Citrus Sinensis ID: 028040

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-----
MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQAVLEEESGSETTRLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNVKDSGSRLHSLLKEAIMLTGLEKNLFGNHPVSLAVAESRGPPPAFASDPIVNVNASSSPSKDGINITEGYTAPSTVSEIMEIDGPSPAGNFIKSSSPVVRVL
ccccccccccccEEEEEEcccccccccccccccEEEEccccccccccccccccccccHHHHcccccccEEEccccccccHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccEEEEEcccEEEEEEEccccccEEEccccccEEEHHHHHHHHccccccccccEcccccccccccccEEEEEEEEHccHHHHHHHHHHcccccccccccccccccccccccHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccEccc
mvvckcrkatklycfvhkvpvcgecicfpehqicvvrTYSEwvidgeydwppkccqcqavleeesgsettrlgCLHVIHTSCLvshiksfpphtapagyvcplcsttiwppknvkdsgSRLHSLLKEAIMLTGLeknlfgnhpvslavaesrgpppafasdpivnvnassspskdginitegytapstvseimeidgpspagnfikssspvvrvl
mvvckcrkatklycfvhkVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQAVLEEESGSETTRLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNVKDSGSRLHSLLKEAIMLTGLEKNLFGNHPVSLAVAESRGPPPAFASDPIVNVNassspskdginiTEGYTAPSTVSEIMEIDGpspagnfikssspvvrvl
MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQAVLEEESGSETTRLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNVKDSGSRLHSLLKEAIMLTGLEKNLFGNHPVSLAVAESRGPPPAFASDPIVNVNASSSPSKDGINITEGYTAPSTVSEIMEIDGPSPAGNFIKSSSPVVRVL
*VVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQAVLEEESGSETTRLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNVKDSGSRLHSLLKEAIMLTGLEKNLFGNHPVSLA********************************************************************
*VVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQAVLEEESGSETTRLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWP***************************************************************************************************P*****
MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQAVL*********RLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNVKDSGSRLHSLLKEAIMLTGLEKNLFGNHPVSLAVAESRGPPPAFASDPIVNVNASSSPSKDGINITEGYTAPSTVSEIMEIDGPSPAGNFIKS********
*VVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQAVLEEESGSETTRLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNVKDSGSRLHSLLKEAIMLTGLEKNLFGNHPVS*******************************************VSE***IDG******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQAVLEEESGSETTRLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNVKDSGSRLHSLLKEAIMLTGLEKNLFGNHPVSLAVAESRGPPPAFASDPIVNVNASSSPSKDGINITEGYTAPSTVSEIMEIDGPSPAGNFIKSSSPVVRVL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query215 2.2.26 [Sep-21-2011]
A8X2R2 319 Zinc finger protein-like N/A no 0.609 0.410 0.415 2e-22
Q9N4Y9309 Zinc finger protein-like yes no 0.758 0.527 0.371 9e-21
Q0VFM0 320 Zinc finger protein-like yes no 0.502 0.337 0.431 2e-20
A1L2S8 320 Zinc finger protein-like N/A no 0.502 0.337 0.431 4e-20
Q2YDD3 312 Zinc finger protein-like yes no 0.841 0.580 0.329 1e-19
O95159 310 Zinc finger protein-like yes no 0.776 0.538 0.346 3e-19
Q9DB43310 Zinc finger protein-like yes no 0.502 0.348 0.413 9e-19
A7S7Z9252 Zinc finger protein-like N/A no 0.502 0.428 0.405 5e-18
P62447 317 Zinc finger protein-like yes no 0.558 0.378 0.366 2e-17
Q16N38290 Zinc finger protein-like N/A no 0.502 0.372 0.396 2e-16
>sp|A8X2R2|ZFPL1_CAEBR Zinc finger protein-like 1 homolog OS=Caenorhabditis briggsae GN=CBG06644 PE=3 SV=1 Back     alignment and function desciption
 Score =  105 bits (263), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 59/142 (41%), Positives = 77/142 (54%), Gaps = 11/142 (7%)

Query: 1   MVVCKC--RKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQ 58
           M +CKC  RK T L+C+ H+V VC  C+    H  CVV++Y  W+ D +YD  P C  C 
Sbjct: 1   MGLCKCPKRKVTNLFCYEHRVNVCEFCL-VDNHPNCVVQSYLNWLTDQDYD--PNCSLCH 57

Query: 59  AVLEEESGSETTRLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNVKDSG 118
             L +    ET RL CLH++H  C      SFPP TAPAGY CP CS  ++PP N     
Sbjct: 58  TTLTQ---GETIRLNCLHLLHWRCFDDWAASFPPTTAPAGYRCPCCSQEVFPPIN---EV 111

Query: 119 SRLHSLLKEAIMLTGLEKNLFG 140
           S L   L+E +  +   +N  G
Sbjct: 112 SPLIEKLREQLKQSNWARNALG 133

Caenorhabditis briggsae (taxid: 6238)
>sp|Q9N4Y9|ZFPL1_CAEEL Zinc finger protein-like 1 homolog OS=Caenorhabditis elegans GN=Y45G12B.2 PE=3 SV=1 Back     alignment and function description
>sp|Q0VFM0|ZFPL1_XENTR Zinc finger protein-like 1 OS=Xenopus tropicalis GN=zfpl1 PE=2 SV=1 Back     alignment and function description
>sp|A1L2S8|ZFPL1_XENLA Zinc finger protein-like 1 OS=Xenopus laevis GN=zfpl1 PE=2 SV=1 Back     alignment and function description
>sp|Q2YDD3|ZFPL1_BOVIN Zinc finger protein-like 1 OS=Bos taurus GN=ZFPL1 PE=2 SV=1 Back     alignment and function description
>sp|O95159|ZFPL1_HUMAN Zinc finger protein-like 1 OS=Homo sapiens GN=ZFPL1 PE=1 SV=2 Back     alignment and function description
>sp|Q9DB43|ZFPL1_MOUSE Zinc finger protein-like 1 OS=Mus musculus GN=Zfpl1 PE=2 SV=1 Back     alignment and function description
>sp|A7S7Z9|ZFPL1_NEMVE Zinc finger protein-like 1 homolog OS=Nematostella vectensis GN=zfpl1 PE=3 SV=1 Back     alignment and function description
>sp|P62447|ZFPL1_DANRE Zinc finger protein-like 1 OS=Danio rerio GN=zfpl1 PE=2 SV=1 Back     alignment and function description
>sp|Q16N38|ZFPL1_AEDAE Zinc finger protein-like 1 homolog OS=Aedes aegypti GN=AAEL012105 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query215
357444419 339 Zinc finger protein-like protein [Medica 0.958 0.607 0.778 9e-94
363808258 338 uncharacterized protein LOC100775639 [Gl 0.972 0.618 0.798 9e-94
225428977 359 PREDICTED: zinc finger protein-like 1 [V 0.976 0.584 0.755 1e-93
358248676 337 uncharacterized protein LOC100805734 [Gl 0.972 0.620 0.779 1e-92
224060790 325 predicted protein [Populus trichocarpa] 0.948 0.627 0.754 3e-87
297831956 343 hypothetical protein ARALYDRAFT_899703 [ 0.962 0.603 0.723 7e-85
224103737 330 predicted protein [Populus trichocarpa] 0.920 0.6 0.758 9e-85
449438325 359 PREDICTED: zinc finger protein-like 1-li 0.976 0.584 0.675 2e-84
18397649 343 RING/U-box domain-containing protein [Ar 0.962 0.603 0.705 2e-83
15010694 343 At2g14841 [Arabidopsis thaliana] gi|1632 0.962 0.603 0.705 3e-83
>gi|357444419|ref|XP_003592487.1| Zinc finger protein-like protein [Medicago truncatula] gi|355481535|gb|AES62738.1| Zinc finger protein-like protein [Medicago truncatula] Back     alignment and taxonomy information
 Score =  348 bits (893), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 165/212 (77%), Positives = 187/212 (88%), Gaps = 6/212 (2%)

Query: 1   MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQAV 60
           MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICV+RTYSEWVIDGEYDWPPKCCQCQA+
Sbjct: 1   MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVIRTYSEWVIDGEYDWPPKCCQCQAI 60

Query: 61  LEEESGSETTRLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNVKDSGSR 120
           LEE  GSETTRLGCLHVIHT+CLVSHIKSFPPHTAPAGYVCP CST+IWPPK+VKDSGSR
Sbjct: 61  LEEGGGSETTRLGCLHVIHTNCLVSHIKSFPPHTAPAGYVCPSCSTSIWPPKSVKDSGSR 120

Query: 121 LHSLLKEAIMLTGLEKNLFGNHPVSLAVAESRGPPPAFASDPIVNV-NASSSPSKDGINI 179
           LHS LKEAI+ TG+EKN+FGNHPVSL+V ESR PPPAF+SDP+++  N   S S DG  +
Sbjct: 121 LHSKLKEAILQTGMEKNIFGNHPVSLSVTESRSPPPAFSSDPLISRENLGKSVSADGSEL 180

Query: 180 TEGYTAPSTVSEIMEIDGPSPAGNFIKSSSPV 211
           ++      +V++I+EIDG +  GNF+KSSSPV
Sbjct: 181 SK-----LSVTDIVEIDGANSGGNFMKSSSPV 207

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|363808258|ref|NP_001242749.1| uncharacterized protein LOC100775639 [Glycine max] gi|255642399|gb|ACU21463.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225428977|ref|XP_002264651.1| PREDICTED: zinc finger protein-like 1 [Vitis vinifera] gi|296083059|emb|CBI22463.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|358248676|ref|NP_001240177.1| uncharacterized protein LOC100805734 [Glycine max] gi|255634620|gb|ACU17672.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224060790|ref|XP_002300269.1| predicted protein [Populus trichocarpa] gi|222847527|gb|EEE85074.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297831956|ref|XP_002883860.1| hypothetical protein ARALYDRAFT_899703 [Arabidopsis lyrata subsp. lyrata] gi|297329700|gb|EFH60119.1| hypothetical protein ARALYDRAFT_899703 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224103737|ref|XP_002313174.1| predicted protein [Populus trichocarpa] gi|222849582|gb|EEE87129.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449438325|ref|XP_004136939.1| PREDICTED: zinc finger protein-like 1-like [Cucumis sativus] gi|449478770|ref|XP_004155414.1| PREDICTED: zinc finger protein-like 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18397649|ref|NP_565365.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|42570775|ref|NP_973461.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|15983470|gb|AAL11603.1|AF424609_1 unknown protein [Arabidopsis thaliana] gi|20197262|gb|AAM15000.1| Expressed protein [Arabidopsis thaliana] gi|330251245|gb|AEC06339.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|330251246|gb|AEC06340.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15010694|gb|AAK74006.1| At2g14841 [Arabidopsis thaliana] gi|16323316|gb|AAL15413.1| At2g14841/At2g14841 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query215
TAIR|locus:505006245 343 AT2G14835 [Arabidopsis thalian 0.962 0.603 0.705 1.7e-82
WB|WBGene00021563309 Y45G12B.2 [Caenorhabditis eleg 0.772 0.537 0.388 4.6e-25
UNIPROTKB|E2RS23 312 ZFPL1 "Uncharacterized protein 0.827 0.570 0.348 2e-24
UNIPROTKB|E9PNY1207 ZFPL1 "Zinc finger protein-lik 0.827 0.859 0.343 4.8e-23
UNIPROTKB|E9PQ47188 ZFPL1 "Zinc finger protein-lik 0.827 0.946 0.343 4.8e-23
UNIPROTKB|O95159 310 ZFPL1 "Zinc finger protein-lik 0.827 0.574 0.343 4.8e-23
UNIPROTKB|F1RQT4 312 ZFPL1 "Uncharacterized protein 0.832 0.573 0.357 4.8e-23
UNIPROTKB|G5E5I4 312 ZFPL1 "Zinc finger protein-lik 0.841 0.580 0.335 7.8e-23
UNIPROTKB|Q2YDD3 312 ZFPL1 "Zinc finger protein-lik 0.841 0.580 0.335 7.8e-23
UNIPROTKB|E9PQA5172 ZFPL1 "Zinc finger protein-lik 0.748 0.936 0.351 1.1e-21
TAIR|locus:505006245 AT2G14835 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 827 (296.2 bits), Expect = 1.7e-82, P = 1.7e-82
 Identities = 153/217 (70%), Positives = 178/217 (82%)

Query:     1 MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQAV 60
             MVVCKC+KAT+LYCFVHK PVCGECICFPEHQ CVVRTYSEWVIDGEYD  PKCCQCQA 
Sbjct:     1 MVVCKCKKATRLYCFVHKAPVCGECICFPEHQTCVVRTYSEWVIDGEYD-QPKCCQCQAT 59

Query:    61 LEEESGSETTRLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNVKDSGSR 120
              +E +G + TRLGCLH IHTSCLVS IKSFPPHTAPAGYVCP CST IWPP  VKD+GSR
Sbjct:    60 FDEGAGHQVTRLGCLHAIHTSCLVSLIKSFPPHTAPAGYVCPACSTPIWPPMMVKDAGSR 119

Query:   121 LHSLLKEAIMLTGLEKNLFGNHPVSLAVAESRGPPPAFASDPIVNVNASSSPSKDGINIT 180
             LH+LL+E I  TGLEKNL GNHPVS +  ESR PPPAFASD ++N++ SSS +++G N+ 
Sbjct:   120 LHALLREVITQTGLEKNLLGNHPVSRST-ESRSPPPAFASDALINIS-SSSHTQEGNNLP 177

Query:   181 EGYT-------APSTVSEIMEIDGPSPAGNFIKSSSP 210
             +GY+       + S VSEI+EID P+ AG+++KSSSP
Sbjct:   178 DGYSVAGNGEYSKSAVSEIVEIDVPASAGSYMKSSSP 214
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0009737 "response to abscisic acid stimulus" evidence=IDA
GO:0007067 "mitosis" evidence=RCA
WB|WBGene00021563 Y45G12B.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|E2RS23 ZFPL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PNY1 ZFPL1 "Zinc finger protein-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PQ47 ZFPL1 "Zinc finger protein-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O95159 ZFPL1 "Zinc finger protein-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQT4 ZFPL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G5E5I4 ZFPL1 "Zinc finger protein-like 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q2YDD3 ZFPL1 "Zinc finger protein-like 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E9PQA5 ZFPL1 "Zinc finger protein-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 215
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.39
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.29
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.98
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.98
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.92
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.83
PHA02929238 N1R/p28-like protein; Provisional 98.79
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.7
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 98.68
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.61
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.54
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.53
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.5
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.49
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.4
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.38
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.35
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.31
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.26
PF1463444 zf-RING_5: zinc-RING finger domain 98.2
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.19
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.15
PHA02926242 zinc finger-like protein; Provisional 98.1
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.04
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 98.03
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.92
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.87
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.83
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.81
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.76
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 97.76
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 97.72
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.6
KOG1941518 consensus Acetylcholine receptor-associated protei 97.6
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.47
KOG1940276 consensus Zn-finger protein [General function pred 97.44
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 97.34
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.26
KOG4445368 consensus Uncharacterized conserved protein, conta 97.25
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.19
COG52191525 Uncharacterized conserved protein, contains RING Z 97.14
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 97.0
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 96.78
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 96.69
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 96.62
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 96.61
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 96.24
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 96.14
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.08
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 96.03
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 96.03
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 95.89
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 95.58
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 95.25
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 95.04
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 94.94
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 94.8
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 94.49
PHA02825162 LAP/PHD finger-like protein; Provisional 94.38
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 94.34
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 94.31
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 93.95
PHA02862156 5L protein; Provisional 93.82
KOG1002791 consensus Nucleotide excision repair protein RAD16 93.68
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 92.64
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 92.62
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 92.49
PF04641260 Rtf2: Rtf2 RING-finger 92.14
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 92.0
KOG2660 331 consensus Locus-specific chromosome binding protei 91.9
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 91.45
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 91.26
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 91.2
KOG0297 391 consensus TNF receptor-associated factor [Signal t 90.5
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 89.84
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 89.41
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 89.17
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 89.04
KOG3039303 consensus Uncharacterized conserved protein [Funct 88.86
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 88.22
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 88.1
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 87.89
KOG03091081 consensus Conserved WD40 repeat-containing protein 87.68
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 87.28
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 85.01
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 83.4
KOG3053 293 consensus Uncharacterized conserved protein [Funct 81.98
COG5152259 Uncharacterized conserved protein, contains RING a 80.93
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=3.7e-60  Score=415.25  Aligned_cols=156  Identities=37%  Similarity=0.809  Sum_probs=144.3

Q ss_pred             Cccccc--cccccceeeeeccCccCcccccCCCCceeeeecceeeccCCCCCCCccccccccccccccCCeeeecCCCcc
Q 028040            1 MVVCKC--RKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQAVLEEESGSETTRLGCLHVI   78 (215)
Q Consensus         1 MglCkC--rk~T~~fCf~Hrv~VC~~Ci~~~~H~~CvVqsYlqwL~Dsdyd~~~~C~ICle~L~~gD~~evvRL~C~HvF   78 (215)
                      ||||||  |||||||||||||||||+|+| .||++||||||+|||+|+||+  ++|.+|...|+.||   ++||.|+|+|
T Consensus         1 MGLCKCPKRkVTNlFCfEHRVNVCEhClV-~nHpkCiVQSYLqWL~DsDY~--pNC~LC~t~La~gd---t~RLvCyhlf   74 (299)
T KOG3970|consen    1 MGLCKCPKRKVTNLFCFEHRVNVCEHCLV-ANHPKCIVQSYLQWLQDSDYN--PNCRLCNTPLASGD---TTRLVCYHLF   74 (299)
T ss_pred             CCcccCchhhhhhhhhhhhhhhHHHHHHh-ccCchhhHHHHHHHHhhcCCC--CCCceeCCccccCc---ceeehhhhhH
Confidence            999999  889999999999999999997 999999999999999999999  99999999999986   9999999999


Q ss_pred             CHHHHHHHHhcCCCCCCCCCCCCCCCCCCccCCCCCCCCcchHHHHHHHHhhhhhhhhhhcCCCCCCchh-cccCCCCCC
Q 028040           79 HTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNVKDSGSRLHSLLKEAIMLTGLEKNLFGNHPVSLAV-AESRGPPPA  157 (215)
Q Consensus        79 H~~CLd~Wl~~~p~nTap~g~~CP~Cr~~I~P~~~i~d~~S~l~~~Lre~i~q~~wAr~~lG~~l~~~~~-~~~~~~p~a  157 (215)
                      ||+||++|..++|.||||+||+||.|..+|||+-|+   .|||+++|||+++|+||||++||++||+--. .+....||.
T Consensus        75 HW~ClneraA~lPanTAPaGyqCP~Cs~eiFPp~Nl---vsPva~aLre~L~qvNWaRagLGLpll~E~~sp~p~p~~p~  151 (299)
T KOG3970|consen   75 HWKCLNERAANLPANTAPAGYQCPCCSQEIFPPINL---VSPVAEALREQLKQVNWARAGLGLPLLPELNSPVPSPAPPQ  151 (299)
T ss_pred             HHHHhhHHHhhCCCcCCCCcccCCCCCCccCCCccc---cchhHHHHHHHHHhhhHHhhccCCccchhhcCCCCCCCChh
Confidence            999999999999999999999999999999999886   5999999999999999999999999998221 222336777


Q ss_pred             CCCCcccc
Q 028040          158 FASDPIVN  165 (215)
Q Consensus       158 f~~~~~~~  165 (215)
                      -+|+|.++
T Consensus       152 ~~s~~~~~  159 (299)
T KOG3970|consen  152 LKSAPVMH  159 (299)
T ss_pred             hccchhhh
Confidence            88888877

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query215
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.45
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.42
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.4
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.38
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.38
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.36
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.36
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.35
2ect_A78 Ring finger protein 126; metal binding protein, st 99.32
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.26
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.22
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.2
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.19
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.18
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.14
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.13
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.11
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.1
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.09
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.09
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.09
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.08
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.07
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.04
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.04
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.04
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.04
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.04
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.02
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.0
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.0
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.98
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.98
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.96
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.94
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.93
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.93
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.93
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.91
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.88
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.88
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.86
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.84
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.8
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.8
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.77
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.72
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.62
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.56
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.52
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.51
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.51
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.44
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.42
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.42
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.37
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.36
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.34
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.31
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.29
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.26
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.24
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.21
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.21
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.18
2ea5_A68 Cell growth regulator with ring finger domain prot 97.93
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 97.83
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.65
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.44
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.3
3nw0_A238 Non-structural maintenance of chromosomes element 97.29
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 96.75
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 94.77
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 90.64
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 88.11
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 84.81
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 84.35
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 82.62
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 81.22
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.45  E-value=7.6e-14  Score=98.19  Aligned_cols=54  Identities=24%  Similarity=0.582  Sum_probs=46.2

Q ss_pred             CccccccccccccccCCeeeecCCCccCHHHHHHHHhcCCCCCCCCCCCCCCCCCCccCCCCCC
Q 028040           52 PKCCQCQAVLEEESGSETTRLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNVK  115 (215)
Q Consensus        52 ~~C~ICle~L~~gD~~evvRL~C~HvFH~~CLd~Wl~~~p~nTap~g~~CP~Cr~~I~P~~~i~  115 (215)
                      ..|+||++.|..++  .++.|+|+|+||..||.+|++...        +||+||++|.....+.
T Consensus        16 ~~C~IC~~~~~~~~--~~~~~~C~H~f~~~Ci~~~~~~~~--------~CP~Cr~~~~~~~~~~   69 (74)
T 2ep4_A           16 ELCAVCLEDFKPRD--ELGICPCKHAFHRKCLIKWLEVRK--------VCPLCNMPVLQLAQLS   69 (74)
T ss_dssp             CBCSSSCCBCCSSS--CEEEETTTEEEEHHHHHHHHHHCS--------BCTTTCCBCSSCCSCC
T ss_pred             CCCcCCCcccCCCC--cEEEcCCCCEecHHHHHHHHHcCC--------cCCCcCcccccccccC
Confidence            78999999998875  677889999999999999998742        5999999998765543
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query215
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.48
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.39
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.38
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.27
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.26
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.18
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.16
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.1
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.95
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.89
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.86
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.84
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.81
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.78
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.73
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.31
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 97.83
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 94.19
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 89.18
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 88.92
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 88.48
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 87.36
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 87.11
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 86.39
d1frea_39 Nuclear factor XNF7 {African clawed frog (Xenopus 84.44
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.48  E-value=9.1e-15  Score=99.32  Aligned_cols=48  Identities=35%  Similarity=0.694  Sum_probs=41.5

Q ss_pred             CccccccccccccccCCeeee-cCCCccCHHHHHHHHhcCCCCCCCCCCCCCCCCCCcc
Q 028040           52 PKCCQCQAVLEEESGSETTRL-GCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIW  109 (215)
Q Consensus        52 ~~C~ICle~L~~gD~~evvRL-~C~HvFH~~CLd~Wl~~~p~nTap~g~~CP~Cr~~I~  109 (215)
                      ..|+||+++|.+++  .+++| .|+|+||.+||++||+.+.        +||+||++|.
T Consensus         6 ~~C~ICl~~~~~~~--~~~~l~~C~H~Fh~~Ci~~Wl~~~~--------~CP~CR~~i~   54 (55)
T d1iyma_           6 VECAVCLAELEDGE--EARFLPRCGHGFHAECVDMWLGSHS--------TCPLCRLTVV   54 (55)
T ss_dssp             CCCTTTCCCCCTTS--CCEECSSSCCEECTTHHHHTTTTCC--------SCSSSCCCSC
T ss_pred             CCCeEECccccCCC--EEEEeCCCCCcccHHHHHHHHHhCC--------cCCCCCCEeE
Confidence            56999999999886  77777 5999999999999998642        5999999875
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1frea_ g.43.1.1 (A:) Nuclear factor XNF7 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure