Citrus Sinensis ID: 027951
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 216 | ||||||
| 356502862 | 213 | PREDICTED: uncharacterized protein LOC10 | 0.953 | 0.967 | 0.549 | 2e-58 | |
| 356536615 | 395 | PREDICTED: uncharacterized protein LOC10 | 0.953 | 0.521 | 0.539 | 7e-58 | |
| 224111120 | 214 | predicted protein [Populus trichocarpa] | 0.847 | 0.855 | 0.601 | 2e-57 | |
| 255552065 | 240 | conserved hypothetical protein [Ricinus | 0.953 | 0.858 | 0.518 | 3e-54 | |
| 297737101 | 212 | unnamed protein product [Vitis vinifera] | 0.972 | 0.990 | 0.5 | 6e-53 | |
| 356535976 | 208 | PREDICTED: uncharacterized protein LOC10 | 0.930 | 0.966 | 0.516 | 7e-53 | |
| 359477359 | 225 | PREDICTED: uncharacterized protein LOC10 | 0.870 | 0.835 | 0.515 | 1e-49 | |
| 224099833 | 190 | predicted protein [Populus trichocarpa] | 0.851 | 0.968 | 0.553 | 4e-49 | |
| 297800742 | 214 | hypothetical protein ARALYDRAFT_493423 [ | 0.925 | 0.934 | 0.473 | 1e-46 | |
| 79580566 | 212 | uncharacterized protein [Arabidopsis tha | 0.916 | 0.933 | 0.483 | 7e-42 |
| >gi|356502862|ref|XP_003520234.1| PREDICTED: uncharacterized protein LOC100802013 [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 231 bits (589), Expect = 2e-58, Method: Compositional matrix adjust.
Identities = 116/211 (54%), Positives = 150/211 (71%), Gaps = 5/211 (2%)
Query: 3 MASVSVIAFLAIFFVLQPLTAPSNFLSPLSPLLAPAFENVCDKVTCGKGKCKASQNSTFF 62
MA SV+A +A F +LQPL+A S+ LSPL L+P F++VC +V CGKG CK S+NSTFF
Sbjct: 1 MAFASVVAIVA-FLLLQPLSATSDLLSPL---LSPIFDDVCKEVECGKGTCKPSKNSTFF 56
Query: 63 YECECDLGWKQNTMAVDQNLKFLPCIAPDCTLNQDCAPSPSPAQEKAAKKNESIFDLCRW 122
+ECEC GWK+ LKFLPCI P+CTL+ C+ +P+P QEK+ K NESIFD C W
Sbjct: 57 FECECHPGWKRAPSNDKMGLKFLPCIVPNCTLDYSCSKAPAPVQEKSTKSNESIFDACHW 116
Query: 123 IDCGGGSCKNTSMFSYSCQCAVDHYNLLNTSTFPCYKECSIGMDCKNMGISVPLPPPPPP 182
IDCGGGSC TS FSYSC+C V + NLLN +TFPC++ECS+G+ C +GISV P
Sbjct: 117 IDCGGGSCNKTSKFSYSCECDVGYDNLLNVTTFPCFRECSLGLGCSELGISVKNSSTSAP 176
Query: 183 PTSLADSSENQAASNLLGNAHWLILLTWSLA 213
PT L D+S+N+ +S L GN+ L++L +A
Sbjct: 177 PT-LNDNSKNEGSSILQGNSLRLVMLIMFVA 206
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356536615|ref|XP_003536832.1| PREDICTED: uncharacterized protein LOC100807319 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224111120|ref|XP_002315754.1| predicted protein [Populus trichocarpa] gi|222864794|gb|EEF01925.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255552065|ref|XP_002517077.1| conserved hypothetical protein [Ricinus communis] gi|223543712|gb|EEF45240.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297737101|emb|CBI26302.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356535976|ref|XP_003536517.1| PREDICTED: uncharacterized protein LOC100816071 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359477359|ref|XP_002279253.2| PREDICTED: uncharacterized protein LOC100263116 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224099833|ref|XP_002311637.1| predicted protein [Populus trichocarpa] gi|222851457|gb|EEE89004.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297800742|ref|XP_002868255.1| hypothetical protein ARALYDRAFT_493423 [Arabidopsis lyrata subsp. lyrata] gi|297314091|gb|EFH44514.1| hypothetical protein ARALYDRAFT_493423 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|79580566|ref|NP_680687.2| uncharacterized protein [Arabidopsis thaliana] gi|332658093|gb|AEE83493.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 216 | ||||||
| TAIR|locus:504955446 | 212 | AT4G14746 "AT4G14746" [Arabido | 0.777 | 0.792 | 0.505 | 6.2e-46 |
| TAIR|locus:504955446 AT4G14746 "AT4G14746" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 482 (174.7 bits), Expect = 6.2e-46, P = 6.2e-46
Identities = 89/176 (50%), Positives = 115/176 (65%)
Query: 40 ENVCDKVTCGKGKCKASQNSTFFYECECDLGWKQNTMAVDQNLKFLPCIAPDCTLNQDCA 99
+N+C +V CGKGKCKA N+TF YECEC+ GWKQ DQ+LKFLPCI P+CT + C
Sbjct: 36 DNICKEVECGKGKCKAPSNTTFMYECECEDGWKQ----FDQHLKFLPCITPNCTFDLTCG 91
Query: 100 PSPSPAQEKAAKKNE--SIFDLCRWIDCGGGSCKNTSMFSYSCQCAVDHYNLLNTSTFPC 157
+ SPAQ K K+ S FD C+W+DCGGG C ++ F YSC C + NL+N +TFPC
Sbjct: 92 EAASPAQPKPPPKDNITSFFDPCQWMDCGGGLCNSSMPFQYSCNCREGYSNLMNITTFPC 151
Query: 158 YKECSIGMDCKNMGISVXXXXXXXXXTSLADSSENQAASNLLGNAHWLILLTWSLA 213
K+C++GMDC N+GI + +L DSS+NQ NL G++ W I L SLA
Sbjct: 152 LKQCALGMDCLNLGIPLSNSSSSSP-PALPDSSKNQGL-NLRGSSLWWITLCVSLA 205
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.321 0.132 0.431 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 216 190 0.00091 110 3 11 22 0.41 32
31 0.42 35
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 613 (65 KB)
Total size of DFA: 193 KB (2107 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 16.17u 0.17s 16.34t Elapsed: 00:00:01
Total cpu time: 16.17u 0.17s 16.34t Elapsed: 00:00:01
Start: Tue May 21 02:56:40 2013 End: Tue May 21 02:56:41 2013
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pg.C_LG_X000758 | hypothetical protein (214 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 216 | |||
| KOG1219 | 4289 | consensus Uncharacterized conserved protein, conta | 99.32 | |
| KOG4289 | 2531 | consensus Cadherin EGF LAG seven-pass G-type recep | 98.84 | |
| KOG4289 | 2531 | consensus Cadherin EGF LAG seven-pass G-type recep | 98.28 | |
| KOG1219 | 4289 | consensus Uncharacterized conserved protein, conta | 98.11 | |
| KOG1214 | 1289 | consensus Nidogen and related basement membrane pr | 98.1 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 97.95 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 97.94 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 97.77 | |
| KOG1217 | 487 | consensus Fibrillins and related proteins containi | 97.68 | |
| KOG1217 | 487 | consensus Fibrillins and related proteins containi | 97.64 | |
| KOG1225 | 525 | consensus Teneurin-1 and related extracellular mat | 97.61 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 97.59 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 97.4 | |
| KOG1225 | 525 | consensus Teneurin-1 and related extracellular mat | 97.38 | |
| KOG4260 | 350 | consensus Uncharacterized conserved protein [Funct | 97.31 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 97.29 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 97.16 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 97.11 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 96.92 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 96.88 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 96.85 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 96.73 | |
| KOG1214 | 1289 | consensus Nidogen and related basement membrane pr | 96.47 | |
| KOG1226 | 783 | consensus Integrin beta subunit (N-terminal portio | 96.3 | |
| KOG1226 | 783 | consensus Integrin beta subunit (N-terminal portio | 96.3 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 96.21 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 95.83 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 95.79 | |
| PHA03099 | 139 | epidermal growth factor-like protein (EGF-like pro | 95.73 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 95.44 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 95.34 | |
| PF06247 | 197 | Plasmod_Pvs28: Plasmodium ookinete surface protein | 94.74 | |
| PHA02887 | 126 | EGF-like protein; Provisional | 93.99 | |
| KOG4260 | 350 | consensus Uncharacterized conserved protein [Funct | 93.51 | |
| PHA02887 | 126 | EGF-like protein; Provisional | 92.24 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 91.27 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 90.41 | |
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 89.03 | |
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 89.02 | |
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 85.97 | |
| PHA03099 | 139 | epidermal growth factor-like protein (EGF-like pro | 84.71 | |
| smart00051 | 63 | DSL delta serrate ligand. | 84.2 | |
| PF00954 | 110 | S_locus_glycop: S-locus glycoprotein family; Inter | 84.19 | |
| PF06247 | 197 | Plasmod_Pvs28: Plasmodium ookinete surface protein | 83.13 |
| >KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=99.32 E-value=1.7e-12 Score=138.66 Aligned_cols=103 Identities=23% Similarity=0.475 Sum_probs=90.0
Q ss_pred cCCCccCCCCCC-eeeccCCCCCcceeecCCCCccCccc-ccCCCccCCccCC-CCCC---CCCCCCCCCCcccccccCC
Q 027951 40 ENVCDKVTCGKG-KCKASQNSTFFYECECDLGWKQNTMA-VDQNLKFLPCIAP-DCTL---NQDCAPSPSPAQEKAAKKN 113 (216)
Q Consensus 40 ~~~C~~~~Cg~G-tC~~~~~~~~~Y~C~C~pGwtg~~c~-~~d~~~~lPC~ip-nCt~---n~sC~~~~~~~~~~~~~~n 113 (216)
.++|+..+|+|| +|..+. ..+|.|+|.+-|+|.+|+ ++..|.+.||-.+ .|.. ++.|.|..++ |++.
T Consensus 3864 ~d~C~~npCqhgG~C~~~~--~ggy~CkCpsqysG~~CEi~~epC~snPC~~GgtCip~~n~f~CnC~~gy-----TG~~ 3936 (4289)
T KOG1219|consen 3864 TDPCNDNPCQHGGTCISQP--KGGYKCKCPSQYSGNHCEIDLEPCASNPCLTGGTCIPFYNGFLCNCPNGY-----TGKR 3936 (4289)
T ss_pred ccccccCcccCCCEecCCC--CCceEEeCcccccCcccccccccccCCCCCCCCEEEecCCCeeEeCCCCc-----cCce
Confidence 489999999985 999874 569999999999999999 5889999999987 7985 5899998888 5665
Q ss_pred -C-CcCCCCCCCCcC-CCeeecCCCCceeeecCCCCcCCC
Q 027951 114 -E-SIFDLCRWIDCG-GGSCKNTSMFSYSCQCAVDHYNLL 150 (216)
Q Consensus 114 -~-s~~DPC~~~~Cg-gGtCv~~~~~sY~C~C~~Gy~nll 150 (216)
| +-+++|..+.|+ +|+|++.. ++|+|.|.+||.|++
T Consensus 3937 Ce~~Gi~eCs~n~C~~gg~C~n~~-gsf~CncT~g~~gr~ 3975 (4289)
T KOG1219|consen 3937 CEARGISECSKNVCGTGGQCINIP-GSFHCNCTPGILGRT 3975 (4289)
T ss_pred eecccccccccccccCCceeeccC-CceEeccChhHhccc
Confidence 3 337999999999 88999975 799999999999987
|
|
| >KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >KOG1217 consensus Fibrillins and related proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1217 consensus Fibrillins and related proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1225 consensus Teneurin-1 and related extracellular matrix proteins, contain EGF-like repeats [Signal transduction mechanisms; Extracellular structures] | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >KOG1225 consensus Teneurin-1 and related extracellular matrix proteins, contain EGF-like repeats [Signal transduction mechanisms; Extracellular structures] | Back alignment and domain information |
|---|
| >KOG4260 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] | Back alignment and domain information |
|---|
| >KOG1226 consensus Integrin beta subunit (N-terminal portion of extracellular region) [Signal transduction mechanisms; Extracellular structures] | Back alignment and domain information |
|---|
| >KOG1226 consensus Integrin beta subunit (N-terminal portion of extracellular region) [Signal transduction mechanisms; Extracellular structures] | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium | Back alignment and domain information |
|---|
| >PHA02887 EGF-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4260 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PHA02887 EGF-like protein; Provisional | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >PF00954 S_locus_glycop: S-locus glycoprotein family; InterPro: IPR000858 In Brassicaceae, self-incompatible plants have a self/non-self recognition system, which involves the inability of flowering plants to achieve self-fertilisation | Back alignment and domain information |
|---|
| >PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 216 | |||
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.6 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.59 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 99.48 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 99.32 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 99.29 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 99.28 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 99.25 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 99.25 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 99.24 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.23 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 99.21 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 99.19 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 99.15 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 99.12 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 99.01 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 99.01 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 99.01 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 98.99 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 98.95 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 98.94 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 98.92 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 98.88 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 98.86 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 98.84 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 98.78 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 98.76 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 98.73 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 98.71 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 98.65 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 98.62 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 98.43 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 98.41 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 98.41 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 98.35 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 98.33 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 98.25 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 98.24 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 98.22 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 98.19 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 98.13 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 98.12 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 98.12 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 98.08 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 98.02 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 98.01 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 98.01 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 97.98 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 97.93 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 97.89 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 97.86 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 97.85 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 97.81 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 97.75 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 97.74 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 97.74 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 97.72 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 97.69 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 97.69 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 97.58 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 97.58 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 97.55 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 97.52 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 97.51 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 97.47 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 97.42 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 97.41 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 97.36 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 97.34 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 97.33 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 97.31 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 97.25 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 97.24 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 97.19 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 97.17 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 97.13 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 97.11 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 97.0 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 97.0 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 96.97 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 96.97 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 96.93 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 96.91 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 96.9 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 96.89 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 96.8 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 96.7 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 96.64 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 96.56 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 96.52 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 96.48 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 96.42 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 96.39 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 96.38 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 96.35 | |
| 1ob1_C | 99 | Major merozoite surface protein; immune system, im | 96.31 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 96.15 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 96.13 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 96.11 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 96.1 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 96.01 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 96.0 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 95.92 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 95.73 | |
| 1n1i_A | 105 | Merozoite surface protein-1; MSP1, malaria, surfac | 95.69 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 95.62 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 95.6 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 95.59 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 95.59 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 95.49 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 95.48 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 95.34 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 95.3 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 95.21 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 94.96 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 94.91 | |
| 2p26_A | 280 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 94.48 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 94.2 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 93.86 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 93.69 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 93.6 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 93.57 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 93.44 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 93.42 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 93.4 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 93.18 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 93.16 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 93.03 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 92.76 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 91.61 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 91.58 | |
| 2e26_A | 725 | Reelin, reeler protein; signaling protein; HET: NA | 91.5 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 91.11 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 90.99 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 90.22 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 89.51 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 88.69 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 88.33 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 88.08 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 87.59 | |
| 1ob1_C | 99 | Major merozoite surface protein; immune system, im | 87.12 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 84.68 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 84.02 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 83.35 |
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.60 E-value=9.6e-16 Score=119.82 Aligned_cols=104 Identities=21% Similarity=0.491 Sum_probs=79.3
Q ss_pred CCCccCCCCC-CeeeccCCCCCcceeecCCCCccCcccc-------------cCCCccCCccCC-CCC----------CC
Q 027951 41 NVCDKVTCGK-GKCKASQNSTFFYECECDLGWKQNTMAV-------------DQNLKFLPCIAP-DCT----------LN 95 (216)
Q Consensus 41 ~~C~~~~Cg~-GtC~~~~~~~~~Y~C~C~pGwtg~~c~~-------------~d~~~~lPC~ip-nCt----------~n 95 (216)
|.|+..+|.+ |+|++... ..+|+|+|.+||+|..|+. +++|...||.+. .|. ..
T Consensus 1 d~C~~~pC~~~g~C~~~~~-~g~~~C~C~~G~~G~~C~~~~~~~~~~~~c~~~~~C~~~~C~~~g~C~~~~~~~~~~~~~ 79 (143)
T 4d90_A 1 DICDPNPCENGGICLPGLA-DGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIG 79 (143)
T ss_dssp --CCSCCCGGGCEEEC------CCEEECCTTCCTTTTCSCCCCTTTTTSCCCCCTTSSCCCCTTCEEEECCCEETTEECC
T ss_pred CcCCCCcCCCCCEeeCCCC-CCCEEeECCCCCCCCCCccCccccccccccccCCcCCCCCCCCCCEecCCCccccCCCCC
Confidence 4788999985 79998632 2579999999999999874 356777788754 676 25
Q ss_pred CCCCCCCCCcccccccCC-CCcCCCCCCCCcC-CCeeecCCCCceeeecCCCCcCCCC
Q 027951 96 QDCAPSPSPAQEKAAKKN-ESIFDLCRWIDCG-GGSCKNTSMFSYSCQCAVDHYNLLN 151 (216)
Q Consensus 96 ~sC~~~~~~~~~~~~~~n-~s~~DPC~~~~Cg-gGtCv~~~~~sY~C~C~~Gy~nlln 151 (216)
|.|.+.++| ++.+ +.++|+|..++|. +|+|++.. ++|+|+|++||+|..-
T Consensus 80 ~~C~C~~G~-----~G~~C~~~i~~C~~~~C~~~~~C~~~~-g~~~C~C~~G~~G~~c 131 (143)
T 4d90_A 80 YVCKCPRGF-----NGIHCQHNINECEVEPCKNGGICTDLV-ANYSCECPGEFMGRNC 131 (143)
T ss_dssp EEEECCTTE-----ESTTSCEECCTTTTCCSCTTCEEEEET-TEEEEECCTTCBSTTS
T ss_pred eEeECcCCC-----cCCCcccCCCcCCCCCCCCCCEeECCC-CCeEeECCCCCccCCc
Confidence 788888888 4555 5467999999998 78999875 7999999999999753
|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 216 | |||
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 98.76 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.52 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.52 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.49 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 98.45 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 98.45 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.44 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.43 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 98.42 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.38 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 98.37 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.33 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.31 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 98.3 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.28 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 98.26 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.2 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.17 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.1 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 98.06 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 98.05 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 98.04 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 98.01 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.92 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.88 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.82 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 97.78 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 97.77 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 97.77 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 97.74 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.7 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.48 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.38 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 97.37 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 97.35 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 97.26 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.21 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 97.18 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 97.07 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.0 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.96 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 96.88 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 96.78 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 96.69 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.6 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.57 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 96.49 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 96.4 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 96.38 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 96.38 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 96.32 | |
| d1dx5i1 | 43 | Thrombomodulin, different EGF-like domains {Human | 96.21 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.19 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 96.07 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 96.03 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 95.78 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 95.75 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 95.72 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 95.6 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 95.47 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 95.26 | |
| d1l3ya_ | 41 | Integrin beta EGF-like domains {Human (Homo sapien | 94.85 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 94.73 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 94.61 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 94.23 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 93.88 | |
| d1jv2b5 | 43 | Integrin beta EGF-like domains {Human (Homo sapien | 93.75 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 93.14 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 92.71 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 92.0 | |
| d1jv2b4 | 31 | Integrin beta EGF-like domains {Human (Homo sapien | 91.95 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 91.48 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 89.55 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 89.24 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 86.99 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 86.34 | |
| d1kigl_ | 51 | Factor X, N-terminal module {Cow (Bos taurus) [Tax | 85.5 | |
| d1rfnb_ | 57 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 85.16 | |
| d1jv2b5 | 43 | Integrin beta EGF-like domains {Human (Homo sapien | 84.18 | |
| d1dx5i1 | 43 | Thrombomodulin, different EGF-like domains {Human | 83.96 | |
| d1kigl_ | 51 | Factor X, N-terminal module {Cow (Bos taurus) [Tax | 83.24 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 82.72 |
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Activated protein c (autoprothrombin IIa) species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.76 E-value=1.8e-09 Score=71.61 Aligned_cols=35 Identities=29% Similarity=0.842 Sum_probs=32.1
Q ss_pred cCCCccCCCCCCeeeccCCCCCcceeecCCCCccCccc
Q 027951 40 ENVCDKVTCGKGKCKASQNSTFFYECECDLGWKQNTMA 77 (216)
Q Consensus 40 ~~~C~~~~Cg~GtC~~~~~~~~~Y~C~C~pGwtg~~c~ 77 (216)
.++|.+++|+||+|++. ..+|+|+|.+||+|.+|+
T Consensus 8 ~~~C~~~PC~nG~C~~~---~~~y~C~C~~G~~G~~Ce 42 (48)
T d1autl1 8 EHPCASLCCGHGTCIDG---IGSFSCDCRSGWEGRFCQ 42 (48)
T ss_dssp CCSSSSTTTTSEEECCC---SSCCCEEECTTEESTTSC
T ss_pred CCcccCCCCCCCEEECC---CCCCeEeCCCCCcCCCcc
Confidence 56999999999999987 568999999999999987
|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|