Citrus Sinensis ID: 028049
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 214 | ||||||
| 24461865 | 892 | NBS-LRR type disease resistance protein | 0.943 | 0.226 | 0.419 | 7e-27 | |
| 24461866 | 890 | NBS-LRR type disease resistance protein | 0.976 | 0.234 | 0.370 | 8e-26 | |
| 160693138 | 271 | NBS-LRR type disease resistance protein | 0.803 | 0.634 | 0.426 | 1e-25 | |
| 160693146 | 271 | NBS-LRR type disease resistance protein | 0.803 | 0.634 | 0.426 | 2e-25 | |
| 160693212 | 271 | NBS-LRR type disease resistance protein | 0.803 | 0.634 | 0.431 | 4e-25 | |
| 160693154 | 271 | NBS-LRR type disease resistance protein | 0.803 | 0.634 | 0.420 | 5e-24 | |
| 160693206 | 271 | NBS-LRR type disease resistance protein | 0.803 | 0.634 | 0.420 | 6e-24 | |
| 160693148 | 271 | NBS-LRR type disease resistance protein | 0.803 | 0.634 | 0.420 | 7e-24 | |
| 160693204 | 271 | NBS-LRR type disease resistance protein | 0.803 | 0.634 | 0.420 | 7e-24 | |
| 160693170 | 271 | NBS-LRR type disease resistance protein | 0.803 | 0.634 | 0.420 | 7e-24 |
| >gi|24461865|gb|AAN62352.1|AF506028_19 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
Score = 126 bits (316), Expect = 7e-27, Method: Compositional matrix adjust.
Identities = 91/217 (41%), Positives = 132/217 (60%), Gaps = 15/217 (6%)
Query: 4 IPQQLISSFSKLQVLRMLHCGYAHRSIVE--EGKVLSADAESLMKEIHCLEQLNLITLSL 61
IP+QLIS+ S+L+VLRM G +H + E E +L E +++E+ L+ L +ITL+L
Sbjct: 622 IPRQLISNLSRLRVLRMF--GASHNAFDEASENSILFGGGELIVEELLGLKHLEVITLTL 679
Query: 62 HGSRGVENFLKFPKLQTITQAL---HIEDCNSLPLNLLHLANMEHLEKLFIEESN-LEDW 117
S G+++FL KL++ TQAL H +D SL ++ LA+++ L +L I S LE+
Sbjct: 680 RSSYGLQSFLNSHKLRSCTQALLLQHFKDSTSLEVS--ALADLKQLNRLQIANSVILEEL 737
Query: 118 NVDCAGEVQKMP--KLHSVLIWNCSNVKDLTWLVFAPNLKCLRILDCDDMEEIISVENFE 175
+D A EVQ+ L+ V I NC +KDLT+LVFAPNLK +++ C MEEI S F
Sbjct: 738 KMDYAEEVQQFAFRSLNMVEICNCIQLKDLTFLVFAPNLKSIKVGICHAMEEIASEGKF- 796
Query: 176 KLIEVSEMMGELNLFSGLESLSLGNASNLKAYVHRSL 212
EV E+M LN F L++L + A NLK+ +SL
Sbjct: 797 --AEVPEVMANLNPFEKLQNLEVAGARNLKSIYWKSL 831
|
Source: Citrus trifoliata Species: Citrus trifoliata Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|24461866|gb|AAN62353.1|AF506028_20 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
| >gi|160693138|gb|ABX46334.1| NBS-LRR type disease resistance protein [Citrus medica] gi|160693140|gb|ABX46335.1| NBS-LRR type disease resistance protein [Citrus medica] | Back alignment and taxonomy information |
|---|
| >gi|160693146|gb|ABX46338.1| NBS-LRR type disease resistance protein [Citrus medica] gi|160693164|gb|ABX46347.1| NBS-LRR type disease resistance protein [Citrus limettioides] gi|160693168|gb|ABX46349.1| NBS-LRR type disease resistance protein [Citrus limon] | Back alignment and taxonomy information |
|---|
| >gi|160693212|gb|ABX46371.1| NBS-LRR type disease resistance protein [Citrus australasica] | Back alignment and taxonomy information |
|---|
| >gi|160693154|gb|ABX46342.1| NBS-LRR type disease resistance protein [Citrus webberi] | Back alignment and taxonomy information |
|---|
| >gi|160693206|gb|ABX46368.1| NBS-LRR type disease resistance protein [Citrus hanaju] | Back alignment and taxonomy information |
|---|
| >gi|160693148|gb|ABX46339.1| NBS-LRR type disease resistance protein [Citrus halimii] gi|160693152|gb|ABX46341.1| NBS-LRR type disease resistance protein [Citrus webberi] gi|160693202|gb|ABX46366.1| NBS-LRR type disease resistance protein [Citrus ichangensis] | Back alignment and taxonomy information |
|---|
| >gi|160693204|gb|ABX46367.1| NBS-LRR type disease resistance protein [Citrus hanaju] | Back alignment and taxonomy information |
|---|
| >gi|160693170|gb|ABX46350.1| NBS-LRR type disease resistance protein [Citrus amblycarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 214 | ||||||
| TAIR|locus:2166320 | 888 | AT5G63020 [Arabidopsis thalian | 0.841 | 0.202 | 0.303 | 8e-14 | |
| TAIR|locus:2034770 | 894 | SUMM2 "AT1G12280" [Arabidopsis | 0.757 | 0.181 | 0.329 | 1.3e-13 | |
| TAIR|locus:2153474 | 874 | AT5G05400 [Arabidopsis thalian | 0.775 | 0.189 | 0.307 | 2.7e-13 | |
| TAIR|locus:2034765 | 884 | AT1G12290 [Arabidopsis thalian | 0.607 | 0.147 | 0.318 | 1.1e-11 | |
| TAIR|locus:2201986 | 885 | RFL1 "AT1G12210" [Arabidopsis | 0.761 | 0.184 | 0.322 | 6.1e-11 | |
| TAIR|locus:2008510 | 967 | AT1G61190 "AT1G61190" [Arabido | 0.831 | 0.184 | 0.319 | 1.4e-10 | |
| TAIR|locus:2171589 | 948 | AT5G47260 [Arabidopsis thalian | 0.752 | 0.169 | 0.298 | 1.8e-10 | |
| TAIR|locus:2201996 | 889 | RPS5 "AT1G12220" [Arabidopsis | 0.766 | 0.184 | 0.301 | 1.7e-09 | |
| TAIR|locus:2132741 | 892 | AT4G10780 [Arabidopsis thalian | 0.892 | 0.214 | 0.288 | 8.3e-09 | |
| TAIR|locus:2036214 | 851 | AT1G15890 [Arabidopsis thalian | 0.747 | 0.188 | 0.308 | 2.2e-08 |
| TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 191 (72.3 bits), Expect = 8.0e-14, P = 8.0e-14
Identities = 64/211 (30%), Positives = 105/211 (49%)
Query: 9 ISSFSKLQVLRMLHCGYAHRSIVEEGKVLSADAESLMKEIHCLEQLNLITLSLHGSRGVE 68
IS + L+VLR+ G+ E+ VL+ E+ LE L +T++L + +E
Sbjct: 623 ISGLTSLKVLRLFVSGFP-----EDPCVLN--------ELQLLENLQTLTITLGLASILE 669
Query: 69 NFLKFPKLQTITQALHIEDCNSLPLNLLHLANMEHLEKLFIEESNLEDWNVDCAGEVQKM 128
FL +L + T+AL IE+ N + +A M+ L++L +S++ + V V +
Sbjct: 670 QFLSNQRLASCTRALRIENLNPQSSVISFVATMDSLQELHFADSDIWEIKVKRNETVLPL 729
Query: 129 ---------PKLHSVLIWNCSNVKDLTWLVFAPNLKCLRILDCDDMEEIISVENFEKLIE 179
P L V + C+ ++DLTWL+FAPNL LR++ D++E+I+ E E+
Sbjct: 730 HIPTTTTFFPNLSQVSLEFCTRLRDLTWLIFAPNLTVLRVISASDLKEVINKEKAEQQ-- 787
Query: 180 VSEMMGELNLFSGLESLSLGNASNLKAYVHR 210
L F L+ L L N LK ++HR
Sbjct: 788 ------NLIPFQELKELRLENVQMLK-HIHR 811
|
|
| TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153474 AT5G05400 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.34 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.33 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.15 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.76 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.66 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.62 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 98.08 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 98.07 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 98.02 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.02 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 98.01 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.87 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 97.81 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.72 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 97.62 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 97.61 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.61 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 97.61 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.59 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.57 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.5 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 97.5 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 97.49 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 97.47 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 97.35 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.32 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.29 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 97.26 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.03 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 96.89 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 96.73 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 96.67 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 96.66 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 96.36 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 96.3 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 95.96 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 95.72 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 95.63 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 95.57 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 95.23 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 95.18 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 95.11 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 95.04 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 94.88 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 94.28 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 94.05 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 93.86 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 93.33 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 93.1 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 91.26 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 89.52 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 89.46 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 89.36 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 89.22 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 88.47 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 87.79 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 85.75 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 84.67 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 84.61 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 84.05 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 83.51 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 83.08 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 82.98 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 81.73 |
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
Probab=99.34 E-value=3.4e-12 Score=124.32 Aligned_cols=63 Identities=24% Similarity=0.403 Sum_probs=38.1
Q ss_pred ccchhhccc-cccceeecccccccCCCCCccEEeeecCcCCccCcccCCCCCccEEeEecCccccccc
Q 028049 103 HLEKLFIEE-SNLEDWNVDCAGEVQKMPKLHSVLIWNCSNVKDLTWLVFAPNLKCLRILDCDDMEEII 169 (214)
Q Consensus 103 ~L~~L~i~~-~~l~~l~~~~~~~~~~~~~L~~L~I~~C~~L~~lp~~~~l~~L~~L~i~~C~~l~~i~ 169 (214)
+|+.|++.+ +.+..++... ..+++|+.|.|.+|++++.+|....+++|++|++++|.++..++
T Consensus 779 sL~~L~Ls~n~~l~~lP~si----~~L~~L~~L~Ls~C~~L~~LP~~~~L~sL~~L~Ls~c~~L~~~p 842 (1153)
T PLN03210 779 SLTRLFLSDIPSLVELPSSI----QNLHKLEHLEIENCINLETLPTGINLESLESLDLSGCSRLRTFP 842 (1153)
T ss_pred cchheeCCCCCCccccChhh----hCCCCCCEEECCCCCCcCeeCCCCCccccCEEECCCCCcccccc
Confidence 455555555 4444443222 24667777777777777777654466777777777776665543
|
syringae 6; Provisional |
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.53 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.51 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.33 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.22 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.2 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.19 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.19 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.17 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.16 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.15 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.14 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.14 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.14 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.13 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.13 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.12 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.12 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.12 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.12 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.11 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.1 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.09 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.08 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.07 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.07 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.05 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.05 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.05 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.05 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.03 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.03 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.02 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.01 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.01 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.01 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.0 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.99 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.99 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.97 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.97 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.95 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.95 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.95 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.95 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.95 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.94 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.94 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.93 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.92 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.92 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.91 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.91 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.9 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.9 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.89 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.89 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.88 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.88 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.86 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.85 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.85 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.84 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.83 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.82 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.82 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.81 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.81 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.78 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.78 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.77 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.77 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.77 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.77 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.76 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.76 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.76 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.76 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.75 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.74 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.73 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.73 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.72 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.69 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.69 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.68 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.67 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.67 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.66 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.65 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.62 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.61 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.61 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.59 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.59 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.56 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.54 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.48 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.47 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.46 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.45 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.41 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.41 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.41 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.4 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.38 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.37 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.37 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.36 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.36 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.35 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.34 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.3 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.29 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.29 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.28 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.27 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.22 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.22 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.2 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.18 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.14 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.13 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.1 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.08 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.98 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.95 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.94 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.94 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.92 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.9 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.9 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.88 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.85 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.82 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.78 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.77 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 97.77 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.61 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.49 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 97.47 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.45 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.38 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.36 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.28 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.11 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 97.0 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 96.27 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 96.1 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 96.09 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 95.69 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 95.52 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 92.99 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 92.24 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 89.87 |
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
Probab=99.53 E-value=4.7e-14 Score=118.40 Aligned_cols=169 Identities=21% Similarity=0.297 Sum_probs=89.2
Q ss_pred CCCChhhhccCcccceEEccccCcccccccccccccchhhHhhhhhccCCccCceeeEEecccchhhhccCCcchhcccc
Q 028049 2 SEIPQQLISSFSKLQVLRMLHCGYAHRSIVEEGKVLSADAESLMKEIHCLEQLNLITLSLHGSRGVENFLKFPKLQTITQ 81 (214)
Q Consensus 2 ~~iP~~~i~~L~~Lq~L~l~~~~~~~~~~~~~~~~~~~~~~~~l~eL~~L~~L~~L~i~~~~~~~l~~l~~~~~l~~~l~ 81 (214)
+.||.+ +.++++|++|++.++.....|. .+..+++|+.|+++-.....++..+ .-.+.|+
T Consensus 94 ~~lp~~-l~~l~~L~~L~L~~n~l~~lp~----------------~~~~l~~L~~L~Ls~n~l~~lp~~l---~~l~~L~ 153 (328)
T 4fcg_A 94 PQFPDQ-AFRLSHLQHMTIDAAGLMELPD----------------TMQQFAGLETLTLARNPLRALPASI---ASLNRLR 153 (328)
T ss_dssp SSCCSC-GGGGTTCSEEEEESSCCCCCCS----------------CGGGGTTCSEEEEESCCCCCCCGGG---GGCTTCC
T ss_pred hhcChh-hhhCCCCCEEECCCCCccchhH----------------HHhccCCCCEEECCCCccccCcHHH---hcCcCCC
Confidence 467875 7778888888888887743321 2333444555554433322222110 0112344
Q ss_pred EEeecCCCCCCch--------------------------------hhhcccccccchhhccccccceeecccccccCCCC
Q 028049 82 ALHIEDCNSLPLN--------------------------------LLHLANMEHLEKLFIEESNLEDWNVDCAGEVQKMP 129 (214)
Q Consensus 82 ~L~l~~c~~l~~l--------------------------------~~~l~~l~~L~~L~i~~~~l~~l~~~~~~~~~~~~ 129 (214)
.|++++|.....+ +..+..+++|++|+++++.+..++... ..++
T Consensus 154 ~L~L~~n~~~~~~p~~~~~~~~~~~~~~l~~L~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~N~l~~l~~~l----~~l~ 229 (328)
T 4fcg_A 154 ELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAI----HHLP 229 (328)
T ss_dssp EEEEEEETTCCCCCSCSEEEC-CCCEEESTTCCEEEEEEECCCCCCGGGGGCTTCCEEEEESSCCCCCCGGG----GGCT
T ss_pred EEECCCCCCccccChhHhhccchhhhccCCCCCEEECcCCCcCcchHhhcCCCCCCEEEccCCCCCcCchhh----ccCC
Confidence 5555444433333 323344444444444443333332211 2355
Q ss_pred CccEEeeecCcCCccCcc-cCCCCCccEEeEecCcccccccccccchhhHHHhhhcccCCCCCccCeeecCccccccccC
Q 028049 130 KLHSVLIWNCSNVKDLTW-LVFAPNLKCLRILDCDDMEEIISVENFEKLIEVSEMMGELNLFSGLESLSLGNASNLKAYV 208 (214)
Q Consensus 130 ~L~~L~I~~C~~L~~lp~-~~~l~~L~~L~i~~C~~l~~i~~~~~~~~l~~~~~~~~~~~~f~~L~~L~l~~cp~L~~i~ 208 (214)
+|+.|++++|.....+|. +..+++|++|++++|.....++ ..+..+++|++|++++|+.+..++
T Consensus 230 ~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~~p---------------~~~~~l~~L~~L~L~~n~~~~~iP 294 (328)
T 4fcg_A 230 KLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLP---------------LDIHRLTQLEKLDLRGCVNLSRLP 294 (328)
T ss_dssp TCCEEECTTCTTCCBCCCCTTCCCCCCEEECTTCTTCCBCC---------------TTGGGCTTCCEEECTTCTTCCCCC
T ss_pred CCCEEECcCCcchhhhHHHhcCCCCCCEEECCCCCchhhcc---------------hhhhcCCCCCEEeCCCCCchhhcc
Confidence 566666666555555543 4455566666666655544443 245667888899998888777766
Q ss_pred C
Q 028049 209 H 209 (214)
Q Consensus 209 ~ 209 (214)
.
T Consensus 295 ~ 295 (328)
T 4fcg_A 295 S 295 (328)
T ss_dssp G
T ss_pred H
Confidence 4
|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.22 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.21 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.19 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.12 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.1 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.08 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.0 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.0 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.94 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.93 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.87 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.84 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.8 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.76 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.75 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.72 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.69 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.65 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.6 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.59 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.52 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.42 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.27 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.27 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.26 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.2 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.1 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.96 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.95 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 97.81 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 97.61 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 97.43 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 95.96 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 95.93 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 94.32 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 94.01 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 92.76 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 91.81 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 87.19 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 80.05 |
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Internalin LRR domain domain: Internalin B species: Listeria monocytogenes [TaxId: 1639]
Probab=99.22 E-value=3.9e-11 Score=91.66 Aligned_cols=152 Identities=14% Similarity=0.212 Sum_probs=90.4
Q ss_pred ccCcccceEEccccCcccccccccccccchhhHhhhhhccCCccCceeeEEecccchhhhccCCcchhccccEEeecCCC
Q 028049 10 SSFSKLQVLRMLHCGYAHRSIVEEGKVLSADAESLMKEIHCLEQLNLITLSLHGSRGVENFLKFPKLQTITQALHIEDCN 89 (214)
Q Consensus 10 ~~L~~Lq~L~l~~~~~~~~~~~~~~~~~~~~~~~~l~eL~~L~~L~~L~i~~~~~~~l~~l~~~~~l~~~l~~L~l~~c~ 89 (214)
..+.++++|++.++.... ++.++.+++|+.|+++-.....+..+.. .++++.|+++++.
T Consensus 37 ~~l~~l~~L~l~~~~i~~-----------------l~~l~~l~nL~~L~Ls~N~l~~~~~l~~----l~~L~~L~l~~n~ 95 (199)
T d2omxa2 37 TDLDQVTTLQADRLGIKS-----------------IDGVEYLNNLTQINFSNNQLTDITPLKN----LTKLVDILMNNNQ 95 (199)
T ss_dssp HHHTTCCEEECTTSCCCC-----------------CTTGGGCTTCCEEECCSSCCCCCGGGTT----CTTCCEEECCSSC
T ss_pred HHhcCCCEEECCCCCCCC-----------------ccccccCCCcCcCccccccccCcccccC----Ccccccccccccc
Confidence 346778888888887622 2234556777777776444444333222 2357778777764
Q ss_pred CCCchhhhcccccccchhhccccccceeecccccccCCCCCccEEeeecCcCCccCcccCCCCCccEEeEecCccccccc
Q 028049 90 SLPLNLLHLANMEHLEKLFIEESNLEDWNVDCAGEVQKMPKLHSVLIWNCSNVKDLTWLVFAPNLKCLRILDCDDMEEII 169 (214)
Q Consensus 90 ~l~~l~~~l~~l~~L~~L~i~~~~l~~l~~~~~~~~~~~~~L~~L~I~~C~~L~~lp~~~~l~~L~~L~i~~C~~l~~i~ 169 (214)
. ..++ .+..+++|+.|++.+.....+.. ...+++|+.+.++++ +++.++.+..+++|++|++.++ ++..+.
T Consensus 96 ~-~~~~-~l~~l~~L~~L~l~~~~~~~~~~-----~~~l~~L~~L~l~~n-~l~~~~~l~~~~~L~~L~l~~n-~l~~l~ 166 (199)
T d2omxa2 96 I-ADIT-PLANLTNLTGLTLFNNQITDIDP-----LKNLTNLNRLELSSN-TISDISALSGLTSLQQLNFSSN-QVTDLK 166 (199)
T ss_dssp C-CCCG-GGTTCTTCSEEECCSSCCCCCGG-----GTTCTTCSEEECCSS-CCCCCGGGTTCTTCSEEECCSS-CCCCCG
T ss_pred c-cccc-ccccccccccccccccccccccc-----cchhhhhHHhhhhhh-hhcccccccccccccccccccc-cccCCc
Confidence 3 3332 45667777777777633322211 124777888888775 5666666666777888877765 333321
Q ss_pred ccccchhhHHHhhhcccCCCCCccCeeecCccccccccC
Q 028049 170 SVENFEKLIEVSEMMGELNLFSGLESLSLGNASNLKAYV 208 (214)
Q Consensus 170 ~~~~~~~l~~~~~~~~~~~~f~~L~~L~l~~cp~L~~i~ 208 (214)
.+..+++|++|++++++ ++.+.
T Consensus 167 ----------------~l~~l~~L~~L~ls~N~-i~~i~ 188 (199)
T d2omxa2 167 ----------------PLANLTTLERLDISSNK-VSDIS 188 (199)
T ss_dssp ----------------GGTTCTTCCEEECCSSC-CCCCG
T ss_pred ----------------cccCCCCCCEEECCCCC-CCCCc
Confidence 23456777777777763 55554
|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|