Citrus Sinensis ID: 027870

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------

MVLEVSCYYTESSFAQSESSVTFLISKVKFEFNQAWFMDESSQDQRLPHHLNPKQFVSLDQLAELGVLYWRLNPKNYENDEELQKIREARGYSYMDLLDLCPEKVTNYEEKLKNFYTEHIHADEEIRYCLEGSGYFDVRDESDQWIRIWIKAGDLIVLPAGIYHRFTLDTSNYVKLMRLFVGEPVWTAYNRPQEDHPARKEYIKGLTGQAGVPVEAH

cEEEEEEEEEEcccccccccEEEccccccccEEEEEEEccccccccccccccccccccHHHHHHcccEEEEEcccccccHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHHccccccEEEEEEEcEEEEEEEEcccEEEEEEEEcccEEEccccccEEEEEcccccEEEEEEEcccccEEEEcccccccHHHHHHHHHHHHccccccccc

cEEEEEEEEcccccccccccHHHHHccccHHHHHEEEcccccccccccccccccccccHHHHHHcccEEEEEccccccccHHHHHHHHHccccccEEEEEcHHHcccHHHHHHHHHHHHHcccHHHHEEEccccEEEEccccccEEEEEEEcccEEEEccccEEEEEcccccHHEEHHHcccccEEccccccccccHHHHHHHHHHHHHccccEccc

MVLEVScyytessfaqseSSVTFLISKVKFefnqawfmdessqdqrlphhlnpkqfvsLDQLAELGVLYwrlnpknyendEELQKIREARGYSYMDLLDLCPEKVTNYEEKLKNFYTEHIHADEEIRYCLegsgyfdvrdeSDQWIRIWIKAgdlivlpagiyhrftldtsNYVKLMRLFvgepvwtaynrpqedhparKEYIkgltgqagvpveah

MVLEVScyytessfaqsesSVTFLISKVKFEFNQAWFMDESSQDQRLPHHLNPKQFVSLDQLAELGVLYWRlnpknyendeELQKIREARGYSYMDLLDLCPEKVTNYEEKLKNFYTEHIHADEEIRYCLEGSGYFDVRDESDQWIRIWIKAGDLIVLPAGIYHRFTLDTSNYVKLMRLFVGEPVWTAYNRPQEDHPARKEYIkgltgqagvpveah

****VSCYYTESSFAQSESSVTFLISKVKFEFNQAWFMD***********LNPKQFVSLDQLAELGVLYWRLNPKNYENDEELQKIREARGYSYMDLLDLCPEKVTNYEEKLKNFYTEHIHADEEIRYCLEGSGYFDVRDESDQWIRIWIKAGDLIVLPAGIYHRFTLDTSNYVKLMRLFVGEPVWTAYN***************************

*VLEVSCYYTESSF***************FEFNQAWFMDESSQDQRLPHHLNPKQFVSLDQLAELGVLYWRLNPKNYENDEELQKIREARGYSYMDLLDLCPEKVTNYEEKLKNFYTEHIHADEEIRYCLEGSGYFDVRDESDQWIRIWIKAGDLIVLPAGIYHRFTLDTSNYVKLMRLFVGEPVWTAYNRPQEDHPARKEYIKGLTGQA*******

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		217	2.2.26 [Sep-21-2011]
D7T737		188	1,2-dihydroxy-3-keto-5-me	yes	no	0.847	0.978	0.826	1e-91
Q8H185		187	1,2-dihydroxy-3-keto-5-me	yes	no	0.847	0.983	0.798	2e-87
F6HDT7		199	1,2-dihydroxy-3-keto-5-me	no	no	0.797	0.869	0.705	6e-76
Q10RE5		198	1,2-dihydroxy-3-keto-5-me	yes	no	0.866	0.949	0.666	5e-75
A2XCT8		198	1,2-dihydroxy-3-keto-5-me	N/A	no	0.866	0.949	0.666	5e-75
C5X1F5		180	1,2-dihydroxy-3-keto-5-me	N/A	no	0.824	0.994	0.698	9e-75
Q8W108		199	1,2-dihydroxy-3-keto-5-me	no	no	0.838	0.914	0.663	3e-73
C5WWY0		181	1,2-dihydroxy-3-keto-5-me	N/A	no	0.801	0.961	0.689	5e-73
A1L4T4		199	1,2-dihydroxy-3-keto-5-me	no	no	0.843	0.919	0.661	5e-73
A2Z7C4		199	1,2-dihydroxy-3-keto-5-me	N/A	no	0.843	0.919	0.661	5e-73

>sp\|D7T737\|MTND1_VITVI 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 1 OS=Vitis vinifera GN=VIT_05s0020g04070 PE=3 SV=1	Back alignment and function desciption

 Score =  335 bits (860), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 152/184 (82%), Positives = 170/184 (92%)

Query: 34  QAWFMDESSQDQRLPHHLNPKQFVSLDQLAELGVLYWRLNPKNYENDEELQKIREARGYS 93
           QAWFM+E+ +DQRLPHH NPKQFVSLD LA+LGVLYW+LNPK+YEND+EL++IRE+RGY+
Sbjct: 5   QAWFMEENDEDQRLPHHRNPKQFVSLDHLADLGVLYWKLNPKDYENDQELKEIRESRGYN 64

Query: 94  YMDLLDLCPEKVTNYEEKLKNFYTEHIHADEEIRYCLEGSGYFDVRDESDQWIRIWIKAG 153
           YMDLLDLCPE+V NYEEKLKNFYTEHIH DEEIRYCLEGSGYFDVRD+ D+WIRIWIK G
Sbjct: 65  YMDLLDLCPERVENYEEKLKNFYTEHIHGDEEIRYCLEGSGYFDVRDKEDRWIRIWIKEG 124

Query: 154 DLIVLPAGIYHRFTLDTSNYVKLMRLFVGEPVWTAYNRPQEDHPARKEYIKGLTGQAGVP 213
           D+IVLPAGIYHRFTLDT NYVKLMRLFVGEPVWTAYNRPQE HPARK YI  +T + GVP
Sbjct: 125 DMIVLPAGIYHRFTLDTGNYVKLMRLFVGEPVWTAYNRPQEHHPARKNYINNVTHKVGVP 184

Query: 214 VEAH 217
           +EAH
Sbjct: 185 LEAH 188

Catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).
Vitis vinifera (taxid: 29760)
EC: 1EC: .EC: 1EC: 3EC: .EC: 1EC: 1EC: .EC: 5EC: 4

>sp\|Q8H185\|MTND4_ARATH 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 4 OS=Arabidopsis thaliana GN=ARD4 PE=2 SV=1	Back alignment and function description

>sp\|F6HDT7\|MTND2_VITVI 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2 OS=Vitis vinifera GN=VIT_05s0020g04080 PE=3 SV=1	Back alignment and function description

>sp\|Q10RE5\|MTND2_ORYSJ 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2 OS=Oryza sativa subsp. japonica GN=ARD2 PE=2 SV=1	Back alignment and function description

>sp\|A2XCT8\|MTND2_ORYSI 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2 OS=Oryza sativa subsp. indica GN=ARD2 PE=2 SV=2	Back alignment and function description

>sp\|C5X1F5\|MTND1_SORBI 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 1 OS=Sorghum bicolor GN=Sb01g021500 PE=3 SV=2	Back alignment and function description

>sp\|Q8W108\|MTND3_ARATH 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 3 OS=Arabidopsis thaliana GN=ARD3 PE=2 SV=1	Back alignment and function description

>sp\|C5WWY0\|MTND2_SORBI 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase homolog 2 OS=Sorghum bicolor GN=Sb01g046360 PE=3 SV=1	Back alignment and function description

>sp\|A1L4T4\|MTND1_ORYSJ 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 1 OS=Oryza sativa subsp. japonica GN=ARD1 PE=2 SV=1	Back alignment and function description

>sp\|A2Z7C4\|MTND1_ORYSI 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 1 OS=Oryza sativa subsp. indica GN=ARD1 PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		217
363805407		188	RecName: Full=1,2-dihydroxy-3-keto-5-met	0.847	0.978	0.826	6e-90
388509288		187	unknown [Lotus japonicus]	0.847	0.983	0.820	6e-89
388513165		187	unknown [Medicago truncatula]	0.847	0.983	0.820	4e-88
255552059		187	acireductone dioxygenase, putative [Rici	0.847	0.983	0.820	2e-87
224099839		189	predicted protein [Populus trichocarpa]	0.843	0.968	0.827	4e-87
297791489		187	ATARD4 [Arabidopsis lyrata subsp. lyrata	0.847	0.983	0.793	2e-86
10177955		185	unnamed protein product [Arabidopsis tha	0.847	0.994	0.804	4e-86
351723551		187	uncharacterized protein LOC100500592 [Gl	0.847	0.983	0.815	6e-86
18422379		187	1,2-dihydroxy-3-keto-5-methylthiopentene	0.847	0.983	0.798	8e-86
359477561		373	PREDICTED: 1,2-dihydroxy-3-keto-5-methyl	0.801	0.466	0.833	2e-85

>gi\|363805407\|sp\|D7T737.1\|MTND1_VITVI RecName: Full=1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 1; AltName: Full=Acireductone dioxygenase (Fe(2+)-requiring) 1; Short=ARD 1; Short=Fe-ARD 1 gi\|297737107\|emb\|CBI26308.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  335 bits (860), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 152/184 (82%), Positives = 170/184 (92%)

Query: 34  QAWFMDESSQDQRLPHHLNPKQFVSLDQLAELGVLYWRLNPKNYENDEELQKIREARGYS 93
           QAWFM+E+ +DQRLPHH NPKQFVSLD LA+LGVLYW+LNPK+YEND+EL++IRE+RGY+
Sbjct: 5   QAWFMEENDEDQRLPHHRNPKQFVSLDHLADLGVLYWKLNPKDYENDQELKEIRESRGYN 64

Query: 94  YMDLLDLCPEKVTNYEEKLKNFYTEHIHADEEIRYCLEGSGYFDVRDESDQWIRIWIKAG 153
           YMDLLDLCPE+V NYEEKLKNFYTEHIH DEEIRYCLEGSGYFDVRD+ D+WIRIWIK G
Sbjct: 65  YMDLLDLCPERVENYEEKLKNFYTEHIHGDEEIRYCLEGSGYFDVRDKEDRWIRIWIKEG 124

Query: 154 DLIVLPAGIYHRFTLDTSNYVKLMRLFVGEPVWTAYNRPQEDHPARKEYIKGLTGQAGVP 213
           D+IVLPAGIYHRFTLDT NYVKLMRLFVGEPVWTAYNRPQE HPARK YI  +T + GVP
Sbjct: 125 DMIVLPAGIYHRFTLDTGNYVKLMRLFVGEPVWTAYNRPQEHHPARKNYINNVTHKVGVP 184

Query: 214 VEAH 217
           +EAH
Sbjct: 185 LEAH 188

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|388509288\|gb\|AFK42710.1\| unknown [Lotus japonicus]	Back alignment and taxonomy information

>gi\|388513165\|gb\|AFK44644.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

>gi\|255552059\|ref\|XP_002517074.1\| acireductone dioxygenase, putative [Ricinus communis] gi\|223543709\|gb\|EEF45237.1\| acireductone dioxygenase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224099839\|ref\|XP_002311640.1\| predicted protein [Populus trichocarpa] gi\|222851460\|gb\|EEE89007.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|297791489\|ref\|XP_002863629.1\| ATARD4 [Arabidopsis lyrata subsp. lyrata] gi\|297309464\|gb\|EFH39888.1\| ATARD4 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|10177955\|dbj\|BAB11314.1\| unnamed protein product [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|351723551\|ref\|NP_001236515.1\| uncharacterized protein LOC100500592 [Glycine max] gi\|255630714\|gb\|ACU15718.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi|18422379|ref|NP_568630.1| 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 4 [Arabidopsis thaliana] gi|75244604|sp|Q8H185.1|MTND4_ARATH RecName: Full=1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 4; AltName: Full=Acireductone dioxygenase (Fe(2+)-requiring) 4; Short=ARD 4; Short=Fe-ARD 4 gi|23306364|gb|AAN17409.1| putative protein [Arabidopsis thaliana] gi|30102912|gb|AAP21374.1| At5g43850 [Arabidopsis thaliana] gi|332007634|gb|AED95017.1| 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 4 [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|359477561\|ref\|XP_003631995.1\| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 3 [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		217
TAIR\|locus:2170842		187	ARD4 [Arabidopsis thaliana (ta	0.847	0.983	0.798	3.1e-83
TAIR\|locus:2066321		199	ARD3 "acireductone dioxygenase	0.801	0.874	0.695	1.3e-68
TAIR\|locus:505006465		192	ARD1 "acireductone dioxygenase	0.797	0.901	0.682	3.5e-68
UNIPROTKB\|Q5ZL43		180	ADI1 "1,2-dihydroxy-3-keto-5-m	0.815	0.983	0.638	6.2e-62
UNIPROTKB\|I3LEI8		179	ADI1 "Uncharacterized protein"	0.797	0.966	0.635	2.7e-61
RGD\|727828		179	Adi1 "acireductone dioxygenase	0.815	0.988	0.621	7.1e-61
ZFIN\|ZDB-GENE-030131-2799		204	adi1 "acireductone dioxygenase	0.778	0.828	0.652	1.9e-60
MGI\|MGI:2144929		179	Adi1 "acireductone dioxygenase	0.815	0.988	0.627	2.4e-60
UNIPROTKB\|Q9BV57		179	ADI1 "1,2-dihydroxy-3-keto-5-m	0.815	0.988	0.604	1e-59
UNIPROTKB\|Q3ZBL1		179	ADI1 "1,2-dihydroxy-3-keto-5-m	0.815	0.988	0.593	2.5e-58

TAIR\|locus:2170842 ARD4 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 834 (298.6 bits), Expect = 3.1e-83, P = 3.1e-83
 Identities = 147/184 (79%), Positives = 165/184 (89%)

Query:    34 QAWFMDESSQDQRLPHHLNPKQFVSLDQLAELGVLYWRLNPKNYENDEELQKIREARGYS 93
             +AWFMD+S++DQRLPHH NPK+ VSLD LAELGVLYW+LNP+NYEND EL KIRE RGY 
Sbjct:     4 EAWFMDDSNEDQRLPHHRNPKELVSLDYLAELGVLYWKLNPENYENDSELSKIREDRGYD 63

Query:    94 YMDLLDLCPEKVTNYEEKLKNFYTEHIHADEEIRYCLEGSGYFDVRDESDQWIRIWIKAG 153
             YMDLLDLCPEKV+NYEEKLKNF+TEHIH DEEIRYCL GSGYFDVRD+ D+WIRIW++ G
Sbjct:    64 YMDLLDLCPEKVSNYEEKLKNFFTEHIHKDEEIRYCLAGSGYFDVRDKDDRWIRIWMQPG 123

Query:   154 DLIVLPAGIYHRFTLDTSNYVKLMRLFVGEPVWTAYNRPQEDHPARKEYIKGLTGQAGVP 213
             DLIVLPAGIYHRFTLD SNY+KLMRLFVGEPVWT YNRPQE+HP RK+YI GLT + G  
Sbjct:   124 DLIVLPAGIYHRFTLDASNYIKLMRLFVGEPVWTPYNRPQEEHPVRKKYIHGLTYKFGET 183

Query:   214 VEAH 217
             V+AH
Sbjct:   184 VKAH 187

GO:0005886 "plasma membrane" evidence=ISM

GO:0010309 "acireductone dioxygenase [iron(II)-requiring

GO:0046872 "metal ion binding" evidence=ISS

GO:0055114 "oxidation-reduction process" evidence=IEA

TAIR\|locus:2066321 ARD3 "acireductone dioxygenase 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:505006465 ARD1 "acireductone dioxygenase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5ZL43 ADI1 "1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|I3LEI8 ADI1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

RGD\|727828 Adi1 "acireductone dioxygenase 1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-2799 adi1 "acireductone dioxygenase 1" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

MGI\|MGI:2144929 Adi1 "acireductone dioxygenase 1" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9BV57 ADI1 "1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q3ZBL1 ADI1 "1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q6DIY2	MTND_XENTR	1, ., 1, 3, ., 1, 1, ., 5, 4	0.6034	0.8018	0.9720	yes	no
Q6AWN0	MTND_DROME	1, ., 1, 3, ., 1, 1, ., 5, 4	0.5232	0.7880	0.9193	yes	no
A2XCT8	MTND2_ORYSI	1, ., 1, 3, ., 1, 1, ., 5, 4	0.6666	0.8663	0.9494	N/A	no
Q5ZL43	MTND_CHICK	1, ., 1, 3, ., 1, 1, ., 5, 4	0.6384	0.8156	0.9833	yes	no
C5WWY0	MTND2_SORBI	1, ., 1, 3, ., 1, 1, ., -	0.6896	0.8018	0.9613	N/A	no
D7T737	MTND1_VITVI	1, ., 1, 3, ., 1, 1, ., 5, 4	0.8260	0.8479	0.9787	yes	no
Q8H185	MTND4_ARATH	1, ., 1, 3, ., 1, 1, ., 5, 4	0.7989	0.8479	0.9839	yes	no
Q99JT9	MTND_MOUSE	1, ., 1, 3, ., 1, 1, ., 5, 4	0.6271	0.8156	0.9888	yes	no
Q10RE5	MTND2_ORYSJ	1, ., 1, 3, ., 1, 1, ., 5, 4	0.6666	0.8663	0.9494	yes	no
Q3ZBL1	MTND_BOVIN	1, ., 1, 3, ., 1, 1, ., 5, 4	0.5932	0.8156	0.9888	yes	no
Q3B8C8	MTND_XENLA	1, ., 1, 3, ., 1, 1, ., 5, 4	0.5762	0.8156	0.9888	N/A	no
Q2LZI9	MTND_DROPS	1, ., 1, 3, ., 1, 1, ., 5, 4	0.5260	0.7880	0.9144	yes	no
A2Z7C4	MTND1_ORYSI	1, ., 1, 3, ., 1, 1, ., 5, 4	0.6612	0.8433	0.9195	N/A	no
C3ZAH2	MTND_BRAFL	1, ., 1, 3, ., 1, 1, ., 5, 4	0.6416	0.7880	0.9661	yes	no
Q9BV57	MTND_HUMAN	1, ., 1, 3, ., 1, 1, ., 5, 4	0.6045	0.8156	0.9888	yes	no
A9SCJ6	MTND3_PHYPA	1, ., 1, 3, ., 1, 1, ., 5, 4	0.6497	0.8156	0.8719	N/A	no
Q562C9	MTND_RAT	1, ., 1, 3, ., 1, 1, ., 5, 4	0.6214	0.8156	0.9888	yes	no
C5X1F5	MTND1_SORBI	1, ., 1, 3, ., 1, 1, ., 5, 4	0.6983	0.8248	0.9944	N/A	no
F7FKV1	MTND_MONDO	1, ., 1, 3, ., 1, 1, ., 5, 4	0.5932	0.8156	0.9888	yes	no
Q6PBX5	MTND_DANRE	1, ., 1, 3, ., 1, 1, ., 5, 4	0.6436	0.7972	0.9558	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.13.11.53	LOW CONFIDENCE prediction!
3rd Layer	1.13.11.24	LOW CONFIDENCE prediction!
3rd Layer	1.13.11	LOW CONFIDENCE prediction!
3rd Layer	1.13.11.54	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	estExt_Genewise1_v1.C_LG_VIII2401	hypothetical protein (190 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
	estExt_fgenesh4_pg.C_1070035	hypothetical protein (504 aa)	•	•	•	•		0.973
	estExt_Genewise1_v1.C_LG_VIII0915	hypothetical protein (200 aa)		•	•	•	•	0.903
	AMT7	aminotransferase family protein (EC-2.6.1.5) (407 aa)			•			0.899
	AMT3	aminotransferase family protein (289 aa)			•			0.899
	AMT2	aminotransferase family protein (418 aa)			•			0.899
	AMT6	aminotransferase family protein (417 aa)			•			0.899
	AMT10	SubName- Full=Putative uncharacterized protein; (424 aa)			•			0.899
	AMT9	aminotransferase family protein (419 aa)			•			0.899
	AMT8	aminotransferase family protein (462 aa)			•			0.899
	AMT1	aminotransferase family protein (418 aa)			•			0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		217
pfam03079		157	pfam03079, ARD, ARD/ARD' family	1e-75
COG1791		181	COG1791, COG1791, Uncharacterized conserved protei	1e-38
pfam07883		70	pfam07883, Cupin_2, Cupin domain	3e-08
pfam02311		134	pfam02311, AraC_binding, AraC-like ligand binding	2e-04
COG0662		127	COG0662, {ManC}, Mannose-6-phosphate isomerase [Ca	9e-04
COG1917		131	COG1917, COG1917, Uncharacterized conserved protei	0.001

>gnl\|CDD\|217357 pfam03079, ARD, ARD/ARD' family	Back alignment and domain information

 Score =  224 bits (574), Expect = 1e-75
 Identities = 90/157 (57%), Positives = 116/157 (73%), Gaps = 2/157 (1%)

Query: 34  QAWFMDES-SQDQRLPHHLNPKQFVSLDQLAELGVLYWRLNPKNYENDEELQKIREARGY 92
           QAW MD+S   DQRLPHH  PK+    D+LA+LGVLYW+L+  + E  EEL +IR+ + Y
Sbjct: 1   QAWIMDDSPCGDQRLPHHTFPKEKAETDELAKLGVLYWKLDADDEETAEELLRIRKYKHY 60

Query: 93  SYMDLL-DLCPEKVTNYEEKLKNFYTEHIHADEEIRYCLEGSGYFDVRDESDQWIRIWIK 151
             +D+   +CPE   N++EKLK F+ EH+H DEEIRY +EG+GYFDVRD+ D WIR++++
Sbjct: 61  DDVDIDVTVCPETTPNFDEKLKKFFEEHLHTDEEIRYIVEGTGYFDVRDKDDVWIRVFVE 120

Query: 152 AGDLIVLPAGIYHRFTLDTSNYVKLMRLFVGEPVWTA 188
            GDLI LPAGIYHRFT    NYVK +RLFV +P WTA
Sbjct: 121 KGDLISLPAGIYHRFTTTPDNYVKALRLFVTKPGWTA 157

The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+. ARD and ARD' can be experimentally interconverted by removal of the bound metal ion and reconstitution with the appropriate metal ion. The two enzymes share the same substrate, 1,2-dihydroxy-3-keto-5-(methylthio)pentene, but yield different products. ARD' yields the alpha-keto precursor of methionine (and formate), thus forming part of the ubiquitous methionine salvage pathway that converts 5'-methylthioadenosine (MTA) to methionine. This pathway is responsible for the tight control of the concentration of MTA, which is a powerful inhibitor of polyamine biosynthesis and transmethylation reactions. ARD yields methylthiopropanoate, carbon monoxide and formate, and thus prevents the conversion of MTA to methionine. The role of the ARD catalyzed reaction is unclear: methylthiopropanoate is cytotoxic, and carbon monoxide can activate guanylyl cyclase, leading to increased intracellular cGMP levels. This family also contains other members, whose functions are not well characterized. Length = 157

>gnl\|CDD\|224704 COG1791, COG1791, Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown]	Back alignment and domain information

>gnl\|CDD\|219618 pfam07883, Cupin_2, Cupin domain	Back alignment and domain information

>gnl\|CDD\|145456 pfam02311, AraC_binding, AraC-like ligand binding domain	Back alignment and domain information

>gnl\|CDD\|223734 COG0662, {ManC}, Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|224829 COG1917, COG1917, Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		217
KOG2107		179	consensus Uncharacterized conserved protein, conta	100.0
PF03079		157	ARD: ARD/ARD' family; InterPro: IPR004313 The two	100.0
COG1791		181	Uncharacterized conserved protein, contains double	100.0
PF07883		71	Cupin_2: Cupin domain; InterPro: IPR013096 This fa	99.1
COG1917		131	Uncharacterized conserved protein, contains double	99.04
COG0662		127	{ManC} Mannose-6-phosphate isomerase [Carbohydrate	98.98
PF02311		136	AraC_binding: AraC-like ligand binding domain; Int	98.86
PRK04190		191	glucose-6-phosphate isomerase; Provisional	98.83
smart00835		146	Cupin_1 Cupin. This family represents the conserve	98.81
PF00190		144	Cupin_1: Cupin; InterPro: IPR006045 This family re	98.75
TIGR03404		367	bicupin_oxalic bicupin, oxalate decarboxylase fami	98.7
TIGR03214		260	ura-cupin putative allantoin catabolism protein. T	98.7
PRK09943		185	DNA-binding transcriptional repressor PuuR; Provis	98.61
PRK13290		125	ectC L-ectoine synthase; Reviewed	98.6
TIGR03037		159	anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase	98.57
PRK13264		177	3-hydroxyanthranilate 3,4-dioxygenase; Provisional	98.52
TIGR03404		367	bicupin_oxalic bicupin, oxalate decarboxylase fami	98.46
COG2140		209	Thermophilic glucose-6-phosphate isomerase and rel	98.45
PRK13500		312	transcriptional activator RhaR; Provisional	98.41
PF06560		182	GPI: Glucose-6-phosphate isomerase (GPI); InterPro	98.38
PRK13501		290	transcriptional activator RhaR; Provisional	98.36
PRK11171		266	hypothetical protein; Provisional	98.33
PRK10371		302	DNA-binding transcriptional regulator MelR; Provis	98.33
PRK10296		278	DNA-binding transcriptional regulator ChbR; Provis	98.32
COG3837		161	Uncharacterized conserved protein, contains double	98.3
TIGR01479		468	GMP_PMI mannose-1-phosphate guanylyltransferase/ma	98.29
PRK13503		278	transcriptional activator RhaS; Provisional	98.28
PRK13502		282	transcriptional activator RhaR; Provisional	98.25
PRK15457		233	ethanolamine utilization protein EutQ; Provisional	98.22
TIGR02297		287	HpaA 4-hydroxyphenylacetate catabolism regulatory	98.21
PRK15460		478	cpsB mannose-1-phosphate guanyltransferase; Provis	98.16
PLN00212		493	glutelin; Provisional	98.13
COG4101		142	Predicted mannose-6-phosphate isomerase [Carbohydr	98.06
TIGR03214		260	ura-cupin putative allantoin catabolism protein. T	98.02
PRK11171		266	hypothetical protein; Provisional	98.0
PF01050		151	MannoseP_isomer: Mannose-6-phosphate isomerase; In	98.0
PF02041		167	Auxin_BP: Auxin binding protein; InterPro: IPR0005	97.97
COG4297		163	Uncharacterized protein containing double-stranded	97.83
COG3435		351	Gentisate 1,2-dioxygenase [Secondary metabolites b	97.62
TIGR02272		335	gentisate_1_2 gentisate 1,2-dioxygenase. This fami	97.59
PLN00212		493	glutelin; Provisional	97.57
TIGR02451		215	anti_sig_ChrR anti-sigma factor, putative, ChrR fa	97.52
PF12973		91	Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_	97.45
PF05899		74	Cupin_3: Protein of unknown function (DUF861); Int	97.41
PF06249		152	EutQ: Ethanolamine utilisation protein EutQ; Inter	97.41
TIGR02272		335	gentisate_1_2 gentisate 1,2-dioxygenase. This fami	97.33
PRK10572		290	DNA-binding transcriptional regulator AraC; Provis	97.19
PF12852		186	Cupin_6: Cupin	97.03
COG4766		176	EutQ Ethanolamine utilization protein [Amino acid	97.03
PF05523		131	FdtA: WxcM-like, C-terminal ; InterPro: IPR008894	96.9
PF06052		151	3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte	96.88
COG3450		116	Predicted enzyme of the cupin superfamily [General	96.51
PF04209		424	HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR	96.43
TIGR01015		429	hmgA homogentisate 1,2-dioxygenase. Missing in hum	96.06
PF11699		85	CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B.	95.83
PRK09685		302	DNA-binding transcriptional activator FeaR; Provis	95.82
PRK05341		438	homogentisate 1,2-dioxygenase; Provisional	95.8
PLN02658		435	homogentisate 1,2-dioxygenase	95.49
PF02373		114	JmjC: JmjC domain, hydroxylase; InterPro: IPR01312	95.46
PF14525		172	AraC_binding_2: AraC-binding-like domain	95.44
COG3435		351	Gentisate 1,2-dioxygenase [Secondary metabolites b	95.2
PF06339		126	Ectoine_synth: Ectoine synthase; InterPro: IPR0104	94.75
PF13621		251	Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU	94.28
COG3257		264	GlxB Uncharacterized protein, possibly involved in	94.19
PF00908		176	dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimer	93.68
TIGR01221		176	rmlC dTDP-4-dehydrorhamnose 3,5-epimerase. This en	93.57
COG3257		264	GlxB Uncharacterized protein, possibly involved in	93.42
PF04962		261	KduI: KduI/IolB family; InterPro: IPR021120 The Kd	93.24
KOG2757		411	consensus Mannose-6-phosphate isomerase [Carbohydr	92.04
KOG3995		279	consensus 3-hydroxyanthranilate oxygenase HAAO [Am	91.86
PF02678		107	Pirin: Pirin; InterPro: IPR003829 This entry repre	91.57
PF08007		319	Cupin_4: Cupin superfamily protein; InterPro: IPR0	90.98
COG3508		427	HmgA Homogentisate 1,2-dioxygenase [Secondary meta	90.69
COG1898		173	RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and rela	90.0
PF14499		251	DUF4437: Domain of unknown function (DUF4437); PDB	89.68
PF07385		225	DUF1498: Protein of unknown function (DUF1498); In	89.56
TIGR00218		302	manA mannose-6-phosphate isomerase, class I. The n	87.48
PRK15131		389	mannose-6-phosphate isomerase; Provisional	86.44
PF13759		101	2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB	85.38
PRK12335		287	tellurite resistance protein TehB; Provisional	85.34
COG3822		225	ABC-type sugar transport system, auxiliary compone	85.14
COG1482		312	ManA Phosphomannose isomerase [Carbohydrate transp	84.59
COG1482		312	ManA Phosphomannose isomerase [Carbohydrate transp	84.27
TIGR00218		302	manA mannose-6-phosphate isomerase, class I. The n	84.22
COG1741		276	Pirin-related protein [General function prediction	80.84

>KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown]	Back alignment and domain information

Probab=100.00  E-value=3.6e-65  Score=422.17  Aligned_cols=177  Identities=66%  Similarity=1.232  Sum_probs=173.6

Q ss_pred             ceEEEEecCCC-CCCCCCCCCCCCCCCCHHHHhhcCeEEEEcCCCCCCChHHHHHHHHHcCCCeeeeeeeCccCccChHH
Q 027870           32 FNQAWFMDESS-QDQRLPHHLNPKQFVSLDQLAELGVLYWRLNPKNYENDEELQKIREARGYSYMDLLDLCPEKVTNYEE  110 (217)
Q Consensus        32 m~~aw~~d~~~-~d~~lph~~~p~~~vs~~~L~~~GV~~w~~~~~~~~~~~~l~~l~~e~Gy~~~Dvi~i~p~~~p~y~~  110 (217)
                      ||||||||+.. +|||+|||.+|++.||+++|+++||+||++++|+++.+++|++|++++||+.+|+++++++++|||++
T Consensus         1 m~qaw~mdd~~~~D~RlPhh~~p~~~vs~d~L~~lGVly~kld~D~~e~~~~L~~lr~e~~~~~~d~~~~~~e~~~nfde   80 (179)
T KOG2107|consen    1 MMQAWYMDDSPCEDQRLPHHKDPKKEVSLDELARLGVLYWKLDADNYELDEELDRLREERGYSYMDICTVCPETLPNFDE   80 (179)
T ss_pred             CeeEEEcCCCCcccccCCCCCCCcccCCHHHHHhhCcEEEEecCchHHHHHHHHHHHHHcCCceeeEEEEchhhcccHHH
Confidence            89999999965 99999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhcCccccccCCCceEEEEEeceEEEEEecCCCcEEEEEEeCCCEEEeCCCCeeeeeeCCCCcEEEEEEEcCCCceEEeC
Q 027870          111 KLKNFYTEHIHADEEIRYCLEGSGYFDVRDESDQWIRIWIKAGDLIVLPAGIYHRFTLDTSNYVKLMRLFVGEPVWTAYN  190 (217)
Q Consensus       111 k~~~f~~eH~H~~dEiryileG~g~f~v~~~~d~wi~i~v~~GDlIiIPaG~~H~F~~~~~~~~~aiRlF~~~~gW~~~~  190 (217)
                      |++.||+||.|+++|||||++|+|||+|++++|+||||.|++||+|+||||++||||++++|+++|||||.++|.|+|+|
T Consensus        81 Kvk~FfEEhlh~deeiR~il~GtgYfDVrd~dd~WIRi~vekGDlivlPaGiyHRFTtt~~n~vkamRlF~~~p~wta~n  160 (179)
T KOG2107|consen   81 KVKSFFEEHLHEDEEIRYILEGTGYFDVRDKDDQWIRIFVEKGDLIVLPAGIYHRFTTTPSNYVKAMRLFVGEPKWTAYN  160 (179)
T ss_pred             HHHHHHHHhcCchhheEEEeecceEEeeccCCCCEEEEEEecCCEEEecCcceeeeecCchHHHHHHHHhcCCcccccCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCcHHHHHHHHhhcC
Q 027870          191 RPQEDHPARKEYIKGLTG  208 (217)
Q Consensus       191 r~~d~~~~R~~y~~~~~~  208 (217)
                      ||+|+.++|++||..+.+
T Consensus       161 R~~d~l~~r~~yl~~i~~  178 (179)
T KOG2107|consen  161 RPHDELPARKQYLNFISQ  178 (179)
T ss_pred             CccccchhHHHHHhhccc
Confidence            999999999999998864

>PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ []	Back alignment and domain information

>COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown]	Back alignment and domain information

>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel)	Back alignment and domain information

>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown]	Back alignment and domain information

>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC	Back alignment and domain information

>PRK04190 glucose-6-phosphate isomerase; Provisional	Back alignment and domain information

>smart00835 Cupin_1 Cupin	Back alignment and domain information

>PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel)	Back alignment and domain information

>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family	Back alignment and domain information

>TIGR03214 ura-cupin putative allantoin catabolism protein	Back alignment and domain information

>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional	Back alignment and domain information

>PRK13290 ectC L-ectoine synthase; Reviewed	Back alignment and domain information

>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase	Back alignment and domain information

>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional	Back alignment and domain information

>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family	Back alignment and domain information

>COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only]	Back alignment and domain information

>PRK13500 transcriptional activator RhaR; Provisional	Back alignment and domain information

>PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5	Back alignment and domain information

>PRK13501 transcriptional activator RhaR; Provisional	Back alignment and domain information

>PRK11171 hypothetical protein; Provisional	Back alignment and domain information

>PRK10371 DNA-binding transcriptional regulator MelR; Provisional	Back alignment and domain information

>PRK10296 DNA-binding transcriptional regulator ChbR; Provisional	Back alignment and domain information

>COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown]	Back alignment and domain information

>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	Back alignment and domain information

>PRK13503 transcriptional activator RhaS; Provisional	Back alignment and domain information

>PRK13502 transcriptional activator RhaR; Provisional	Back alignment and domain information

>PRK15457 ethanolamine utilization protein EutQ; Provisional	Back alignment and domain information

>TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA	Back alignment and domain information

>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional	Back alignment and domain information

>PLN00212 glutelin; Provisional	Back alignment and domain information

>COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR03214 ura-cupin putative allantoin catabolism protein	Back alignment and domain information

>PRK11171 hypothetical protein; Provisional	Back alignment and domain information

>PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5	Back alignment and domain information

>PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER)	Back alignment and domain information

>COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown]	Back alignment and domain information

>COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase	Back alignment and domain information

>PLN00212 glutelin; Provisional	Back alignment and domain information

>TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family	Back alignment and domain information

>PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A	Back alignment and domain information

>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown	Back alignment and domain information

>PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine	Back alignment and domain information

>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase	Back alignment and domain information

>PRK10572 DNA-binding transcriptional regulator AraC; Provisional	Back alignment and domain information

>PF12852 Cupin_6: Cupin	Back alignment and domain information

>COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism]	Back alignment and domain information

>PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase []	Back alignment and domain information

>PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1	Back alignment and domain information

>COG3450 Predicted enzyme of the cupin superfamily [General function prediction only]	Back alignment and domain information

>PF04209 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR005708 Alkaptonuria (AKU), a rare hereditary disorder, was the first disease to be interpreted as an inborn error of metabolism	Back alignment and domain information

>TIGR01015 hmgA homogentisate 1,2-dioxygenase	Back alignment and domain information

>PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B	Back alignment and domain information

>PRK09685 DNA-binding transcriptional activator FeaR; Provisional	Back alignment and domain information

>PRK05341 homogentisate 1,2-dioxygenase; Provisional	Back alignment and domain information

>PLN02658 homogentisate 1,2-dioxygenase	Back alignment and domain information

>PF02373 JmjC: JmjC domain, hydroxylase; InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice []	Back alignment and domain information

>PF14525 AraC_binding_2: AraC-binding-like domain	Back alignment and domain information

>COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PF06339 Ectoine_synth: Ectoine synthase; InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins	Back alignment and domain information

>PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A	Back alignment and domain information

>COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only]	Back alignment and domain information

>PF00908 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IPR000888 Deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-d-hexulose 3, 5-epimerase (RmlC, 5	Back alignment and domain information

>TIGR01221 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase	Back alignment and domain information

>COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only]	Back alignment and domain information

>PF04962 KduI: KduI/IolB family; InterPro: IPR021120 The KduI/IolB family of enzymes includes 5-keto 4-deoxyuronate isomerase (KduI) and 5-deoxy-glucuronate isomerase (IolB)	Back alignment and domain information

>KOG2757 consensus Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG3995 consensus 3-hydroxyanthranilate oxygenase HAAO [Amino acid transport and metabolism]	Back alignment and domain information

>PF02678 Pirin: Pirin; InterPro: IPR003829 This entry represents N-terminal domain of Pirin proteins from both eukaryotes and prokaryotes	Back alignment and domain information

>PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors	Back alignment and domain information

>COG3508 HmgA Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>COG1898 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A	Back alignment and domain information

>PF07385 DUF1498: Protein of unknown function (DUF1498); InterPro: IPR010864 This family consists of several hypothetical bacterial proteins of around 225 residues in length	Back alignment and domain information

>TIGR00218 manA mannose-6-phosphate isomerase, class I	Back alignment and domain information

>PRK15131 mannose-6-phosphate isomerase; Provisional	Back alignment and domain information

>PF13759 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB: 3BVC_B 2RG4_A	Back alignment and domain information

>PRK12335 tellurite resistance protein TehB; Provisional	Back alignment and domain information

>COG3822 ABC-type sugar transport system, auxiliary component [General function prediction only]	Back alignment and domain information

>COG1482 ManA Phosphomannose isomerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG1482 ManA Phosphomannose isomerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR00218 manA mannose-6-phosphate isomerase, class I	Back alignment and domain information

>COG1741 Pirin-related protein [General function prediction only]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		217
1vr3_A		191	Crystal Structure Of Acireductone Dioxygenase (1354		9e-61
1zrr_A		179	Residual Dipolar Coupling Refinement Of Acireducton		5e-06

>pdb|1VR3|A Chain A, Crystal Structure Of Acireductone Dioxygenase (13543033) From Mus Musculus At 2.06 A Resolution Length = 191

Back alignment and structure

Iteration: 1

Score = 229 bits (584), Expect = 9e-61, Method: Compositional matrix adjust. Identities = 108/177 (61%), Positives = 130/177 (73%) Query: 34 QAWFMDESSQDQRLPHHLNPKQFVSLDQLAELGVLYWRLNPKNYENDEELQKIREARGYS 93 QAW+ DES+ D R PH P + VSL+QL LGVLYW+L+ YEND EL+KIR+ R YS Sbjct: 15 QAWYXDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKXRNYS 74 Query: 94 YMDLLDLCPEKVTNYEEKLKNFYTEHIHADEEIRYCLEGSGYFDVRDESDQWIRIWIKAG 153 + D++ +C + + NYEEK+K F+ EH+H DEEIRY LEGSGYFDVRD+ D+WIRI + G Sbjct: 75 WXDIITICKDTLPNYEEKIKXFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISXEKG 134 Query: 154 DLIVLPAGIYHRFTLDTSNYVKLMRLFVGEPVWTAYNRPQEDHPARKEYIKGLTGQA 210 D I LPAGIYHRFTLD NYVK RLFVGEPVWT YNRP + AR +Y L G A Sbjct: 135 DXITLPAGIYHRFTLDEKNYVKAXRLFVGEPVWTPYNRPADHFDARVQYXSFLEGTA 191

PyMOL of 1vr3

>pdb|1ZRR|A Chain A, Residual Dipolar Coupling Refinement Of Acireductone Dioxygenase From Klebsiella Length = 179

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		217
1vr3_A		191	Acireductone dioxygenase; 13543033, structural gen	2e-83
1zrr_A		179	E-2/E-2' protein; nickel, cupin, beta helix, methi	2e-57
3ht1_A		145	REMF protein; cupin fold, Zn-binding, antibiotic b	2e-08
2pfw_A		116	Cupin 2, conserved barrel domain protein; cupin do	4e-08
3d82_A		102	Cupin 2, conserved barrel domain protein; structur	4e-08
2d40_A		354	Z3393, putative gentisate 1,2-dioxygenase; gentisi	6e-08
2d40_A		354	Z3393, putative gentisate 1,2-dioxygenase; gentisi	1e-05
1vj2_A		126	Novel manganese-containing cupin TM1459; structura	2e-07
1v70_A		105	Probable antibiotics synthesis protein; structural	2e-07
1lr5_A		163	Auxin binding protein 1; beta jellyroll, double st	4e-07
1yhf_A		115	Hypothetical protein SPY1581; structural genomics,	4e-07
3nw4_A		368	Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc	5e-07
3nw4_A		368	Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc	8e-07
2ozj_A		114	Cupin 2, conserved barrel; cupin superfamily prote	9e-07
2gu9_A		113	Tetracenomycin polyketide synthesis protein; X-RAY	1e-06
3ibm_A		167	Cupin 2, conserved barrel domain protein; cupin 2	2e-06
3kgz_A		156	Cupin 2 conserved barrel domain protein; metallopr	2e-06
2i45_A		107	Hypothetical protein; neisseria meningitidis cupin	2e-06
3rns_A		227	Cupin 2 conserved barrel domain protein; structura	2e-06
3cew_A		125	Uncharacterized cupin protein; all beta-protein, j	2e-06
3fjs_A		114	Uncharacterized protein with RMLC-like cupin fold;	2e-06
4e2g_A		126	Cupin 2 conserved barrel domain protein; MCSG, PSI	2e-06
3jzv_A		166	Uncharacterized protein RRU_A2000; structural geno	5e-06
2cav_A		445	Protein (canavalin); vicilin, 7S SEED protein, dom	6e-06
3bu7_A		394	Gentisate 1,2-dioxygenase; cupin domain, oxidoredu	9e-06
3bu7_A		394	Gentisate 1,2-dioxygenase; cupin domain, oxidoredu	1e-05
2q30_A		110	Uncharacterized protein; double-stranded beta-heli	9e-06
1juh_A		350	Quercetin 2,3-dioxygenase; cupin, glycoprotein, be	1e-05
1y3t_A		337	Hypothetical protein YXAG; BI cupin, dioxygenase,	2e-05
1y3t_A		337	Hypothetical protein YXAG; BI cupin, dioxygenase,	2e-04
1x82_A		190	Glucose-6-phosphate isomerase; cupin superfamily,	3e-05
1j58_A		385	YVRK protein; cupin, decarboxyklase, oxalate, mang	5e-05
2pyt_A		133	Ethanolamine utilization protein EUTQ; structural	1e-04
1o4t_A		133	Putative oxalate decarboxylase; double-stranded be	2e-04
2o8q_A		134	Hypothetical protein; cpuin-like fold, structural	2e-04
4b29_A		217	Dimethylsulfoniopropionate lyase; hydrolase, dimet	2e-04
3gbg_A		276	TCP pilus virulence regulatory protein; cupin, hel	3e-04
3h7j_A		243	Bacilysin biosynthesis protein BACB; YWFC, bacilys	5e-04
3lwc_A		119	Uncharacterized protein; structural genomics, unkn	9e-04

>1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 Length = 191	Back alignment and structure

 Score =  245 bits (626), Expect = 2e-83
 Identities = 111/177 (62%), Positives = 136/177 (76%)

Query: 34  QAWFMDESSQDQRLPHHLNPKQFVSLDQLAELGVLYWRLNPKNYENDEELQKIREARGYS 93
           QAW+MDES+ D R PH   P + VSL+QL  LGVLYW+L+   YEND EL+KIR+ R YS
Sbjct: 15  QAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRNYS 74

Query: 94  YMDLLDLCPEKVTNYEEKLKNFYTEHIHADEEIRYCLEGSGYFDVRDESDQWIRIWIKAG 153
           +MD++ +C + + NYEEK+K F+ EH+H DEEIRY LEGSGYFDVRD+ D+WIRI ++ G
Sbjct: 75  WMDIITICKDTLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKG 134

Query: 154 DLIVLPAGIYHRFTLDTSNYVKLMRLFVGEPVWTAYNRPQEDHPARKEYIKGLTGQA 210
           D+I LPAGIYHRFTLD  NYVK MRLFVGEPVWT YNRP +   AR +Y+  L G A
Sbjct: 135 DMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRPADHFDARVQYMSFLEGTA 191

PyMOL of 1vr3

>1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A Length = 179	Back alignment and structure

>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Length = 145	Back alignment and structure

>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Length = 116	Back alignment and structure

>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Length = 102	Back alignment and structure

>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Length = 354	Back alignment and structure

>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Length = 354	Back alignment and structure

>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Length = 126	Back alignment and structure

>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Length = 105	Back alignment and structure

>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Length = 163	Back alignment and structure

>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Length = 115	Back alignment and structure

>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* Length = 368	Back alignment and structure

>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* Length = 368	Back alignment and structure

>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Length = 114	Back alignment and structure

>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Length = 113	Back alignment and structure

>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Length = 167	Back alignment and structure

>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Length = 156	Back alignment and structure

>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Length = 107	Back alignment and structure

>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Length = 227	Back alignment and structure

>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Length = 125	Back alignment and structure

>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Length = 114	Back alignment and structure

>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Length = 126	Back alignment and structure

>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Length = 166	Back alignment and structure

>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Length = 445	Back alignment and structure

>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Length = 394	Back alignment and structure

>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Length = 394	Back alignment and structure

>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Length = 110	Back alignment and structure

>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Length = 350	Back alignment and structure

>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Length = 337	Back alignment and structure

>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Length = 337	Back alignment and structure

>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* Length = 190	Back alignment and structure

>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385	Back alignment and structure

>2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 Length = 133	Back alignment and structure

>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Length = 133	Back alignment and structure

>2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} Length = 134	Back alignment and structure

>4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} Length = 217	Back alignment and structure

>3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} Length = 276	Back alignment and structure

>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Length = 243	Back alignment and structure

>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Length = 119	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		217
1vr3_A		191	Acireductone dioxygenase; 13543033, structural gen	100.0
1zrr_A		179	E-2/E-2' protein; nickel, cupin, beta helix, methi	100.0
1v70_A		105	Probable antibiotics synthesis protein; structural	99.16
3h8u_A		125	Uncharacterized conserved protein with double-STR	99.16
2b8m_A		117	Hypothetical protein MJ0764; structural genomics,	99.11
3fjs_A		114	Uncharacterized protein with RMLC-like cupin fold;	99.11
4i4a_A		128	Similar to unknown protein; structural genomics, P	99.05
2ozj_A		114	Cupin 2, conserved barrel; cupin superfamily prote	99.04
2gu9_A		113	Tetracenomycin polyketide synthesis protein; X-RAY	99.04
1x82_A		190	Glucose-6-phosphate isomerase; cupin superfamily,	99.03
4e2g_A		126	Cupin 2 conserved barrel domain protein; MCSG, PSI	99.03
1yhf_A		115	Hypothetical protein SPY1581; structural genomics,	99.02
1vj2_A		126	Novel manganese-containing cupin TM1459; structura	99.02
3ibm_A		167	Cupin 2, conserved barrel domain protein; cupin 2	99.02
3ht1_A		145	REMF protein; cupin fold, Zn-binding, antibiotic b	99.0
2pfw_A		116	Cupin 2, conserved barrel domain protein; cupin do	98.99
3d82_A		102	Cupin 2, conserved barrel domain protein; structur	98.99
1lr5_A		163	Auxin binding protein 1; beta jellyroll, double st	98.97
3l2h_A		162	Putative sugar phosphate isomerase; AFE_0303, stru	98.97
2o8q_A		134	Hypothetical protein; cpuin-like fold, structural	98.96
3kgz_A		156	Cupin 2 conserved barrel domain protein; metallopr	98.95
2oa2_A		148	BH2720 protein; 10175341, structural genomics, joi	98.95
2f4p_A		147	Hypothetical protein TM1010; double-stranded beta-	98.95
2q30_A		110	Uncharacterized protein; double-stranded beta-heli	98.95
3jzv_A		166	Uncharacterized protein RRU_A2000; structural geno	98.93
2i45_A		107	Hypothetical protein; neisseria meningitidis cupin	98.91
1fi2_A		201	Oxalate oxidase, germin; beta-jellyroll, oxidoredu	98.91
3i7d_A		163	Sugar phosphate isomerase; YP_168127.1, structural	98.86
2fqp_A		97	Hypothetical protein BP2299; double-stranded beta-	98.86
2opk_A		112	Hypothetical protein; putative mannose-6-phosphate	98.85
3cew_A		125	Uncharacterized cupin protein; all beta-protein, j	98.85
3rns_A		227	Cupin 2 conserved barrel domain protein; structura	98.84
3lwc_A		119	Uncharacterized protein; structural genomics, unkn	98.83
1o4t_A		133	Putative oxalate decarboxylase; double-stranded be	98.83
4b29_A		217	Dimethylsulfoniopropionate lyase; hydrolase, dimet	98.83
2bnm_A		198	Epoxidase; oxidoreductase, cupin, HTH, cation-depe	98.82
3h7j_A		243	Bacilysin biosynthesis protein BACB; YWFC, bacilys	98.79
1y9q_A		192	Transcriptional regulator, HTH_3 family; transcrip	98.79
1o5u_A		101	Novel thermotoga maritima enzyme TM1112; cupin, st	98.77
2vqa_A		361	SLL1358 protein, MNCA; periplasmic binding protein	98.75
1sef_A		274	Conserved hypothetical protein; structural genomic	98.74
1yfu_A		174	3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid	98.74
1dgw_A		178	Canavalin; duplicated swiss-roll beta barrels, loo	98.73
4h7l_A		157	Uncharacterized protein; structural genomics, PSI-	98.73
3rns_A		227	Cupin 2 conserved barrel domain protein; structura	98.72
2vqa_A		361	SLL1358 protein, MNCA; periplasmic binding protein	98.69
1j58_A		385	YVRK protein; cupin, decarboxyklase, oxalate, mang	98.68
2arc_A		164	ARAC, arabinose operon regulatory protein; transcr	98.67
1fxz_A		476	Glycinin G1; proglycinin, legumin, SEED storage pr	98.66
1y3t_A		337	Hypothetical protein YXAG; BI cupin, dioxygenase,	98.66
1y3t_A		337	Hypothetical protein YXAG; BI cupin, dioxygenase,	98.64
4axo_A		151	EUTQ, ethanolamine utilization protein; structural	98.64
3h7j_A		243	Bacilysin biosynthesis protein BACB; YWFC, bacilys	98.64
1rc6_A		261	Hypothetical protein YLBA; structural genomics, NY	98.64
1j58_A		385	YVRK protein; cupin, decarboxyklase, oxalate, mang	98.63
2d40_A		354	Z3393, putative gentisate 1,2-dioxygenase; gentisi	98.62
2cav_A		445	Protein (canavalin); vicilin, 7S SEED protein, dom	98.62
3c3v_A		510	Arachin ARAH3 isoform; peanut allergen, allergy, g	98.61
3nw4_A		368	Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc	98.6
3es1_A		172	Cupin 2, conserved barrel domain protein; YP_00116	98.59
2d5f_A		493	Glycinin A3B4 subunit; soybean, globulin, 11S,SEED	98.58
2vpv_A		166	Protein MIF2, MIF2P; nucleus, mitosis, centromere,	98.57
2ea7_A		434	7S globulin-1; beta barrel, cupin superfamily, pla	98.56
4e2q_A		266	Ureidoglycine aminohydrolase; BI-cupin, manganese	98.55
1uij_A		416	Beta subunit of beta conglycinin; double-stranded	98.55
1fxz_A		476	Glycinin G1; proglycinin, legumin, SEED storage pr	98.54
1juh_A		350	Quercetin 2,3-dioxygenase; cupin, glycoprotein, be	98.53
2xlg_A		239	SLL1785 protein, CUCA; metal binding protein, cupi	98.53
3bu7_A		394	Gentisate 1,2-dioxygenase; cupin domain, oxidoredu	98.52
1sfn_A		246	Conserved hypothetical protein; structural genomic	98.51
1sq4_A		278	GLXB, glyoxylate-induced protein; structural genom	98.51
1zvf_A		176	3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b	98.51
3d0j_A		140	Uncharacterized protein CA_C3497; beta-barrel, str	98.51
2e9q_A		459	11S globulin subunit beta; cucubitin, pumpkin SEED	98.5
3bu7_A		394	Gentisate 1,2-dioxygenase; cupin domain, oxidoredu	98.5
2d5f_A		493	Glycinin A3B4 subunit; soybean, globulin, 11S,SEED	98.5
3bcw_A		123	Uncharacterized protein; structural genomics, join	98.49
2pyt_A		133	Ethanolamine utilization protein EUTQ; structural	98.48
1juh_A		350	Quercetin 2,3-dioxygenase; cupin, glycoprotein, be	98.47
3qac_A		465	11S globulin SEED storage protein; 11S SEED storag	98.47
3c3v_A		510	Arachin ARAH3 isoform; peanut allergen, allergy, g	98.45
2phl_A		397	Phaseolin; plant SEED storage protein(vicilin); HE	98.43
3fz3_A		531	Prunin; TREE NUT allergen, allergy, amandin, almon	98.41
3ksc_A		496	LEGA class, prolegumin; PEA prolegumin, 11S SEED s	98.33
1sq4_A		278	GLXB, glyoxylate-induced protein; structural genom	98.33
2d40_A		354	Z3393, putative gentisate 1,2-dioxygenase; gentisi	98.29
2e9q_A		459	11S globulin subunit beta; cucubitin, pumpkin SEED	98.29
2phl_A		397	Phaseolin; plant SEED storage protein(vicilin); HE	98.28
1uij_A		416	Beta subunit of beta conglycinin; double-stranded	98.28
3lag_A		98	Uncharacterized protein RPA4178; functionally unkn	98.26
2o1q_A		145	Putative acetyl/propionyl-COA carboxylase, alpha;	98.24
1rc6_A		261	Hypothetical protein YLBA; structural genomics, NY	98.23
3ksc_A		496	LEGA class, prolegumin; PEA prolegumin, 11S SEED s	98.23
1sef_A		274	Conserved hypothetical protein; structural genomic	98.17
2qnk_A		286	3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol	98.16
3kgl_A		466	Cruciferin; 11S SEED globulin, rapeseed, SEED stor	98.15
2ea7_A		434	7S globulin-1; beta barrel, cupin superfamily, pla	98.13
3qac_A		465	11S globulin SEED storage protein; 11S SEED storag	98.12
3s7i_A		418	Allergen ARA H 1, clone P41B; bicupin, vicilin, st	98.1
2ozi_A		98	Hypothetical protein RPA4178; APC6210, putative pr	98.09
3nw4_A		368	Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc	98.05
4e2q_A		266	Ureidoglycine aminohydrolase; BI-cupin, manganese	98.04
2cav_A		445	Protein (canavalin); vicilin, 7S SEED protein, dom	97.96
3kgl_A		466	Cruciferin; 11S SEED globulin, rapeseed, SEED stor	97.94
3gbg_A		276	TCP pilus virulence regulatory protein; cupin, hel	97.93
3s7i_A		418	Allergen ARA H 1, clone P41B; bicupin, vicilin, st	97.91
1sfn_A		246	Conserved hypothetical protein; structural genomic	97.88
2q1z_B		195	Anti-sigma factor CHRR, transcriptional activator;	97.88
3ebr_A		159	Uncharacterized RMLC-like cupin; structural genomi	97.81
2y0o_A		175	Probable D-lyxose ketol-isomerase; carbohydrate me	97.7
3es4_A		116	Uncharacterized protein DUF861 with A RMLC-like C;	97.7
3myx_A		238	Uncharacterized protein pspto_0244; protein of unk	97.6
3fz3_A		531	Prunin; TREE NUT allergen, allergy, amandin, almon	97.54
3cjx_A		165	Protein of unknown function with A cupin-like FOL;	97.46
3st7_A		369	Capsular polysaccharide synthesis enzyme CAP5F; ro	97.45
3o14_A		223	Anti-ecfsigma factor, CHRR; cupin, structural geno	97.28
3bal_A		153	Acetylacetone-cleaving enzyme; jelly roll, tetrame	96.98
3myx_A		238	Uncharacterized protein pspto_0244; protein of unk	96.71
2pa7_A		141	DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug	96.45
1nxm_A		197	DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jell	96.21
1ep0_A		185	DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race	96.14
3ejk_A		174	DTDP sugar isomerase; YP_390184.1, structural geno	96.02
2ixk_A		184	DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l	95.96
2qnk_A		286	3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol	95.96
3ryk_A		205	DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat	95.79
1dzr_A		183	DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase,	95.71
1eyb_A		471	Homogentisate 1,2-dioxygenase; jelly roll, beta sa	95.69
3eqe_A		171	Putative cystein deoxygenase; YUBC, SR112, NESG, s	95.4
1yud_A		170	Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, p	95.24
2c0z_A		216	NOVW; isomerase, epimerase, antibiotic biosynthesi	95.14
2gm6_A		208	Cysteine dioxygenase type I; structural genomics,	94.98
1wlt_A		196	176AA long hypothetical DTDP-4-dehydrorhamnose 3,	94.87
1oi6_A		205	PCZA361.16; epimerase, vancomycin group antibiotic	94.08
2qjv_A		270	Uncharacterized IOLB-like protein; structural geno	93.67
4gjz_A		235	Lysine-specific demethylase 8; JMJC, beta barrel,	93.63
3o14_A		223	Anti-ecfsigma factor, CHRR; cupin, structural geno	93.59
1upi_A		225	DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat	93.56
3kmh_A		246	D-lyxose isomerase; cupin beta-barrel, structural	93.52
2vec_A		256	YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe	93.29
3bb6_A		127	Uncharacterized protein YEAR; structural genomics,	93.06
4hn1_A		201	Putative 3-epimerase in D-allose pathway; 3'-monoe	92.79
2xdv_A		442	MYC-induced nuclear antigen; ribosome biogenesis,	91.63
4diq_A		489	Lysine-specific demethylase NO66; structural genom	91.14
1qwr_A		319	Mannose-6-phosphate isomerase; structural genomics	91.12
3d8c_A		349	Hypoxia-inducible factor 1 alpha inhibitor; FIH, H	90.89
1tq5_A		242	Protein YHHW; bicupin, pirin, montreal-kingston ba	90.11
1dgw_X		79	Canavalin; duplicated swiss-roll beta barrels, loo	89.91
1vrb_A		342	Putative asparaginyl hydroxylase; 2636534, structu	89.71
3eln_A		200	Cysteine dioxygenase type 1; peroxysulfenate, non-	89.15
3al5_A		338	HTYW5, JMJC domain-containing protein C2ORF60; tRN	88.73
1zx5_A		300	Mannosephosphate isomerase, putative; STRU genomic	86.94
1ywk_A		289	4-deoxy-L-threo-5-hexosulose-uronate ketol- isomer	86.33
1qwr_A		319	Mannose-6-phosphate isomerase; structural genomics	86.17
1zx5_A		300	Mannosephosphate isomerase, putative; STRU genomic	85.65
2p17_A		277	Pirin-like protein; GK1651, structural genomics, s	85.09
3uss_A		211	Putative uncharacterized protein; cupin, three his	85.02
2wfp_A		394	Mannose-6-phosphate isomerase; APO-structure, meta	84.02
1xru_A		282	4-deoxy-L-threo-5-hexosulose-uronate ketol-isomer;	83.97
2rg4_A		216	Uncharacterized protein; rhodobacterales, oceanico	83.79
3dl3_A		119	Tellurite resistance protein B; X-RAY NESG VFR98 Q	83.27
2wfp_A		394	Mannose-6-phosphate isomerase; APO-structure, meta	83.14
3k2o_A		336	Bifunctional arginine demethylase and lysyl-hydro	82.53
1pmi_A		440	PMI, phosphomannose isomerase; aldose-ketose isome	80.78

>1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6	Back alignment and structure

Probab=100.00  E-value=4.1e-54  Score=365.03  Aligned_cols=180  Identities=61%  Similarity=1.125  Sum_probs=171.6

Q ss_pred             cccceEEEEecCCCCCCCCCCCCCCCCCCCHHHHhhcCeEEEEcCCCCCCChHHHHHHHHHcCCCeeeeeeeCccCccCh
Q 027870           29 KFEFNQAWFMDESSQDQRLPHHLNPKQFVSLDQLAELGVLYWRLNPKNYENDEELQKIREARGYSYMDLLDLCPEKVTNY  108 (217)
Q Consensus        29 ~~~m~~aw~~d~~~~d~~lph~~~p~~~vs~~~L~~~GV~~w~~~~~~~~~~~~l~~l~~e~Gy~~~Dvi~i~p~~~p~y  108 (217)
                      .--||||||||++++|||+||+++|+++||+++|+++||+||+++++.++++.+|++|++++||.+.|+++++++.+|||
T Consensus        10 ~~~~~~~~~~~~~~~d~~~ph~~~~~~~v~~~~L~~~GV~~w~~~~~~~~~~~~l~~l~~~~gy~~~D~v~~~p~~~p~~   89 (191)
T 1vr3_A           10 HHHMVQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRNYSWMDIITICKDTLPNY   89 (191)
T ss_dssp             ---CCEEEEBCSCCSCTTSCCBCSSCCBCCHHHHHHTTCEEEECCGGGTTSCHHHHHHHHHHTCCEEEEEEESTTTSTTH
T ss_pred             hhhhheeeeccCCccccCcccccCCCCccCHHHHHhcCcEEEECCCccccccHHHHHHHHhcCCCceeEEEECCCcCcch
Confidence            34699999999999999999999999999999999999999999987777789999999999999999999999877999


Q ss_pred             HHHhcCccccccCCCceEEEEEeceEEEEEecCCCcEEEEEEeCCCEEEeCCCCeeeeeeCCCCcEEEEEEEcCCCceEE
Q 027870          109 EEKLKNFYTEHIHADEEIRYCLEGSGYFDVRDESDQWIRIWIKAGDLIVLPAGIYHRFTLDTSNYVKLMRLFVGEPVWTA  188 (217)
Q Consensus       109 ~~k~~~f~~eH~H~~dEiryileG~g~f~v~~~~d~wi~i~v~~GDlIiIPaG~~H~F~~~~~~~~~aiRlF~~~~gW~~  188 (217)
                      ++++..++.+|+|+++|++||++|+|+|.+++.+|+|+++.|++||+|+||+|++|||+++++++++|||||.++|||+|
T Consensus        90 ~~k~~~~~~~H~H~~~Ei~yVleG~G~f~i~d~~d~~~~i~v~~GDlIiIPaG~~H~f~~~~~~~~~airlF~~~~~W~~  169 (191)
T 1vr3_A           90 EEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTP  169 (191)
T ss_dssp             HHHHHHHHSCEECSSCEEEEEEEEEEEEEEECTTSCEEEEEEETTEEEEECTTCCEEEEECTTCCEEEEEEESSSCCCCC
T ss_pred             hhhhccCCcceECCcceEEEEEeceEEEEECCCCCeEEEEEECCCCEEEECcCCcCCcccCCCCCEEEEEEECCCCCccC
Confidence            99999999999999999999999999999998778999999999999999999999999999999999999999999999


Q ss_pred             eCCCCCCcHHHHHHHHhhcC
Q 027870          189 YNRPQEDHPARKEYIKGLTG  208 (217)
Q Consensus       189 ~~r~~d~~~~R~~y~~~~~~  208 (217)
                      ++||+|++++|++||++|..
T Consensus       170 ~~r~~~~~~~r~~y~~~~~~  189 (191)
T 1vr3_A          170 YNRPADHFDARVQYMSFLEG  189 (191)
T ss_dssp             EESCCTTSHHHHHHHHHHHH
T ss_pred             CCCchhccHHHHHHHHHhhh
Confidence            99999999999999999864

PyMOL of 1vr3

>1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A	Back alignment and structure

>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A	Back alignment and structure

>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp}	Back alignment and structure

>2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18	Back alignment and structure

>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134}	Back alignment and structure

>4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp}	Back alignment and structure

>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense}	Back alignment and structure

>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A	Back alignment and structure

>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A*	Back alignment and structure

>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus}	Back alignment and structure

>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9	Back alignment and structure

>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10	Back alignment and structure

>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1}	Back alignment and structure

>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A	Back alignment and structure

>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina}	Back alignment and structure

>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400}	Back alignment and structure

>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A*	Back alignment and structure

>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans}	Back alignment and structure

>2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans}	Back alignment and structure

>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris}	Back alignment and structure

>2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans}	Back alignment and structure

>2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9	Back alignment and structure

>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp}	Back alignment and structure

>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum}	Back alignment and structure

>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis}	Back alignment and structure

>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A	Back alignment and structure

>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3}	Back alignment and structure

>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I}	Back alignment and structure

>2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha}	Back alignment and structure

>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis}	Back alignment and structure

>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis}	Back alignment and structure

>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum}	Back alignment and structure

>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9	Back alignment and structure

>4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism}	Back alignment and structure

>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A	Back alignment and structure

>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A*	Back alignment and structure

>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15	Back alignment and structure

>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A	Back alignment and structure

>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP}	Back alignment and structure

>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11	Back alignment and structure

>1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A*	Back alignment and structure

>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A	Back alignment and structure

>4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus}	Back alignment and structure

>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis}	Back alignment and structure

>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP}	Back alignment and structure

>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A	Back alignment and structure

>2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A	Back alignment and structure

>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A	Back alignment and structure

>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A*	Back alignment and structure

>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A*	Back alignment and structure

>4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile}	Back alignment and structure

>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A*	Back alignment and structure

>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11	Back alignment and structure

>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A	Back alignment and structure

>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23	Back alignment and structure

>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B	Back alignment and structure

>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea}	Back alignment and structure

>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A	Back alignment and structure

>3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID}	Back alignment and structure

>2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae}	Back alignment and structure

>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A	Back alignment and structure

>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A	Back alignment and structure

>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A*	Back alignment and structure

>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A	Back alignment and structure

>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A*	Back alignment and structure

>2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A	Back alignment and structure

>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23	Back alignment and structure

>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11	Back alignment and structure

>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11	Back alignment and structure

>1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20	Back alignment and structure

>3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824}	Back alignment and structure

>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A	Back alignment and structure

>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23	Back alignment and structure

>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A	Back alignment and structure

>3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50}	Back alignment and structure

>2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24	Back alignment and structure

>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A*	Back alignment and structure

>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus}	Back alignment and structure

>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea}	Back alignment and structure

>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A*	Back alignment and structure

>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A	Back alignment and structure

>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum}	Back alignment and structure

>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11	Back alignment and structure

>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23	Back alignment and structure

>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A	Back alignment and structure

>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A*	Back alignment and structure

>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A*	Back alignment and structure

>3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris}	Back alignment and structure

>2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21	Back alignment and structure

>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11	Back alignment and structure

>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum}	Back alignment and structure

>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11	Back alignment and structure

>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A	Back alignment and structure

>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus}	Back alignment and structure

>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A	Back alignment and structure

>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus}	Back alignment and structure

>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A	Back alignment and structure

>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A	Back alignment and structure

>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A	Back alignment and structure

>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B	Back alignment and structure

>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus}	Back alignment and structure

>3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae}	Back alignment and structure

>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A	Back alignment and structure

>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11	Back alignment and structure

>3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134}	Back alignment and structure

>2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp}	Back alignment and structure

>3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str}	Back alignment and structure

>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV}	Back alignment and structure

>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A	Back alignment and structure

>3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha}	Back alignment and structure

>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A	Back alignment and structure

>3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei}	Back alignment and structure

>3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii}	Back alignment and structure

>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV}	Back alignment and structure

>2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A*	Back alignment and structure

>1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A*	Back alignment and structure

>1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A*	Back alignment and structure

>3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, JOIN for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp}	Back alignment and structure

>2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A*	Back alignment and structure

>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A	Back alignment and structure

>3ryk_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, STRU genomics, infectious diseases; HET: TYD; 1.63A {Bacillus anthracis str}	Back alignment and structure

>1dzr_A DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 3\,5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A*	Back alignment and structure

>1eyb_A Homogentisate 1,2-dioxygenase; jelly roll, beta sandwich, oxidoreductase; 1.90A {Homo sapiens} SCOP: b.82.1.4 PDB: 1ey2_A	Back alignment and structure

>3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis}	Back alignment and structure

>1yud_A Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Shewanella oneidensis} SCOP: b.82.1.16	Back alignment and structure

>2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1	Back alignment and structure

>2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19	Back alignment and structure

>1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A	Back alignment and structure

>1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A	Back alignment and structure

>2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2}	Back alignment and structure

>4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A*	Back alignment and structure

>3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei}	Back alignment and structure

>1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A*	Back alignment and structure

>3kmh_A D-lyxose isomerase; cupin beta-barrel, structural genomics, montreal-kingston BA structural genomics initiative, BSGI; 1.58A {Escherichia coli O157} PDB: 3mpb_A*	Back alignment and structure

>2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli}	Back alignment and structure

>3bb6_A Uncharacterized protein YEAR; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Escherichia coli} SCOP: b.82.2.13	Back alignment and structure

>4hn1_A Putative 3-epimerase in D-allose pathway; 3'-monoepimerase, natural product, deoxysugar, chalcomycin, mycinose, cupin fold; HET: TYD THM; 1.60A {Streptomyces bikiniensis} PDB: 4hmz_A* 4hn0_A	Back alignment and structure

>2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens}	Back alignment and structure

>4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens}	Back alignment and structure

>1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3	Back alignment and structure

>3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ...	Back alignment and structure

>1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12	Back alignment and structure

>1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X	Back alignment and structure

>1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11	Back alignment and structure

>3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A	Back alignment and structure

>3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A*	Back alignment and structure

>1zx5_A Mannosephosphate isomerase, putative; STRU genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; HET: LFR; 2.30A {Archaeoglobus fulgidus} SCOP: b.82.1.3	Back alignment and structure

>1ywk_A 4-deoxy-L-threo-5-hexosulose-uronate ketol- isomerase 1; structural genomics, nysgxrc target T1814, PSI, protein structure initiative; 2.95A {Enterococcus faecalis} SCOP: b.82.1.13	Back alignment and structure

>1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3	Back alignment and structure

>1zx5_A Mannosephosphate isomerase, putative; STRU genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; HET: LFR; 2.30A {Archaeoglobus fulgidus} SCOP: b.82.1.3	Back alignment and structure

>2p17_A Pirin-like protein; GK1651, structural genomics, south collaboratory for structural genomics, protein structure in secsg; 1.52A {Geobacillus kaustophilus}	Back alignment and structure

>3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19	Back alignment and structure

>2wfp_A Mannose-6-phosphate isomerase; APO-structure, metal-binding; 1.67A {Salmonella typhimurium} PDB: 3h1w_A 3h1m_A 3h1y_A*	Back alignment and structure

>1xru_A 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomer; beta barrel, cupin, isomerase; HET: 1PE; 1.94A {Escherichia coli} SCOP: b.82.1.13 PDB: 1x8m_A	Back alignment and structure

>2rg4_A Uncharacterized protein; rhodobacterales, oceanicola granulosus HTCC2516, Q2CBJ1_9RHO structural genomics, PSI-2; 1.90A {Oceanicola granulosus} PDB: 3bvc_A	Back alignment and structure

>3dl3_A Tellurite resistance protein B; X-RAY NESG VFR98 Q5E3X2_VIBF1, structural genomics, PSI-2, protein structure initiative; 2.30A {Vibrio fischeri ES114} SCOP: b.82.2.13	Back alignment and structure

>2wfp_A Mannose-6-phosphate isomerase; APO-structure, metal-binding; 1.67A {Salmonella typhimurium} PDB: 3h1w_A 3h1m_A 3h1y_A*	Back alignment and structure

>3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A*	Back alignment and structure

>1pmi_A PMI, phosphomannose isomerase; aldose-ketose isomerase; 1.70A {Candida albicans} SCOP: b.82.1.3	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		217
d1vr3a1		179	b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse	4e-90
d1zrra1		179	b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebs	5e-46
d2phda1		351	b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Ps	2e-06
d2phda1		351	b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Ps	4e-05
d3bu7a1		355	b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Si	3e-06
d3bu7a1		355	b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Si	5e-05
d2d40a1		308	b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Es	4e-06
d2d40a1		308	b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Es	3e-05
d1juha_		348	b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergill	1e-05
d1juha_		348	b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergill	1e-04
d1y3ta1		330	b.82.1.5 (A:5-334) Hypothetical protein YxaG {Baci	1e-05
d1y3ta1		330	b.82.1.5 (A:5-334) Hypothetical protein YxaG {Baci	0.004
d1j58a_		372	b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B	2e-05
d1sq4a_		273	b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {	2e-04
d1yhfa1		112	b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {S	3e-04
d1x82a_		190	b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {	6e-04
d1sfna_		245	b.82.1.11 (A:) Hypothetical protein DR1152 {Deinoc	8e-04
d2arca_		161	b.82.4.1 (A:) Regulatory protein AraC {Escherichia	0.001
d1dgwa_		178	b.82.1.2 (A:) Seed storage 7S protein {Jack bean (	0.001
d1uija1		170	b.82.1.2 (A:6-175) Seed storage 7S protein {Soybea	0.002
d2f4pa1		134	b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Th	0.002
d1rc6a_		253	b.82.1.11 (A:) Hypothetical protein YlbA {Escheric	0.003
d2pyta1		128	b.82.1.24 (A:100-227) Ethanolamine utilization pro	0.004
d1uika1		203	b.82.1.2 (A:148-350) Seed storage 7S protein {Soyb	0.004

>d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 179	Back information, alignment and structure


class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Acireductone dioxygenase
domain: Acireductone dioxygenase
species: Mouse (Mus musculus) [TaxId: 10090]

 Score =  260 bits (666), Expect = 4e-90
 Identities = 111/177 (62%), Positives = 136/177 (76%)

Query: 34  QAWFMDESSQDQRLPHHLNPKQFVSLDQLAELGVLYWRLNPKNYENDEELQKIREARGYS 93
           QAW+MDES+ D R PH   P + VSL+QL  LGVLYW+L+   YEND EL+KIR+ R YS
Sbjct: 3   QAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRNYS 62

Query: 94  YMDLLDLCPEKVTNYEEKLKNFYTEHIHADEEIRYCLEGSGYFDVRDESDQWIRIWIKAG 153
           +MD++ +C + + NYEEK+K F+ EH+H DEEIRY LEGSGYFDVRD+ D+WIRI ++ G
Sbjct: 63  WMDIITICKDTLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKG 122

Query: 154 DLIVLPAGIYHRFTLDTSNYVKLMRLFVGEPVWTAYNRPQEDHPARKEYIKGLTGQA 210
           D+I LPAGIYHRFTLD  NYVK MRLFVGEPVWT YNRP +   AR +Y+  L G A
Sbjct: 123 DMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRPADHFDARVQYMSFLEGTA 179

PyMOL of d1vr3a1

>d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} Length = 179	Back information, alignment and structure

>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Length = 351	Back information, alignment and structure

>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Length = 351	Back information, alignment and structure

>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Length = 355	Back information, alignment and structure

>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Length = 355	Back information, alignment and structure

>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Length = 308	Back information, alignment and structure

>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Length = 308	Back information, alignment and structure

>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Length = 348	Back information, alignment and structure

>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Length = 348	Back information, alignment and structure

>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Length = 330	Back information, alignment and structure

>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Length = 330	Back information, alignment and structure

>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372	Back information, alignment and structure

>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Length = 273	Back information, alignment and structure

>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Length = 112	Back information, alignment and structure

>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 190	Back information, alignment and structure

>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Length = 245	Back information, alignment and structure

>d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} Length = 161	Back information, alignment and structure

>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Length = 178	Back information, alignment and structure

>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Length = 170	Back information, alignment and structure

>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Length = 134	Back information, alignment and structure

>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Length = 253	Back information, alignment and structure

>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Length = 128	Back information, alignment and structure

>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 203	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		217
d1vr3a1		179	Acireductone dioxygenase {Mouse (Mus musculus) [Ta	100.0
d1zrra1		179	Acireductone dioxygenase {Klebsiella pneumoniae [T	100.0
d2b8ma1		108	Hypothetical protein MJ0764 {Archaeon Methanococcu	99.25
d1v70a_		105	Hypothetical protein TTHA0104 {Thermus thermophilu	99.25
d1yhfa1		112	Hypothetical protein SPy1581 {Streptococcus pyogen	99.15
d1vj2a_		114	Hypothetical protein TM1459 {Thermotoga maritima [	99.1
d1lr5a_		160	Auxin binding protein {Maize (Zea mays) [TaxId: 45	99.09
d2f4pa1		134	Hypothetical protein TM1010 {Thermotoga maritima [	99.08
d1o4ta_		115	Hypothetical protein TM1287 {Thermotoga maritima [	99.01
d1x82a_		190	Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc	98.99
d1y9qa2		99	Probable transcriptional regulator VC1968, C-termi	98.95
d2pyta1		128	Ethanolamine utilization protein EutQ {Salmonella	98.83
d1sfna_		245	Hypothetical protein DR1152 {Deinococcus radiodura	98.82
d1rc6a_		253	Hypothetical protein YlbA {Escherichia coli [TaxId	98.81
d1sq4a_		273	Glyoxylate-induced protein PA1140 {Pseudomonas aer	98.78
d1sefa_		250	Hypothetical protein EF2996 {Enterococcus faecalis	98.76
d2et1a1		201	Germin {Barley (Hordeum vulgare) [TaxId: 4513]}	98.75
g1dgw.1		168	Seed storage 7S protein {Jack bean (Canavalia ensi	98.71
d1j58a_		372	Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil	98.69
d1fxza2		174	Seed storage 7S protein {Soybean (Glycine max), pr	98.68
d2bnma2		122	Hydroxypropylphosphonic acid epoxidase Fom4, C-ter	98.67
d1od5a2		173	Seed storage 7S protein {Soybean (Glycine max), gl	98.66
d1uika1		203	Seed storage 7S protein {Soybean (Glycine max), be	98.65
d1y3ta1		330	Hypothetical protein YxaG {Bacillus subtilis [TaxI	98.64
d1dgwa_		178	Seed storage 7S protein {Jack bean (Canavalia ensi	98.63
d1uija1		170	Seed storage 7S protein {Soybean (Glycine max), be	98.61
d2arca_		161	Regulatory protein AraC {Escherichia coli [TaxId:	98.58
d2d40a1		308	Gentisate 1,2-dioxygenase {Escherichia coli [TaxId	98.56
d1juha_		348	Quercetin 2,3-dioxygenase {Aspergillus japonicus [	98.53
d2phla2		162	Seed storage 7S protein {French bean (Phaseolus vu	98.52
d1uika2		185	Seed storage 7S protein {Soybean (Glycine max), be	98.51
d1y3ta1		330	Hypothetical protein YxaG {Bacillus subtilis [TaxI	98.5
d2phda1		351	Gentisate 1,2-dioxygenase {Pseudaminobacter salicy	98.48
d1j58a_		372	Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil	98.46
d3bu7a1		355	Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [	98.4
d1sefa_		250	Hypothetical protein EF2996 {Enterococcus faecalis	98.37
d2d40a1		308	Gentisate 1,2-dioxygenase {Escherichia coli [TaxId	98.37
d2phla1		200	Seed storage 7S protein {French bean (Phaseolus vu	98.35
d1juha_		348	Quercetin 2,3-dioxygenase {Aspergillus japonicus [	98.34
d1rc6a_		253	Hypothetical protein YlbA {Escherichia coli [TaxId	98.29
d1fxza1		239	Seed storage 7S protein {Soybean (Glycine max), pr	98.28
d2phda1		351	Gentisate 1,2-dioxygenase {Pseudaminobacter salicy	98.24
d3bu7a1		355	Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [	98.22
d1od5a1		245	Seed storage 7S protein {Soybean (Glycine max), gl	98.21
d1sfna_		245	Hypothetical protein DR1152 {Deinococcus radiodura	98.15
d1sq4a_		273	Glyoxylate-induced protein PA1140 {Pseudomonas aer	98.12
d2pa7a1		135	dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane	97.42
d1o5ua_		88	Hypothetical protein TM1112 {Thermotoga maritima [	97.4
d1yfua1		174	3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m	97.3
d1zvfa1		175	3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea	97.11
d1eyba_		439	Homogentisate dioxygenase {Human (Homo sapiens) [T	96.64
d2o1qa1		144	Putative acetyl/propionyl-CoA carboxylase subunit	96.58
d1wlta1		176	dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo	95.44
d1vrba1		319	Putative asparaginyl hydroxylase YxbC {Bacillus su	94.87
d2ixca1		198	dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobac	94.84
d1dzra_		183	dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmone	94.78
d1nxma_		194	dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Strepto	94.28
d1ep0a_		183	dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo	94.2
d2ixha1		184	dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudom	94.11
d2c0za1		190	Novobiocin biosynthesis protein NovW {Streptomyces	93.89
d1oi6a_		202	dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amyc	93.69
d1pmia_		440	Phosphomannose isomerase {Yeast (Candida albicans)	92.8
d1h2ka_		335	Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum	92.73
d1qwra_		315	Mannose-6-phosphate isomerase ManA {Bacillus subti	89.61
d1zx5a1		299	Putative mannosephosphate isomerase AF0035 {Archae	89.23
d1zx5a1		299	Putative mannosephosphate isomerase AF0035 {Archae	88.86
d1qwra_		315	Mannose-6-phosphate isomerase ManA {Bacillus subti	87.32
d3dl3a1		96	Tellurite resistance protein B, TehB {Vibrio fisch	86.76
d1pmia_		440	Phosphomannose isomerase {Yeast (Candida albicans)	83.78
d1tq5a1		231	Hypothetical protein YhhW {Escherichia coli [TaxId	83.68
d1ft9a2		132	CO-sensing protein CooA, N-terminal domain {Rhodos	81.99
d1i5za2		132	Catabolite gene activator protein, N-terminal doma	81.89
d3bb6a1		109	Uncharacterized protein YeaR {Escherichia coli [Ta	81.37
d1j1la_		288	Pirin {Human (Homo sapiens) [TaxId: 9606]}	80.73

>d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Acireductone dioxygenase
domain: Acireductone dioxygenase
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=2.1e-64  Score=421.97  Aligned_cols=178  Identities=62%  Similarity=1.136  Sum_probs=174.6

Q ss_pred             ceEEEEecCCCCCCCCCCCCCCCCCCCHHHHhhcCeEEEEcCCCCCCChHHHHHHHHHcCCCeeeeeeeCccCccChHHH
Q 027870           32 FNQAWFMDESSQDQRLPHHLNPKQFVSLDQLAELGVLYWRLNPKNYENDEELQKIREARGYSYMDLLDLCPEKVTNYEEK  111 (217)
Q Consensus        32 m~~aw~~d~~~~d~~lph~~~p~~~vs~~~L~~~GV~~w~~~~~~~~~~~~l~~l~~e~Gy~~~Dvi~i~p~~~p~y~~k  111 (217)
                      ||+|||||++++|||+||+++|+++||+++|+++||.||++++++++.+++|++|++++||+++|+|+|+|+++|||+++
T Consensus         1 m~~aw~~d~~~~d~r~ph~~~p~~~v~~~~L~~lGV~y~~~~~~~~~~~~~l~~l~~ergY~~~D~i~l~p~~~pn~~~~   80 (179)
T d1vr3a1           1 MVQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRNYSWMDIITICKDTLPNYEEK   80 (179)
T ss_dssp             CCEEEEBCSCCSCTTSCCBCSSCCBCCHHHHHHTTCEEEECCGGGTTSCHHHHHHHHHHTCCEEEEEEESTTTSTTHHHH
T ss_pred             CceEEEecCCCcccccCcccCCCCccCHHHHHhhCCEEEEecCccccccHHHHHHHHhcCCCceEEEEECCccCCCHHHH
Confidence            89999999999999999999999999999999999999999999998899999999999999999999999999999999


Q ss_pred             hcCccccccCCCceEEEEEeceEEEEEecCCCcEEEEEEeCCCEEEeCCCCeeeeeeCCCCcEEEEEEEcCCCceEEeCC
Q 027870          112 LKNFYTEHIHADEEIRYCLEGSGYFDVRDESDQWIRIWIKAGDLIVLPAGIYHRFTLDTSNYVKLMRLFVGEPVWTAYNR  191 (217)
Q Consensus       112 ~~~f~~eH~H~~dEiryileG~g~f~v~~~~d~wi~i~v~~GDlIiIPaG~~H~F~~~~~~~~~aiRlF~~~~gW~~~~r  191 (217)
                      +++|+.||+|+++|||||++|+|+|++++.+++||+|.|++||+|+||||++|||+++++++|+|||||.++|||+|+||
T Consensus        81 ~~~F~~EH~H~~~Evr~vl~G~G~f~v~~~~~~~iri~~~~GDli~iPag~~HwFtl~~~~~v~aiRlF~~~~~W~~~~r  160 (179)
T d1vr3a1          81 IKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNR  160 (179)
T ss_dssp             HHHHHSCEECSSCEEEEEEEEEEEEEEECTTSCEEEEEEETTEEEEECTTCCEEEEECTTCCEEEEEEESSSCCCCCEES
T ss_pred             HHHHhhceeCCCcEEEEEEeCcEEEEEECCCCcEEEEEEeCCCEEEeCCCccEeccCCCCCCEEEEEEECCCCeeeEcCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCcHHHHHHHHhhcCC
Q 027870          192 PQEDHPARKEYIKGLTGQ  209 (217)
Q Consensus       192 ~~d~~~~R~~y~~~~~~~  209 (217)
                      |+|++++|++||++|+..
T Consensus       161 ~ad~~~~R~~Y~~~l~~~  178 (179)
T d1vr3a1         161 PADHFDARVQYMSFLEGT  178 (179)
T ss_dssp             CCTTSHHHHHHHHHHHHC
T ss_pred             ChhhchHHHHHHHHhhcc
Confidence            999999999999998753

PyMOL of d1vr3a1

>d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]}	Back information, alignment and structure

>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]}	Back information, alignment and structure

>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]}	Back information, alignment and structure

>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}	Back information, alignment and structure

>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]}	Back information, alignment and structure

>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]}	Back information, alignment and structure

>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]}	Back information, alignment and structure

>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]}	Back information, alignment and structure

>d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]}	Back information, alignment and structure

>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]}	Back information, alignment and structure

>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]}	Back information, alignment and structure

>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]}	Back information, alignment and structure

>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]}	Back information, alignment and structure

>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]}	Back information, alignment and structure

>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]}	Back information, alignment and structure

>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]}	Back information, alignment and structure

>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]}	Back information, alignment and structure

>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]}	Back information, alignment and structure

>d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]}	Back information, alignment and structure

>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]}	Back information, alignment and structure

>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]}	Back information, alignment and structure

>d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]}	Back information, alignment and structure

>d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]}	Back information, alignment and structure

>d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]}	Back information, alignment and structure

>d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]}	Back information, alignment and structure

>d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]}	Back information, alignment and structure

>d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]}	Back information, alignment and structure

>d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d3dl3a1 b.82.2.13 (A:5-100) Tellurite resistance protein B, TehB {Vibrio fischeri [TaxId: 668]}	Back information, alignment and structure

>d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]}	Back information, alignment and structure

>d1tq5a1 b.82.1.12 (A:1-231) Hypothetical protein YhhW {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]}	Back information, alignment and structure

>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3bb6a1 b.82.2.13 (A:1-109) Uncharacterized protein YeaR {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1j1la_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure