Citrus Sinensis ID: 027884

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------
MKTLNVANSGICCVAFRALDKENLCLYGHPNESWEVTLPAEEVPPELPEPALGINFARDGMNRKDWLSLVAVHTDSWLLSVAFYLGARLNRNERKRLFSLINDQPTVFEVVTERKPIKDKPSVDSSSKSRGSTKRSNDGQVKSNPKLADESFDDEEDEHSETLCGSCGGNYNADEFWIGCDICERWFHGKCVKITPAKAENIKQYKCPSCSMKRGRQ
ccccccccccEEEEEEEccccccEEEcccccccEEEEccccccccccccccccccccccccccccccEEEHHcccHHHHHHHHHHHHcccccHHHHHcccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccHHHHccccEEEccccccccccc
ccEEEEcccccEEEEEEEcccccEEEEccccccEEEcccccccccccccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccEEEEcccHHcccccccccccHHHHHHHHcccccccccccccc
mktlnvansgICCVAFRALdkenlclyghpneswevtlpaeevppelpepalginfardgmnrkDWLSLVAVHTDSWLLSVAFYLGARLNRNERKRLFSLindqptvfevvterkpikdkpsvdsssksrgstkrsndgqvksnpkladesfddeedehsetlcgscggnynadefwigcdicerwfhgkcvkitpakaenikqykcpscsmkrgrq
MKTLNVANSGICCVAFRALDKENLCLYGHPNESWEVTLPAEEVPPELPEPALGINFARDGMNRKDWLSLVAVHTDSWLLSVAFYLGARLNRNERKRLfslindqptvfevvterkpikdkpsvdsssksrgstkrsndgqvksnpkLADESFDDEEDEHSETLCGSCGGNYNADEFWIGCDICERWFHGKCVKitpakaenikqykcpscsmkrgrq
MKTLNVANSGICCVAFRALDKENLCLYGHPNESWevtlpaeevppelpepalGINFARDGMNRKDWLSLVAVHTDSWLLSVAFYLGARLNRNERKRLFSLINDQPTVFEVVTERkpikdkpsvdsssksrgstkrsNDGQVKSNPKLAdesfddeedehseTLCGSCGGNYNADEFWIGCDICERWFHGKCVKITPAKAENIKQYKCPSCSMKRGRQ
*****VANSGICCVAFRALDKENLCLYGHPNESWEVTLPA*********PALGINFARDGMNRKDWLSLVAVHTDSWLLSVAFYLGARLNRNERKRLFSLINDQPTVFEVV***************************************************LCGSCGGNYNADEFWIGCDICERWFHGKCVKITPAKAENIKQYK***********
****N*ANSGICCVAFRALDKENLCLYGHPNESWEVTLPAEEVPPELPEPALGINFARDGMNRKDWLSLVAVHTDSWLLSVAFYLGAR********************************************************************DEHSETLCGSCGGNYNADEFWIGCDICERWFHGKCVKITPAKAENIKQYKCPS*SM*****
MKTLNVANSGICCVAFRALDKENLCLYGHPNESWEVTLPAEEVPPELPEPALGINFARDGMNRKDWLSLVAVHTDSWLLSVAFYLGARLNRNERKRLFSLINDQPTVFEVVTERK************************************************CGSCGGNYNADEFWIGCDICERWFHGKCVKITPAKAENIKQYKCP*********
MKTLNVANSGICCVAFRALDKENLCLYGHPNESWEVTLPAEEVPPELPEPALGINFARDGMNRKDWLSLVAVHTDSWLLSVAFYLGARLNRNERKRLFSLINDQPTVFEVVTER**********************************************ETLCGSCGGNYNADEFWIGCDICERWFHGKCVKITPAKAENIKQYKCPSCS******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTLNVANSGICCVAFRALDKENLCLYGHPNESWEVTLPAEEVPPELPEPALGINFARDGMNRKDWLSLVAVHTDSWLLSVAFYLGARLNRNERKRLFSLINDQPTVFEVVTERKPIKDKPSVDSSSKSRGSTKRSNDGQVKSNPKLADESFDDEEDEHSETLCGSCGGNYNADEFWIGCDICERWFHGKCVKITPAKAENIKQYKCPSCSMKRGRQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query217 2.2.26 [Sep-21-2011]
Q75IR6258 PHD finger protein ALFIN- yes no 0.912 0.767 0.686 1e-77
A2Y0Q2258 PHD finger protein ALFIN- N/A no 0.912 0.767 0.686 1e-77
Q9FFF5241 PHD finger protein ALFIN- yes no 0.912 0.821 0.793 1e-76
Q9SRM4246 PHD finger protein ALFIN- no no 0.912 0.804 0.777 1e-74
Q8H383244 PHD finger protein ALFIN- no no 0.903 0.803 0.741 2e-73
B8B8I3244 PHD finger protein ALFIN- N/A no 0.903 0.803 0.741 2e-73
Q84TV4247 PHD finger protein ALFIN- no no 0.880 0.773 0.729 2e-70
B8AMA8247 PHD finger protein ALFIN- N/A no 0.880 0.773 0.729 2e-70
Q7XUW3256 PHD finger protein ALFIN- no no 0.907 0.769 0.559 8e-61
A2XTW9256 PHD finger protein ALFIN- N/A no 0.907 0.769 0.555 6e-60
>sp|Q75IR6|ALFL1_ORYSJ PHD finger protein ALFIN-LIKE 1 OS=Oryza sativa subsp. japonica GN=Os05g0163100 PE=2 SV=1 Back     alignment and function desciption
 Score =  289 bits (739), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 138/201 (68%), Positives = 174/201 (86%), Gaps = 3/201 (1%)

Query: 20  DKENLCLYGHPNESWEVTLPAEEVPPELPEPALGINFARDGMNRKDWLSLVAVHTDSWLL 79
           +KENLCLYG+ NE+W+V LPAEEVP ELPEPALGINFARDGMNR+DWL+LVAVH+DSWL+
Sbjct: 58  EKENLCLYGYANEAWQVALPAEEVPTELPEPALGINFARDGMNRRDWLALVAVHSDSWLV 117

Query: 80  SVAFYLGARLNRNERKRLFSLINDQPTVFEVVTERKPIK--DKPSVDSSSKSRGSTKRSN 137
           SVAFY  ARLNRN+RKRLF ++ND PTV+EVV+  +  K  D+  +D+SS+++ S+K ++
Sbjct: 118 SVAFYYAARLNRNDRKRLFGMMNDLPTVYEVVSGSRQSKERDRSGMDNSSRNKISSKHTS 177

Query: 138 D-GQVKSNPKLADESFDDEEDEHSETLCGSCGGNYNADEFWIGCDICERWFHGKCVKITP 196
           D  +V++N K  DE +D+++ +HSETLCG+CGG Y+ADEFWIGCD+CERW+HGKCVKITP
Sbjct: 178 DVARVENNIKEEDEGYDEDDGDHSETLCGTCGGIYSADEFWIGCDVCERWYHGKCVKITP 237

Query: 197 AKAENIKQYKCPSCSMKRGRQ 217
           AKAE+IKQYKCPSCS KR RQ
Sbjct: 238 AKAESIKQYKCPSCSSKRPRQ 258
Histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|A2Y0Q2|ALFL1_ORYSI PHD finger protein ALFIN-LIKE 1 OS=Oryza sativa subsp. indica GN=OsI_18576 PE=3 SV=1 Back     alignment and function description
>sp|Q9FFF5|ALFL1_ARATH PHD finger protein ALFIN-LIKE 1 OS=Arabidopsis thaliana GN=AL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SRM4|ALFL2_ARATH PHD finger protein ALFIN-LIKE 2 OS=Arabidopsis thaliana GN=AL2 PE=2 SV=1 Back     alignment and function description
>sp|Q8H383|ALFL2_ORYSJ PHD finger protein ALFIN-LIKE 2 OS=Oryza sativa subsp. japonica GN=Os07g0233300 PE=2 SV=1 Back     alignment and function description
>sp|B8B8I3|ALFL2_ORYSI PHD finger protein ALFIN-LIKE 2 OS=Oryza sativa subsp. indica GN=OsI_25444 PE=3 SV=1 Back     alignment and function description
>sp|Q84TV4|ALFL3_ORYSJ PHD finger protein ALFIN-LIKE 3 OS=Oryza sativa subsp. japonica GN=Os03g0818300 PE=2 SV=1 Back     alignment and function description
>sp|B8AMA8|ALFL3_ORYSI PHD finger protein ALFIN-LIKE 3 OS=Oryza sativa subsp. indica GN=OsI_14081 PE=3 SV=2 Back     alignment and function description
>sp|Q7XUW3|ALFL4_ORYSJ PHD finger protein ALFIN-LIKE 4 OS=Oryza sativa subsp. japonica GN=Os04g0444900 PE=2 SV=2 Back     alignment and function description
>sp|A2XTW9|ALFL4_ORYSI PHD finger protein ALFIN-LIKE 4 OS=Oryza sativa subsp. indica GN=OsI_16049 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query217
358248172238 uncharacterized protein LOC100793126 [Gl 0.903 0.823 0.913 9e-95
449524633241 PREDICTED: PHD finger protein ALFIN-LIKE 0.907 0.817 0.818 1e-93
449463018241 PREDICTED: PHD finger protein ALFIN-LIKE 0.889 0.800 0.819 7e-92
118482703237 unknown [Populus trichocarpa] 0.921 0.843 0.858 2e-90
224139112235 predicted protein [Populus trichocarpa] 0.921 0.851 0.858 2e-90
449439888240 PREDICTED: PHD finger protein ALFIN-LIKE 0.912 0.825 0.863 4e-90
388515281238 unknown [Lotus japonicus] 0.907 0.827 0.909 2e-89
363806774239 uncharacterized protein LOC100779170 [Gl 0.907 0.824 0.898 2e-89
449533989233 PREDICTED: LOW QUALITY PROTEIN: PHD fing 0.912 0.849 0.858 2e-89
307135937240 phd/F-box containing protein [Cucumis me 0.912 0.825 0.858 3e-89
>gi|358248172|ref|NP_001239831.1| uncharacterized protein LOC100793126 [Glycine max] gi|255635147|gb|ACU17930.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score =  352 bits (902), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 180/197 (91%), Positives = 191/197 (96%), Gaps = 1/197 (0%)

Query: 20  DKENLCLYGHPNESWEVTLPAEEVPPELPEPALGINFARDGMNRKDWLSLVAVHTDSWLL 79
           DKENLCLYGHPNE+WEVTLPAEEVPPELPEPALGINFARDGMNR+DWLSLVAVH+DSWLL
Sbjct: 42  DKENLCLYGHPNETWEVTLPAEEVPPELPEPALGINFARDGMNRRDWLSLVAVHSDSWLL 101

Query: 80  SVAFYLGARLNRNERKRLFSLINDQPTVFEVVTERKPIKDKPSVDSSSKSRGSTKRSNDG 139
           SVAFYLGARLNRNERKRLFSLIND PTVFEVVTERKP+KDKP+ DS SKSRGSTKRS+DG
Sbjct: 102 SVAFYLGARLNRNERKRLFSLINDLPTVFEVVTERKPVKDKPTADSGSKSRGSTKRSSDG 161

Query: 140 QVKSNPKLADESFDDEEDEHSETLCGSCGGNYNADEFWIGCDICERWFHGKCVKITPAKA 199
           QVKSNPK ADE + +EEDEHSETLCGSCGGNYNADEFWIGCDICERWFHGKCVKITPAKA
Sbjct: 162 QVKSNPKFADEGY-EEEDEHSETLCGSCGGNYNADEFWIGCDICERWFHGKCVKITPAKA 220

Query: 200 ENIKQYKCPSCSMKRGR 216
           E+IKQYKCPSCS++RGR
Sbjct: 221 ESIKQYKCPSCSLRRGR 237

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449524633|ref|XP_004169326.1| PREDICTED: PHD finger protein ALFIN-LIKE 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449463018|ref|XP_004149231.1| PREDICTED: PHD finger protein ALFIN-LIKE 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|118482703|gb|ABK93270.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224139112|ref|XP_002322983.1| predicted protein [Populus trichocarpa] gi|222867613|gb|EEF04744.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449439888|ref|XP_004137717.1| PREDICTED: PHD finger protein ALFIN-LIKE 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388515281|gb|AFK45702.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|363806774|ref|NP_001242535.1| uncharacterized protein LOC100779170 [Glycine max] gi|255639560|gb|ACU20074.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449533989|ref|XP_004173952.1| PREDICTED: LOW QUALITY PROTEIN: PHD finger protein ALFIN-LIKE 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|307135937|gb|ADN33799.1| phd/F-box containing protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query217
TAIR|locus:2169707241 AL1 "AT5G05610" [Arabidopsis t 0.912 0.821 0.592 1.7e-59
TAIR|locus:2074663246 AL2 "AT3G11200" [Arabidopsis t 0.912 0.804 0.589 3.5e-59
UNIPROTKB|Q40359257 ALFIN-1 "PHD finger protein Al 0.428 0.361 0.610 6.1e-52
TAIR|locus:2056281256 AL6 "AT2G02470" [Arabidopsis t 0.428 0.363 0.610 1.6e-51
TAIR|locus:2179709255 AL4 "AT5G26210" [Arabidopsis t 0.442 0.376 0.58 2.6e-51
TAIR|locus:2149867260 AL5 "AT5G20510" [Arabidopsis t 0.428 0.357 0.568 7.7e-50
TAIR|locus:2012577252 AL7 "AT1G14510" [Arabidopsis t 0.898 0.773 0.482 1.1e-48
TAIR|locus:2099321250 AL3 "AT3G42790" [Arabidopsis t 0.907 0.788 0.478 1.8e-48
UNIPROTKB|J3QQQ8 420 BPTF "Nucleosome-remodeling fa 0.202 0.104 0.477 9.5e-09
UNIPROTKB|B0QZE1148 PHF8 "Histone lysine demethyla 0.225 0.331 0.428 1.6e-08
TAIR|locus:2169707 AL1 "AT5G05610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 610 (219.8 bits), Expect = 1.7e-59, P = 1.7e-59
 Identities = 118/199 (59%), Positives = 129/199 (64%)

Query:    20 DKENLCLYGHPNESWXXXXXXXXXXXXXXXXXXGINFARDGMNRKDWLSLVAVHTDSWLL 79
             + ENLCLYGHPN +W                  GINFARDGM RKDWLSLVAVH+D WLL
Sbjct:    43 EMENLCLYGHPNGTWEVNLPAEEVPPELPEPALGINFARDGMQRKDWLSLVAVHSDCWLL 102

Query:    80 SVAFYLGARLNRNERKRLFSLINDQPTVFEVVTERXXXXXXXXXXXXXXXXXXXXXXN-D 138
             SV+ Y GARLNRNERKRLFSLIND PT+FEVVT R                      + +
Sbjct:   103 SVSSYFGARLNRNERKRLFSLINDLPTLFEVVTGRKPIKDGKPSMDLGSKSRNGVKRSIE 162

Query:   139 GQVKSNPKLAXXXXXXXXXXXXXTLCGSCGGNYNADEFWIGCDICERWFHGKCVKITPAK 198
             GQ KS PKL              TLCGSCGGNY  DEFWI CD+CERW+HGKCVKITPAK
Sbjct:   163 GQTKSTPKLMEESYEDEDDEHGDTLCGSCGGNYTNDEFWICCDVCERWYHGKCVKITPAK 222

Query:   199 AENIKQYKCPSCSMKRGRQ 217
             AE+IKQYKCPSC  K+GRQ
Sbjct:   223 AESIKQYKCPSCCTKKGRQ 241
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0035064 "methylated histone residue binding" evidence=IDA
TAIR|locus:2074663 AL2 "AT3G11200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40359 ALFIN-1 "PHD finger protein Alfin1" [Medicago sativa (taxid:3879)] Back     alignment and assigned GO terms
TAIR|locus:2056281 AL6 "AT2G02470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179709 AL4 "AT5G26210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149867 AL5 "AT5G20510" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012577 AL7 "AT1G14510" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099321 AL3 "AT3G42790" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|J3QQQ8 BPTF "Nucleosome-remodeling factor subunit BPTF" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B0QZE1 PHF8 "Histone lysine demethylase PHF8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B8B8I3ALFL2_ORYSINo assigned EC number0.74120.90320.8032N/Ano
B8AMA8ALFL3_ORYSINo assigned EC number0.72910.88010.7732N/Ano
Q75IR6ALFL1_ORYSJNo assigned EC number0.68650.91240.7674yesno
Q9FFF5ALFL1_ARATHNo assigned EC number0.79390.91240.8215yesno
Q9SRM4ALFL2_ARATHNo assigned EC number0.77720.91240.8048nono
Q8H383ALFL2_ORYSJNo assigned EC number0.74120.90320.8032nono

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_kg.C_LG_XVI000040
SubName- Full=Putative uncharacterized protein; (236 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query217
pfam12165137 pfam12165, DUF3594, Domain of unknown function (DU 2e-65
smart0024947 smart00249, PHD, PHD zinc finger 2e-09
pfam0062851 pfam00628, PHD, PHD-finger 1e-08
>gnl|CDD|221449 pfam12165, DUF3594, Domain of unknown function (DUF3594) Back     alignment and domain information 
 Score =  198 bits (504), Expect = 2e-65
 Identities = 82/95 (86%), Positives = 86/95 (90%), Gaps = 2/95 (2%)

Query: 20  DKENLCLYGHPNESWEVTLPAEEVPPELPEPALGINFARDGMNRKDWLSLVAVHTDSWLL 79
           +KENLCLYG PNESWEV LPAEEVPPELPEPALGINFARDGM  KDWLSLVAVH+DSWLL
Sbjct: 35  EKENLCLYGLPNESWEVNLPAEEVPPELPEPALGINFARDGMQEKDWLSLVAVHSDSWLL 94

Query: 80  SVAFYLGAR--LNRNERKRLFSLINDQPTVFEVVT 112
           SVAFY GAR   NRN+RKRLFS+IND PTVFEVVT
Sbjct: 95  SVAFYFGARFGFNRNDRKRLFSMINDLPTVFEVVT 129

This presumed domain is functionally uncharacterized.This domain family is found in eukaryotes, and is approximately 140 amino acids in length. The family is found in association with pfam00628. Length = 137
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 217
PF12165137 DUF3594: Domain of unknown function (DUF3594); Int 100.0
KOG1632345 consensus Uncharacterized PHD Zn-finger protein [G 99.97
KOG1973274 consensus Chromatin remodeling protein, contains P 99.16
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 99.06
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.96
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 98.89
KOG4323 464 consensus Polycomb-like PHD Zn-finger protein [Gen 97.79
KOG1632 345 consensus Uncharacterized PHD Zn-finger protein [G 97.46
KOG1844 508 consensus PHD Zn-finger proteins [General function 97.25
KOG0825 1134 consensus PHD Zn-finger protein [General function 96.73
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 96.22
KOG1512381 consensus PHD Zn-finger protein [General function 96.22
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 95.91
KOG2752 345 consensus Uncharacterized conserved protein, conta 95.44
KOG0383 696 consensus Predicted helicase [General function pre 95.16
PF07227 446 DUF1423: Protein of unknown function (DUF1423); In 94.75
KOG0954 893 consensus PHD finger protein [General function pre 94.72
KOG4299 613 consensus PHD Zn-finger protein [General function 94.57
KOG1245 1404 consensus Chromatin remodeling complex WSTF-ISWI, 94.53
PF0749650 zf-CW: CW-type Zinc Finger; InterPro: IPR011124 Zi 94.42
KOG0957 707 consensus PHD finger protein [General function pre 93.95
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 93.59
KOG1244336 consensus Predicted transcription factor Requiem/N 93.5
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 92.23
KOG0957 707 consensus PHD finger protein [General function pre 91.73
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 90.67
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 88.09
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 86.79
PF13901202 DUF4206: Domain of unknown function (DUF4206) 86.69
PF0764930 C1_3: C1-like domain; InterPro: IPR011424 This sho 86.45
PF1377190 zf-HC5HC2H: PHD-like zinc-binding domain 81.09
COG5141 669 PHD zinc finger-containing protein [General functi 80.4
KOG0956 900 consensus PHD finger protein AF10 [General functio 80.17
>PF12165 DUF3594: Domain of unknown function (DUF3594); InterPro: IPR021998 This presumed domain is functionally uncharacterised Back     alignment and domain information 
Probab=100.00  E-value=1.3e-71  Score=447.55  Aligned_cols=100  Identities=81%  Similarity=1.357  Sum_probs=98.3

Q ss_pred             EeecCCCcceeeeccCCCceeEeCCCCCCCCCCCCCcccccccCCCCCcccchhheehccchHHHHHHHHhhcc--cChh
Q 027884           15 AFRALDKENLCLYGHPNESWEVTLPAEEVPPELPEPALGINFARDGMNRKDWLSLVAVHTDSWLLSVAFYLGAR--LNRN   92 (217)
Q Consensus        15 ~~~~~~~~~l~lyg~~~~~w~v~~p~~~~p~~~pep~~gin~~rd~m~~~~wl~~va~h~d~wl~~~a~~~~~~--~~~~   92 (217)
                      .+|||+||||||||+|||+|||+||+||||||||||+||||||||||+|+||||||||||||||||||||||||  ||++
T Consensus        30 ~~CDP~kenLCLYG~p~~~WeV~lP~eevPpeLPEPaLGINfaRDgM~r~dWLslVAvHsDsWLlsvAfy~gar~~~~~~  109 (137)
T PF12165_consen   30 QQCDPEKENLCLYGHPDGTWEVNLPAEEVPPELPEPALGINFARDGMQRKDWLSLVAVHSDSWLLSVAFYFGARFGFDKN  109 (137)
T ss_pred             HhcCccccceEEecCCCCCeEEeCChHhCCCCCCCcccCcccccCCccHHHHHHHHHHhccHHHHHHHHHHHHhhccChH
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999999  7999


Q ss_pred             hhhhhhhhccCCCchhhhhhcc
Q 027884           93 ERKRLFSLINDQPTVFEVVTER  114 (217)
Q Consensus        93 ~r~rLf~mIndLPTVfEvVtg~  114 (217)
                      +|+|||+|||+||||||||||+
T Consensus       110 ~R~rLF~mIN~lpTv~Evv~g~  131 (137)
T PF12165_consen  110 ERKRLFSMINDLPTVFEVVTGR  131 (137)
T ss_pred             HHHHHHHHHhcCchHHHHHhcc
Confidence            9999999999999999999994

This domain family is found in eukaryotes, and is approximately 140 amino acids in length. The family is found in association with PF00628 from PFAM.
>KOG1632 consensus Uncharacterized PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1632 consensus Uncharacterized PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1844 consensus PHD Zn-finger proteins [General function prediction only] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG2752 consensus Uncharacterized conserved protein, contains N-recognin-type Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>PF07227 DUF1423: Protein of unknown function (DUF1423); InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp [] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>PF07496 zf-CW: CW-type Zinc Finger; InterPro: IPR011124 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>PF13901 DUF4206: Domain of unknown function (DUF4206) Back     alignment and domain information
>PF07649 C1_3: C1-like domain; InterPro: IPR011424 This short domain is rich in cysteines and histidines Back     alignment and domain information
>PF13771 zf-HC5HC2H: PHD-like zinc-binding domain Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query217
1we9_A64 Solution Structure Of Phd Domain In Nucleic Acid Bi 1e-19
3qzv_A 174 Crystal Structure Of Bptf Phd-Linker-Bromo In Compl 2e-08
2f6j_A 174 Crystal Structure Of Phd Finger-Linker-Bromodomain 2e-08
2fui_A62 Nmr Solution Structure Of Phd Finger Fragment Of Hu 2e-08
3kv4_A 447 Structure Of Phf8 In Complex With Histone H3 Length 8e-08
3kv5_D 488 Structure Of Kiaa1718, Human Jumonji Demethylase, I 1e-07
2ri7_A 174 Crystal Structure Of Phd Finger-Linker-Bromodomain 2e-07
3kqi_A75 Crystal Structure Of Phf2 Phd Domain Complexed With 3e-06
1wep_A79 Solution Structure Of Phd Domain In Phf8 Length = 7 5e-06
1wem_A76 Solution Structure Of Phd Domain In Death Inducer- 1e-04
>pdb|1WE9|A Chain A, Solution Structure Of Phd Domain In Nucleic Acid Binding Protein-like Np_197993 Length = 64 Back     alignment and structure 
Iteration: 1

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 41/52 (78%), Positives = 46/52 (88%)
Query: 164 CGSCGGNYNADEFWIGCDICERWFHGKCVKITPAKAENIKQYKCPSCSMKRG 215
           CG+CG +Y ADEFWI CD+CE WFHGKCVKITPA+AE+IKQYKCPSCS K G
Sbjct: 9   CGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNKSG 60
>pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 Back     alignment and structure
>pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 Back     alignment and structure
>pdb|2FUI|A Chain A, Nmr Solution Structure Of Phd Finger Fragment Of Human Bptf In Free State Length = 62 Back     alignment and structure
>pdb|3KV4|A Chain A, Structure Of Phf8 In Complex With Histone H3 Length = 447 Back     alignment and structure
>pdb|3KV5|D Chain D, Structure Of Kiaa1718, Human Jumonji Demethylase, In Complex With N-Oxalylglycine Length = 488 Back     alignment and structure
>pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 Back     alignment and structure
>pdb|3KQI|A Chain A, Crystal Structure Of Phf2 Phd Domain Complexed With H3k4me3 Peptide Length = 75 Back     alignment and structure
>pdb|1WEP|A Chain A, Solution Structure Of Phd Domain In Phf8 Length = 79 Back     alignment and structure
>pdb|1WEM|A Chain A, Solution Structure Of Phd Domain In Death Inducer- Obliterator 1(Dio-1) Length = 76 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query217
1we9_A64 PHD finger family protein; structural genomics, PH 5e-25
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 7e-19
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 1e-18
2k16_A75 Transcription initiation factor TFIID subunit 3; p 4e-18
3kv5_D 488 JMJC domain-containing histone demethylation prote 9e-18
1wem_A76 Death associated transcription factor 1; structura 1e-17
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 5e-17
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 4e-16
1wee_A72 PHD finger family protein; structural genomics, PH 3e-14
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 5e-14
3o70_A68 PHD finger protein 13; PHF13, structural genomics 2e-12
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 6e-11
3lqh_A 183 Histone-lysine N-methyltransferase MLL; PHD finger 2e-10
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 2e-10
2ri7_A 174 Nucleosome-remodeling factor subunit BPTF; zinc fi 1e-09
1wew_A78 DNA-binding family protein; structural genomics, P 5e-09
1weu_A91 Inhibitor of growth family, member 4; structural g 2e-08
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 2e-07
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 2e-07
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 2e-06
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 3e-06
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 1e-04
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 2e-04
1x4i_A70 Inhibitor of growth protein 3; structural genomics 2e-04
3u5n_A 207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 5e-04
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 Back     alignment and structure
 Score = 92.2 bits (229), Expect = 5e-25
 Identities = 42/59 (71%), Positives = 47/59 (79%)

Query: 157 DEHSETLCGSCGGNYNADEFWIGCDICERWFHGKCVKITPAKAENIKQYKCPSCSMKRG 215
              S   CG+CG +Y ADEFWI CD+CE WFHGKCVKITPA+AE+IKQYKCPSCS K G
Sbjct: 2   SSGSSGQCGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNKSG 60
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Length = 528 Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Length = 447 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Length = 52 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Length = 52 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 78 Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Length = 65 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Length = 68 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Length = 90 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query217
1we9_A64 PHD finger family protein; structural genomics, PH 99.73
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 99.62
1wew_A78 DNA-binding family protein; structural genomics, P 99.6
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 99.59
1wee_A72 PHD finger family protein; structural genomics, PH 99.59
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 99.57
1wem_A76 Death associated transcription factor 1; structura 99.54
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 99.54
3o70_A68 PHD finger protein 13; PHF13, structural genomics 99.53
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 99.51
1weu_A91 Inhibitor of growth family, member 4; structural g 99.5
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 99.48
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 99.47
2k16_A75 Transcription initiation factor TFIID subunit 3; p 99.47
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 99.44
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 99.39
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 99.37
2ri7_A 174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.35
3kv5_D 488 JMJC domain-containing histone demethylation prote 99.34
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 99.34
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 99.31
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 99.29
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 99.23
1x4i_A70 Inhibitor of growth protein 3; structural genomics 99.19
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 99.03
3lqh_A 183 Histone-lysine N-methyltransferase MLL; PHD finger 98.94
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 98.82
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 98.74
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 98.73
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 98.67
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 98.62
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 98.62
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 98.62
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 98.61
2yt5_A66 Metal-response element-binding transcription facto 98.56
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 98.54
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 98.53
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 98.46
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 98.35
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 98.25
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 98.21
3rsn_A 177 SET1/ASH2 histone methyltransferase complex subun; 98.21
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.19
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 98.11
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.09
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 98.03
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.02
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 97.97
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 97.93
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 97.62
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 97.21
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 96.8
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 96.46
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 95.85
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 94.34
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 94.27
2ect_A78 Ring finger protein 126; metal binding protein, st 92.49
2ecm_A55 Ring finger and CHY zinc finger domain- containing 92.4
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 91.66
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 91.28
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 90.79
2e61_A69 Zinc finger CW-type PWWP domain protein 1; ZF-CW d 90.1
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 89.78
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 89.62
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 88.06
1wil_A89 KIAA1045 protein; ring finger domain, structural g 87.58
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 87.31
2l7p_A100 Histone-lysine N-methyltransferase ASHH2; CW-domai 87.28
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 84.67
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 83.35
2lq6_A87 Bromodomain-containing protein 1; PHD finger, meta 83.1
2ysl_A73 Tripartite motif-containing protein 31; ring-type 82.6
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 80.59
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 80.58
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
Probab=99.73  E-value=7e-19  Score=124.03  Aligned_cols=60  Identities=70%  Similarity=1.408  Sum_probs=53.1

Q ss_pred             ccCCceeCccCCCCCCCCceEeccCCCCeeeccccccCccccCCCCeEEcCCCCCcCCCC
Q 027884          158 EHSETLCGSCGGNYNADEFWIGCDICERWFHGKCVKITPAKAENIKQYKCPSCSMKRGRQ  217 (217)
Q Consensus       158 e~~~~~C~iC~~py~~d~~mIqCD~Ce~WfH~~CVgIt~~~a~~~d~y~Cp~C~~kr~r~  217 (217)
                      +.+..+|++|+++|+++++|||||.|+.|||+.|||++...++.++.|+|+.|..|++|+
T Consensus         3 ~~e~~~C~~C~~~~~~~~~mI~Cd~C~~WfH~~Cvgl~~~~~~~~~~~~C~~C~~k~~~~   62 (64)
T 1we9_A            3 SGSSGQCGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNKSGPS   62 (64)
T ss_dssp             CSSCCCCSSSCCCCCSSSCEEECSSSCCEEETTTTTCCTTGGGGCSSCCCHHHHTTTCSS
T ss_pred             CCCCCCCCCCCCccCCCCCEEEccCCCCCCCccccCcChhHhcCCCcEECCCCcCcCCCC
Confidence            345678999999998789999999999999999999998877667899999999998874
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e61_A Zinc finger CW-type PWWP domain protein 1; ZF-CW domain, structural genomics, NPPSFA, national project protein structural and functional analyses; NMR {Homo sapiens} PDB: 2rr4_A* Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l7p_A Histone-lysine N-methyltransferase ASHH2; CW-domain; NMR {Arabidopsis thaliana} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2lq6_A Bromodomain-containing protein 1; PHD finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 217
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 2e-16
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 8e-15
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 7e-12
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 2e-11
d1wewa_78 g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c 1e-09
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 1e-06
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 5e-06
d2pnxa151 g.50.1.2 (A:195-245) Inhibitor of growth protein 4 7e-05
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 1e-04
d1wesa_71 g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I 2e-04
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 0.001
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: PHD finger protein At5g26210
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 68.9 bits (168), Expect = 2e-16
 Identities = 42/56 (75%), Positives = 47/56 (83%)

Query: 160 SETLCGSCGGNYNADEFWIGCDICERWFHGKCVKITPAKAENIKQYKCPSCSMKRG 215
           S   CG+CG +Y ADEFWI CD+CE WFHGKCVKITPA+AE+IKQYKCPSCS K G
Sbjct: 5   SSGQCGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNKSG 60
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query217
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 99.54
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 99.46
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 99.41
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 99.3
d1wema_76 Death associated transcription factor 1, Datf1 (DI 99.26
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 99.17
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 99.13
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 99.01
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.99
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 98.92
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 98.53
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 95.71
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 94.29
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 90.55
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 85.1
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 82.31
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: PHD finger protein 8
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.54  E-value=1.5e-15  Score=109.92  Aligned_cols=54  Identities=39%  Similarity=0.978  Sum_probs=47.4

Q ss_pred             CCceeCccCCCCCCCCceEeccCCCCeeeccccccCccccCCCCeEEcCCCCCcC
Q 027884          160 SETLCGSCGGNYNADEFWIGCDICERWFHGKCVKITPAKAENIKQYKCPSCSMKR  214 (217)
Q Consensus       160 ~~~~C~iC~~py~~d~~mIqCD~Ce~WfH~~CVgIt~~~a~~~d~y~Cp~C~~kr  214 (217)
                      ..++| +|+++++.+++||+||.|+.|||..|++++...+...+.|+|+.|..+.
T Consensus        11 ~pv~C-iC~~~~~~~~~mI~Cd~C~~W~H~~C~g~~~~~~~~~~~~~C~~C~~~~   64 (79)
T d1wepa_          11 VPVYC-LCRQPYNVNHFMIECGLCQDWFHGSCVGIEEENAVDIDIYHCPDCEAVF   64 (79)
T ss_dssp             CCCCS-TTSCSCCSSSCEEEBTTTCCEEEHHHHTCCHHHHTTCSBBCCTTTTTTS
T ss_pred             CCeEe-ECCCccCCCCcEEECCCCCCcEeccccCcchhcCCCCCEEECccCcCCc
Confidence            34556 9999998888999999999999999999998877777889999998754
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure