi_A108 Crystallographic Structure Of Fkbp12 From Aedes Aeg 4e-15
3jxv_A 356 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 4e-14
3jym_A 377 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 5e-14
2vn1_A129 Crystal Structure Of The Fk506-Binding Domain Of Pl 6e-14
2ofn_A135 Solution Structure Of Fk506-Binding Domain (Fkbd)of 6e-14
1fkk_A107 Atomic Structure Of Fkbp12, An Immunophilin Binding 1e-13
3h9r_B109 Crystal Structure Of The Kinase Domain Of Type I Ac 2e-13
2fap_A107 The Structure Of The Immunophilin-Immunosuppressant 3e-13
1fkb_A107 Atomic Structure Of The Rapamycin Human Immunophili 3e-13
1tco_C107 Ternary Complex Of A Calcineurin A Fragment, Calcin 3e-13
1bkf_A107 Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX 3e-13
2ppp_A107 Crystal Structure Of E60q Mutant Of Fkbp12 Length = 3e-13
3b7x_A134 Crystal Structure Of Human Fk506-Binding Protein 6 5e-13
2ppo_A107 Crystal Structure Of E60a Mutant Of Fkbp12 Length = 6e-13
1eym_A107 Fk506 Binding Protein Mutant, Homodimeric Complex L 1e-12
1bl4_A107 Fkbp Mutant F36v Complexed With Remodeled Synthetic 2e-12
4dz3_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 2e-12
2y78_A133 Crystal Structure Of Bpss1823, A Mip-Like Chaperone 2e-12
3uf8_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 3e-12
2ke0_A117 Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso 3e-12
2dg4_A107 Fk506-Binding Protein Mutant Wf59 Complexed With Ra 3e-12
3vaw_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 3e-12
4ggq_C209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 3e-12
3uqa_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 5e-12
2dg9_A107 Fk506-Binding Protein Mutant Wl59 Complexed With Ra 6e-12
1c9h_A107 Crystal Structure Of Fkbp12.6 In Complex With Rapam 9e-12
3uqb_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-11
2lgo_A130 Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol 2e-11
1yat_A113 Improved Calcineurin Inhibition By Yeast Fkbp12-Dru 4e-11
2pbc_A102 Fk506-Binding Protein 2 Length = 102 1e-10
1pbk_A116 Homologous Domain Of Human Fkbp25 Length = 116 3e-09
3kz7_A119 C-Terminal Domain Of Murine Fkbp25 Rapamycin Comple 3e-09
4dz2_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 5e-09
4dip_A125 Crystal Structure Of Human Peptidyl-Prolyl Cis-Tran 6e-08
1u79_A129 Crystal Structure Of Atfkbp13 Length = 129 5e-05
1q6u_A245 Crystal Structure Of Fkpa From Escherichia Coli Len 2e-04
>pdb|4DRJ|A Chain A, O-crystal Structure Of The Ppiase Domain Of Fkbp52, Rapamycin And The Frb Fragment Of Mtor Length = 144 Back     alignment and structure 
Iteration: 1

 Score =  102 bits (255), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 62/138 (44%), Positives = 77/138 (55%), Gaps = 33/138 (23%)
Query: 10  DEGVIKKIVRQAKPDALSPTEDLPLVDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSV 69
           DEGV+K I R+     +    D   V VHY G L + G  FD++ +    FSF+LGKG V
Sbjct: 34  DEGVLKVIKREGTGTEMPMIGDR--VFVHYTGWLLD-GTKFDSSLDRKDKFSFDLGKGEV 90
Query: 70  IRAWDIALRSMKVKLCSVDLFSVCSLWGAKFLLLILFSSFYQVGEVAKLTCKPEYAYGSA 129
           I+AWDIA+ +MKV                              GEV  +TCKPEYAYGSA
Sbjct: 91  IKAWDIAIATMKV------------------------------GEVCHITCKPEYAYGSA 120
Query: 130 GSPPDVPPDATLIFEVEL 147
           GSPP +PP+ATL+FEVEL
Sbjct: 121 GSPPKIPPNATLVFEVEL 138
>pdb|1N1A|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Fkbp52 Length = 140 Back     alignment and structure
>pdb|1Q1C|A Chain A, Crystal Structure Of N(1-260) Of Human Fkbp52 Length = 280 Back     alignment and structure
>pdb|1ROT|A Chain A, Structure Of Fkbp59-I, The N-Terminal Domain Of A 59 Kda Fk506-Binding Protein, Nmr, Minimized Average Structure Length = 149 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|3O5E|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 Back     alignment and structure
>pdb|4DRH|A Chain A, Co-crystal Structure Of The Ppiase Domain Of Fkbp51, Rapamycin And The Frb Fragment Of Mtor At Low Ph Length = 144 Back     alignment and structure
>pdb|3O5G|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|3O5L|A Chain A, Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|3O5D|A Chain A, Crystal Structure Of A Fragment Of Fkbp51 Comprising The Fk1 And Fk2 Domains Length = 264 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1R9H|A Chain A, Structural Genomics Of C.Elegans: Fkbp-Type Peptidylprolyl Isomerase Length = 135 Back     alignment and structure
>pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 Back     alignment and structure
>pdb|3UQI|A Chain A, Crystallographic Structure Of Fkbp12 From Aedes Aegypti Length = 108 Back     alignment and structure
>pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 Back     alignment and structure
>pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 377 Back     alignment and structure
>pdb|2VN1|A Chain A, Crystal Structure Of The Fk506-Binding Domain Of Plasmodium Falciparum Fkbp35 In Complex With Fk506 Length = 129 Back     alignment and structure
>pdb|2OFN|A Chain A, Solution Structure Of Fk506-Binding Domain (Fkbd)of Fkbp35 From Plasmodium Falciparum Length = 135 Back     alignment and structure
>pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 Back     alignment and structure
>pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 Back     alignment and structure
>pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 Back     alignment and structure
>pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 Back     alignment and structure
>pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 Back     alignment and structure
>pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 Back     alignment and structure
>pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|3B7X|A Chain A, Crystal Structure Of Human Fk506-Binding Protein 6 Length = 134 Back     alignment and structure
>pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 Back     alignment and structure
>pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 Back     alignment and structure
>pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 Back     alignment and structure
>pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 Back     alignment and structure
>pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 Back     alignment and structure
>pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 Back     alignment and structure
>pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 Back     alignment and structure
>pdb|1YAT|A Chain A, Improved Calcineurin Inhibition By Yeast Fkbp12-Drug Complexes. Crystallographic And Functional Analysis Length = 113 Back     alignment and structure
>pdb|2PBC|A Chain A, Fk506-Binding Protein 2 Length = 102 Back     alignment and structure
>pdb|1PBK|A Chain A, Homologous Domain Of Human Fkbp25 Length = 116 Back     alignment and structure
>pdb|3KZ7|A Chain A, C-Terminal Domain Of Murine Fkbp25 Rapamycin Complex Length = 119 Back     alignment and structure
>pdb|4DZ2|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation R92g From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|4DIP|A Chain A, Crystal Structure Of Human Peptidyl-Prolyl Cis-Trans Isomerase Fkbp14 Length = 125 Back     alignment and structure
>pdb|1U79|A Chain A, Crystal Structure Of Atfkbp13 Length = 129 Back     alignment and structure
>pdb|1Q6U|A Chain A, Crystal Structure Of Fkpa From Escherichia Coli Length = 245 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 1e-43
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 7e-40
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 1e-39
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 1e-38
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 7e-37
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 2e-36
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 3e-35
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 1e-34
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 7e-23
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 5e-34
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 5e-34
2ppn_A107 FK506-binding protein 1A; high resolution protein 4e-33
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 4e-33
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 9e-26
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 4e-22
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 5e-33
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 9e-32
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 2e-30
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 8e-30
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 2e-28
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 4e-27
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 1e-26
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 7e-15
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 1e-26
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 9e-24
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 2e-22
1jvw_A167 Macrophage infectivity potentiator; chagas disease 6e-19
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 3e-18
1fd9_A213 Protein (macrophage infectivity potentiator prote; 4e-17
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 5e-17
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 3e-16
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 2e-06
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 4e-05
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 8e-05
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 9e-05
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 3e-04
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
 Score =  141 bits (358), Expect = 1e-43
 Identities = 43/153 (28%), Positives = 69/153 (45%), Gaps = 30/153 (19%)

Query: 2   GDSIDLTGDEGVIKKIVRQAKPDALSPTEDLPLVDVHYEGSLAETGEVFDTTHEDNTVFS 61
            + ++LT D GVIK I+++      +  +    V VHY G L  TG+VFD++ + N  F 
Sbjct: 7   FEKVELTADGGVIKTILKKGDEGEENIPKKGNEVTVHYVGKLESTGKVFDSSFDRNVPFK 66

Query: 62  FELGKGSVIRAWDIALRSMKVKLCSVDLFSVCSLWGAKFLLLILFSSFYQVGEVAKLTCK 121
           F L +G VI+ WDI + SM+                                E   +  +
Sbjct: 67  FHLEQGEVIKGWDICVSSMR------------------------------KNEKCLVRIE 96

Query: 122 PEYAYGSAGSPPDVPPDATLIFEVELVACRPRK 154
             Y YG  G    +P ++ L+FE+EL++ R  +
Sbjct: 97  SMYGYGDEGCGESIPGNSVLLFEIELLSFRELE 129
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Length = 151 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.95
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.94
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.94
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.94
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.94
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.93
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.93
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.93
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.93
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.93
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.93
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.93
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 99.92
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.92
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.92
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.92
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.92
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.91
1fd9_A213 Protein (macrophage infectivity potentiator prote; 99.91
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 99.9
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.9
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.9
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 99.89
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.89
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.88
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.87
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.85
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.84
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.83
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.75
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.68
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 99.64
1w26_A 432 Trigger factor, TF; chaperone, protein folding, ri 99.63
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 99.62
3prb_A231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 99.6
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.6
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 99.6
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.56
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.49
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 99.48
1t11_A392 Trigger factor, TF; helix-turn-helix, four-helix-b 99.47
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 99.37
3gty_X 433 Trigger factor, TF; chaperone-client complex, cell 98.89
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
Probab=99.95  E-value=4.1e-27  Score=187.21  Aligned_cols=120  Identities=45%  Similarity=0.834  Sum_probs=108.1

Q ss_pred             CCccccc--CCCCEEEEEEEcCCCCCCCCCCCCCEEEEEEEEEEcCCCcEeeccccCCceEEEEeCCCccchhHHHHHhc
Q 027810            2 GDSIDLT--GDEGVIKKIVRQAKPDALSPTEDLPLVDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRS   79 (218)
Q Consensus         2 ~~~~d~t--~d~gv~~kil~~G~g~~~~p~~~gd~V~V~Y~g~l~~dG~~fd~t~~~~~~~~f~lG~g~vIpg~e~aL~~   79 (218)
                      ++|+|++  .++||+|+++++|+|. ..|. .||.|.|||++++. ||++||+++.+..+++|.+|.+++|+||++||.+
T Consensus         3 ~~~~dv~~~~~~gl~~~~l~~G~g~-~~~~-~gd~V~v~Y~g~~~-dG~~fdss~~~~~p~~f~lG~~~vi~G~e~~l~g   79 (135)
T 1r9h_A            3 GEKIDITPKKDGGVLKLIKKEGQGV-VKPT-TGTTVKVHYVGTLE-NGTKFDSSRDRGDQFSFNLGRGNVIKGWDLGVAT   79 (135)
T ss_dssp             --CEECSTTCCSSEEEEEEECCBSS-CCCC-TTCEEEEEEEEEET-TSCEEEEHHHHTSCEEEETTTTSSCHHHHHHHTT
T ss_pred             ccceecccCCCCcEEEEEEEccCCC-cCCC-CCCEEEEEEEEEEC-CCCEEEecCcCCCCEEEEeCCCCccHHHHHHHhc
Confidence            6789999  9999999999999986 2344 46999999999996 8999999976678999999999999999999999


Q ss_pred             cccccccccccceeeccchhhhhhhhhccccccCCEEEEEecCCCccCCCCCCCCCCCCCcEEEEEEEeeeecCC
Q 027810           80 MKVKLCSVDLFSVCSLWGAKFLLLILFSSFYQVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELVACRPRK  154 (218)
Q Consensus        80 mk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ge~~~l~iP~~~aYg~~g~~~~IP~~s~LiFeVeLl~i~~~~  154 (218)
                      |++                              |+++.|+|||+++||+.+.++.||++++|+|+|+|++++..+
T Consensus        80 m~~------------------------------Ge~~~v~ip~~~aYG~~g~~~~Ip~~~~l~f~v~l~~i~~~~  124 (135)
T 1r9h_A           80 MTK------------------------------GEVAEFTIRSDYGYGDAGSPPKIPGGATLIFEVELFEWSAED  124 (135)
T ss_dssp             CCB------------------------------TCEEEEEECGGGTTTTTCBTTTBCTTCCEEEEEEEEEEEC--
T ss_pred             CCC------------------------------CCEEEEEEChHHcCCCCCCCCCcCcCCcEEEEEEEEEeecCC
Confidence            999                              999999999999999999988999999999999999998763
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 218
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 4e-21
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 8e-19
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 6e-18
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 5e-16
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 6e-14
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 1e-13
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 2e-13
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 2e-12
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 3e-12
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 1e-11
d1jvwa_160 d.26.1.1 (A:) Macrophage infectivity potentiator p 3e-11
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 5e-11
d1hxva_85 d.26.1.1 (A:) Trigger factor PPIase domain {Mycopl 2e-07
d1ix5a_151 d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu 5e-05
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKB-6, N-terminal domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 82.4 bits (203), Expect = 4e-21
 Identities = 52/146 (35%), Positives = 70/146 (47%), Gaps = 35/146 (23%)

Query: 5   IDLT--GDEGVIKKIVRQAKPDALSPTEDLPLVDVHYEGSLAETGEVFDTTHEDNTVFSF 62
           ID+T   D GV+K I ++ +      T     V VHY G+L E G  FD++ +    FSF
Sbjct: 2   IDITPKKDGGVLKLIKKEGQGVVKPTTGTT--VKVHYVGTL-ENGTKFDSSRDRGDQFSF 58

Query: 63  ELGKGSVIRAWDIALRSMKVKLCSVDLFSVCSLWGAKFLLLILFSSFYQVGEVAKLTCKP 122
            LG+G+VI+ WD+                                +    GEVA+ T + 
Sbjct: 59  NLGRGNVIKGWDL------------------------------GVATMTKGEVAEFTIRS 88

Query: 123 EYAYGSAGSPPDVPPDATLIFEVELV 148
           +Y YG AGSPP +P  ATLIFEVEL 
Sbjct: 89  DYGYGDAGSPPKIPGGATLIFEVELF 114
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.96
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.95
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.94
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.94
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.94
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.93
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.93
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.92
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.92
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.91
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.89
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 99.6
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.58
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 99.32
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 99.21
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKBP52, N-terminal domains
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.96  E-value=5.3e-29  Score=193.96  Aligned_cols=117  Identities=54%  Similarity=0.924  Sum_probs=109.4

Q ss_pred             Cccccc--CCCCEEEEEEEcCCCCCCCCCCCCCEEEEEEEEEEcCCCcEeeccccCCceEEEEeCCCccchhHHHHHhcc
Q 027810            3 DSIDLT--GDEGVIKKIVRQAKPDALSPTEDLPLVDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSM   80 (218)
Q Consensus         3 ~~~d~t--~d~gv~~kil~~G~g~~~~p~~~gd~V~V~Y~g~l~~dG~~fd~t~~~~~~~~f~lG~g~vIpg~e~aL~~m   80 (218)
                      +++|+|  +|+||+|+|+++|+|. ..|.. ||.|.|||++++. ||++||+|+....|+.|.+|.+.+|+||+++|.+|
T Consensus         1 ~~~d~t~~~d~gv~~~i~~~G~G~-~~P~~-gd~V~v~y~~~l~-dG~~fdss~~~~~p~~f~~g~~~~i~G~~~~l~~M   77 (120)
T d1q1ca1           1 EGVDISPKQDEGVLKVIKREGTGT-EMPMI-GDRVFVHYTGWLL-DGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATM   77 (120)
T ss_dssp             CCEECCSSCSSSEEEEEEECCSSS-CCCCT-TCEEEEEEEEEET-TSCEEEESTTSSSCEEEETTTTSSCHHHHHHHTTC
T ss_pred             CceeccCCCCCCEEEEEEEcccCC-cCCCC-CCEEEEEEEEEEc-CCCEEEeccccccceeeecCCCceeeeeeeeeccc
Confidence            578999  5999999999999986 45765 5999999999997 99999999998899999999999999999999999


Q ss_pred             ccccccccccceeeccchhhhhhhhhccccccCCEEEEEecCCCccCCCCCCCCCCCCCcEEEEEEEeeeec
Q 027810           81 KVKLCSVDLFSVCSLWGAKFLLLILFSSFYQVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELVACRP  152 (218)
Q Consensus        81 k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ge~~~l~iP~~~aYg~~g~~~~IP~~s~LiFeVeLl~i~~  152 (218)
                      +.                              |++++|+|||+++||+.+.++.|||+++|+|+|||++|+.
T Consensus        78 ~~------------------------------Ge~~~~~ip~~laYG~~g~~~~IPp~s~LifeIeLl~v~~  119 (120)
T d1q1ca1          78 KV------------------------------GEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKG  119 (120)
T ss_dssp             CT------------------------------TCEEEEEECGGGTTTTTCBTTTBCTTCCEEEEEEEEEEEC
T ss_pred             cC------------------------------CcEEEEEECHHHhCCCcCCCCCCCcCCcEEEEEEEEEEeC
Confidence            99                              9999999999999999999889999999999999999975
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure