Citrus Sinensis ID: 028055

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----
MGRAPCCEKMGLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQKANTNTNNNNNSDDHKQNSKQNVDSFESFPVIDESFWTDTSLSENSSNLTSDFGGGLNEFAIGHHDYGGGMDFWYNILVTSGADSLTLPF
ccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHcHHHHHHHccccccccccccccHHHHHHHHHHHHHHccHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccc
cccccccHHcccccccccHHHHHHHHHHHHHcccccHHHccHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHcccHHHHccccccccccccccccccccccccccHHcccHHcccccccccccHHHccccccccccccccccccccccccccccccHHHHHHHHHcccccccccc
mgrapccekmglkkgpwtpeeDRILIVHIKkhghpnwralpkqagllrcgksCRLRWINylrpdikrgnfskeEEETIINLHDMLGNRWsaiagrlpgrtdneiKNVWHTHLKKKAAAVLKQNQKantntnnnnnsddhkqnskqnvdsfesfpvidesfwtdtslsenssnltsdfggglnefaighhdygggmDFWYNILVTsgadsltlpf
mgrapccekmglkkgpwtpeEDRILIVHIKKhghpnwralpkqaGLLRCGKSCRLRWINylrpdikrgnfskEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQKAntntnnnnnsddhkqNSKQNVDSFESFPVIDESFWTDTSLSENSSNLTSDFGGGLNEFAIGHHDYGGGMDFWYNILVTSGADSLTLPF
MGRAPCCEKMGLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQKAntntnnnnnSDDHKQNSKQNVDSFESFPVIDESFWTdtslsenssnltsdFGGGLNEFAIGHHDYGGGMDFWYNILVTSGADSLTLPF
***************PWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVW*********************************************PVIDESFWT************SDFGGGLNEFAIGHHDYGGGMDFWYNILVTSG********
*GRAPCCEKMGLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLK*****************************************************************************YGGGMDFWYNILVTSGA***TLPF
MGRAPCCEKMGLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQKANTNTNNNNNSDDHKQNSKQNVDSFESFPVIDESFWTDTSLSENSSNLTSDFGGGLNEFAIGHHDYGGGMDFWYNILVTSGADSLTLPF
***APCCEKMGLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVL**********************************************************************YGGGMDFWYNILVTSGADS*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRAPCCEKMGLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQKANTNTNNNNNSDDHKQNSKQNVDSFESFPVIDESFWTDTSLSENSSNLTSDFGGGLNEFAIGHHDYGGGMDFWYNILVTSGADSLTLPF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query214 2.2.26 [Sep-21-2011]
Q7XBH4257 Myb-related protein Myb4 yes no 0.551 0.459 0.872 1e-60
P20024 340 Myb-related protein Zm1 O N/A no 0.602 0.379 0.709 7e-52
Q38850249 Transcription repressor M no no 0.934 0.803 0.472 1e-46
Q9SZP1282 Transcription repressor M no no 0.537 0.407 0.713 2e-46
Q9S9K9257 Transcription factor MYB3 no no 0.537 0.447 0.695 3e-46
P81393232 Myb-related protein 308 O N/A no 0.537 0.495 0.704 5e-46
P81392 316 Myb-related protein 306 O N/A no 0.537 0.363 0.686 7e-46
Q38851236 Transcription repressor M no no 0.537 0.487 0.695 1e-45
P81395274 Myb-related protein 330 O N/A no 0.551 0.430 0.694 2e-45
P20026267 Myb-related protein Hv1 O N/A no 0.551 0.441 0.703 3e-45
>sp|Q7XBH4|MYB4_ORYSJ Myb-related protein Myb4 OS=Oryza sativa subsp. japonica GN=MYB4 PE=2 SV=2 Back     alignment and function desciption
 Score =  233 bits (593), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 113/118 (95%)

Query: 1   MGRAPCCEKMGLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINY 60
           MGRAPCCEKMGLKKGPWTPEED++L+ HI++HGH NWRALPKQAGLLRCGKSCRLRWINY
Sbjct: 1   MGRAPCCEKMGLKKGPWTPEEDKVLVAHIQRHGHGNWRALPKQAGLLRCGKSCRLRWINY 60

Query: 61  LRPDIKRGNFSKEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAA 118
           LRPDIKRGNFSKEEE+TII+LH++LGNRWSAIA RLPGRTDNEIKNVWHTHLKK+  A
Sbjct: 61  LRPDIKRGNFSKEEEDTIIHLHELLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLDA 118
Putative transcription factor which is may be involved in cold stress response.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|P20024|MYB1_MAIZE Myb-related protein Zm1 OS=Zea mays PE=2 SV=1 Back     alignment and function description
>sp|Q38850|MYB5_ARATH Transcription repressor MYB5 OS=Arabidopsis thaliana GN=MYB5 PE=1 SV=1 Back     alignment and function description
>sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 Back     alignment and function description
>sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 Back     alignment and function description
>sp|P81393|MYB08_ANTMA Myb-related protein 308 OS=Antirrhinum majus GN=MYB308 PE=2 SV=1 Back     alignment and function description
>sp|P81392|MYB06_ANTMA Myb-related protein 306 OS=Antirrhinum majus GN=MYB306 PE=2 SV=1 Back     alignment and function description
>sp|Q38851|MYB6_ARATH Transcription repressor MYB6 OS=Arabidopsis thaliana GN=MYB6 PE=1 SV=1 Back     alignment and function description
>sp|P81395|MYB30_ANTMA Myb-related protein 330 OS=Antirrhinum majus GN=MYB330 PE=2 SV=1 Back     alignment and function description
>sp|P20026|MYB1_HORVU Myb-related protein Hv1 OS=Hordeum vulgare GN=MYB1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
217337738238 myb-related transcription factor [Panax 0.939 0.844 0.553 2e-64
359807202275 MYB29 protein [Glycine max] gi|6492385|d 0.985 0.767 0.487 5e-64
356498363264 PREDICTED: myb-related protein Myb4-like 0.990 0.803 0.513 3e-63
5139806264 GmMYB29A2 [Glycine max] 0.990 0.803 0.513 4e-63
359806618272 uncharacterized protein LOC100807569 [Gl 0.985 0.775 0.481 6e-63
224099907287 predicted protein [Populus trichocarpa] 0.943 0.703 0.496 1e-62
255646780268 unknown [Glycine max] 0.990 0.791 0.498 9e-62
388503814258 unknown [Medicago truncatula] 0.990 0.821 0.513 1e-61
22266675253 myb-related transcription factor VlMYBB1 0.957 0.810 0.514 1e-61
356534297264 PREDICTED: myb-related protein Myb4-like 0.990 0.803 0.490 1e-61
>gi|217337738|gb|ACK43221.1| myb-related transcription factor [Panax ginseng] Back     alignment and taxonomy information
 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 157/235 (66%), Gaps = 34/235 (14%)

Query: 1   MGRAPCCEKMGLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINY 60
           MGRAPCCEKMGLKKGPWT EED++LI +I++HGH NWRALPKQAGLLRCGKSCRLRW NY
Sbjct: 1   MGRAPCCEKMGLKKGPWTTEEDQVLISYIQQHGHANWRALPKQAGLLRCGKSCRLRWANY 60

Query: 61  LRPDIKRGNFSKEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKK----- 115
           LRPDIKRGNF+KEEE+TI  LH+MLGNRWSA+A +LPGRTDNEIKNVWHTHLKKK     
Sbjct: 61  LRPDIKRGNFTKEEEDTIFQLHEMLGNRWSAMAAKLPGRTDNEIKNVWHTHLKKKLKNYQ 120

Query: 116 --AAAVLKQNQKANTNTNNNNNSDDHKQ---------------------NSKQNVDSFES 152
             +  V KQ     +N + N +     +                       ++ +DS ES
Sbjct: 121 PSSQVVTKQQSMIKSNGHKNPDFSARPEVCGPPQGSSSELSSVTVMTTAVKQEQMDSSES 180

Query: 153 -FPVIDESFWTDTSLSENSSNLTSDFGGGLNEFAIGHHDYGGGMDFWYNILVTSG 206
            FP IDESFWT    +E+S    S+F G  ++  +G      GMDFWYN+ + +G
Sbjct: 181 TFPEIDESFWTQ---AEDSKMEFSEFRGPNDK--LGCQMIEDGMDFWYNLFIRAG 230

Source: Panax ginseng

Species: Panax ginseng

Genus: Panax

Family: Araliaceae

Order: Apiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359807202|ref|NP_001241360.1| MYB29 protein [Glycine max] gi|6492385|dbj|BAA81733.2| GmMYB29A2 [Glycine max] gi|255644995|gb|ACU22997.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356498363|ref|XP_003518022.1| PREDICTED: myb-related protein Myb4-like [Glycine max] Back     alignment and taxonomy information
>gi|5139806|dbj|BAA81732.1| GmMYB29A2 [Glycine max] Back     alignment and taxonomy information
>gi|359806618|ref|NP_001241018.1| uncharacterized protein LOC100807569 [Glycine max] gi|5139814|dbj|BAA81736.1| GmMYB29B2 [Glycine max] gi|255642060|gb|ACU21296.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224099907|ref|XP_002311670.1| predicted protein [Populus trichocarpa] gi|222851490|gb|EEE89037.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255646780|gb|ACU23862.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388503814|gb|AFK39973.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|22266675|dbj|BAC07544.1| myb-related transcription factor VlMYBB1-2 [Vitis labrusca x Vitis vinifera] Back     alignment and taxonomy information
>gi|356534297|ref|XP_003535693.1| PREDICTED: myb-related protein Myb4-like [Glycine max] gi|5139802|dbj|BAA81730.1| GmMYB29A1 [Glycine max] gi|5139804|dbj|BAA81731.1| GmMYB29A1 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
TAIR|locus:2086233285 MYB15 "myb domain protein 15" 0.537 0.403 0.834 1.4e-58
TAIR|locus:2038520246 MYB13 "myb domain protein 13" 0.584 0.508 0.792 7.8e-58
TAIR|locus:2042526249 MYB14 "myb domain protein 14" 0.537 0.461 0.834 8.8e-57
TAIR|locus:2098906299 MYB17 "myb domain protein 17" 0.537 0.384 0.747 9.9e-52
TAIR|locus:2075387 321 MYB107 "myb domain protein 107 0.537 0.358 0.791 1.5e-51
TAIR|locus:2149000 336 MYB9 "myb domain protein 9" [A 0.537 0.342 0.791 1.3e-50
TAIR|locus:2207330294 MYB63 "myb domain protein 63" 0.542 0.394 0.758 2.3e-48
TAIR|locus:2032860274 MYB58 "myb domain protein 58" 0.696 0.543 0.604 3.7e-48
TAIR|locus:2141231 350 MYB102 "MYB-like 102" [Arabido 0.537 0.328 0.765 4.7e-48
TAIR|locus:2011786296 MYB72 "myb domain protein 72" 0.649 0.469 0.624 7.7e-48
TAIR|locus:2086233 MYB15 "myb domain protein 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 560 (202.2 bits), Expect = 1.4e-58, Sum P(2) = 1.4e-58
 Identities = 96/115 (83%), Positives = 107/115 (93%)

Query:     1 MGRAPCCEKMGLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINY 60
             MGRAPCCEKMGLK+GPWTPEED+IL+  I  HGH NWRALPKQAGLLRCGKSCRLRW+NY
Sbjct:     1 MGRAPCCEKMGLKRGPWTPEEDQILVSFILNHGHSNWRALPKQAGLLRCGKSCRLRWMNY 60

Query:    61 LRPDIKRGNFSKEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKK 115
             L+PDIKRGNF+KEEE+ II+LH +LGNRWSAIA +LPGRTDNEIKNVWHTHLKK+
Sbjct:    61 LKPDIKRGNFTKEEEDAIISLHQILGNRWSAIAAKLPGRTDNEIKNVWHTHLKKR 115
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0009651 "response to salt stress" evidence=IEP
GO:0009723 "response to ethylene stimulus" evidence=IEP;RCA
GO:0009733 "response to auxin stimulus" evidence=IEP;RCA
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP;RCA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0010200 "response to chitin" evidence=IEP;RCA
GO:0002679 "respiratory burst involved in defense response" evidence=RCA
GO:0007165 "signal transduction" evidence=RCA
GO:0009414 "response to water deprivation" evidence=RCA
GO:0009611 "response to wounding" evidence=RCA
GO:0009695 "jasmonic acid biosynthetic process" evidence=RCA
GO:0009737 "response to abscisic acid stimulus" evidence=RCA
GO:0009738 "abscisic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0009873 "ethylene mediated signaling pathway" evidence=RCA
GO:0035556 "intracellular signal transduction" evidence=RCA
GO:0042538 "hyperosmotic salinity response" evidence=RCA
GO:0052542 "defense response by callose deposition" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
TAIR|locus:2038520 MYB13 "myb domain protein 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042526 MYB14 "myb domain protein 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098906 MYB17 "myb domain protein 17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075387 MYB107 "myb domain protein 107" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149000 MYB9 "myb domain protein 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2207330 MYB63 "myb domain protein 63" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032860 MYB58 "myb domain protein 58" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141231 MYB102 "MYB-like 102" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011786 MYB72 "myb domain protein 72" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7XBH4MYB4_ORYSJNo assigned EC number0.87280.55140.4591yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 5e-58
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 2e-57
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 2e-16
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 2e-14
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 2e-13
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 1e-12
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 2e-11
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 2e-10
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 6e-10
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 1e-08
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 9e-05
cd1165953 cd11659, SANT_CDC5_II, SANT/myb-like DNA-binding d 3e-04
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information 
 Score =  183 bits (465), Expect = 5e-58
 Identities = 102/215 (47%), Positives = 138/215 (64%), Gaps = 16/215 (7%)

Query: 5   PCCEKMGLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPD 64
           PCC KMG+K+GPWT EED IL+  IKK G   WR+LPK+AGLLRCGKSCRLRW+NYLRP 
Sbjct: 16  PCCTKMGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPS 75

Query: 65  IKRGNFSKEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQ 124
           +KRG  + +EE+ I+ LH +LGNRWS IAGR+PGRTDNEIKN W+THL+KK   +L+Q  
Sbjct: 76  VKRGGITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKK---LLRQGI 132

Query: 125 KANTNTNNNNNSDDHKQNSKQNVDSFESFPV--IDESFWTDTSLS---ENSSNLTSDFGG 179
              T+   + N + HK   ++ V   + +P+  I  S   DT+++    +S N  + FGG
Sbjct: 133 DPQTHKPLDAN-NIHK--PEEEVSGGQKYPIEPISSSHTDDTTVNGGDGDSKNSINVFGG 189

Query: 180 GLNEFAIGHHDYGGGMDFWYNILVTSGADSLTLPF 214
                  G+ D+G   D  ++  + S  +    PF
Sbjct: 190 -----EHGYEDFGFCYDDKFSSFLNSLINDDADPF 219

Length = 249
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|212557 cd11659, SANT_CDC5_II, SANT/myb-like DNA-binding domain of Cell Division Cycle 5-Like Protein repeat II Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 214
PLN03212249 Transcription repressor MYB5; Provisional 100.0
PLN03091 459 hypothetical protein; Provisional 100.0
KOG0048238 consensus Transcription factor, Myb superfamily [T 100.0
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.81
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.74
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.71
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.66
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.62
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.53
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.48
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.47
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.3
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.3
PLN03212249 Transcription repressor MYB5; Provisional 99.22
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.19
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.15
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.08
PLN03091 459 hypothetical protein; Provisional 99.01
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.0
KOG0051607 consensus RNA polymerase I termination factor, Myb 98.97
COG5147512 REB1 Myb superfamily proteins, including transcrip 98.46
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.95
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.82
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.74
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.73
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 97.35
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 97.27
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 97.24
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.11
KOG1279 506 consensus Chromatin remodeling factor subunit and 97.09
COG5259 531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.01
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.0
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.89
KOG1279506 consensus Chromatin remodeling factor subunit and 96.86
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.83
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.4
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 96.31
PRK13923170 putative spore coat protein regulator protein YlbO 96.2
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 96.05
PLN031421033 Probable chromatin-remodeling complex ATPase chain 96.05
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.02
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 95.87
PRK13923170 putative spore coat protein regulator protein YlbO 95.79
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.05
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 94.28
KOG2656 445 consensus DNA methyltransferase 1-associated prote 94.08
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 93.2
KOG4282 345 consensus Transcription factor GT-2 and related pr 92.01
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 91.8
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 91.78
KOG1194 534 consensus Predicted DNA-binding protein, contains 87.38
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 86.1
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 83.53
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 82.37
KOG4282345 consensus Transcription factor GT-2 and related pr 81.59
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information 
Probab=100.00  E-value=9.2e-40  Score=280.22  Aligned_cols=116  Identities=67%  Similarity=1.311  Sum_probs=111.8

Q ss_pred             CCcccccCCCCCCCCCHHHHHHHHHHHHHhCCCCcchhchhhCCCCCccccchhhhhcccCCCCCCCCCHHHHHHHHHHH
Q 028055            3 RAPCCEKMGLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEETIINLH   82 (214)
Q Consensus         3 r~~~~~k~~l~kg~WT~EED~~L~~~v~~~g~~nW~~Ia~~~~~~Rt~~qcr~Rw~~~L~p~i~kg~WT~EED~~Ll~l~   82 (214)
                      |+|||.|++++|++||+|||++|+++|++||..+|..||+.++.+|+++|||+||.+||+|.+++++||.|||++|++++
T Consensus        14 ~~pcc~K~glKRg~WT~EEDe~L~~lV~kyG~~nW~~IAk~~g~gRT~KQCReRW~N~L~P~I~kgpWT~EED~lLlel~   93 (249)
T PLN03212         14 TTPCCTKMGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGGITSDEEDLILRLH   93 (249)
T ss_pred             CCCCcccCCCcCCCCCHHHHHHHHHHHHHhCcccHHHHHHhhhcCCCcchHHHHHHHhhchhcccCCCChHHHHHHHHHH
Confidence            68999999999999999999999999999999999999999965599999999999999999999999999999999999


Q ss_pred             HhcCCcHHHHHhhCCCCCHHHHHHHHHHHhHHHHHH
Q 028055           83 DMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAA  118 (214)
Q Consensus        83 ~~~G~kW~~IA~~lpgRt~~~~knrw~~~lkk~~~~  118 (214)
                      .+||++|+.||+.|||||+++|||||+.++++++.+
T Consensus        94 ~~~GnKWs~IAk~LpGRTDnqIKNRWns~LrK~l~r  129 (249)
T PLN03212         94 RLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLR  129 (249)
T ss_pred             HhccccHHHHHhhcCCCCHHHHHHHHHHHHhHHHHh
Confidence            999999999999999999999999999999988754

>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 6e-22
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 7e-22
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 8e-21
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 9e-21
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 9e-21
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 1e-16
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 2e-11
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 2e-08
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 3e-08
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 2e-07
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 1e-05
1mbg_A53 Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 3e-05
1gv5_A52 Crystal Structure Of C-Myb R2 Length = 52 3e-05
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure 
Iteration: 1

 Score =  100 bits (249), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 70/105 (66%), Gaps = 1/105 (0%)
Query: 12  LKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFS 71
           L KGPWT EED+ +I  +KK+G   W  + K     R GK CR RW N+L P++K+ +++
Sbjct: 5   LVKGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKG-RLGKQCRERWHNHLNPEVKKSSWT 63
Query: 72  KEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKKA 116
           +EE+  I   H +LGNRW+ IA  LPGRTDN +KN W++ +K+K 
Sbjct: 64  EEEDRIIFEAHKVLGNRWAEIAKLLPGRTDNAVKNHWNSTIKRKV 108
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure
>pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 Back     alignment and structure
>pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 2e-67
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 4e-67
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 3e-66
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 5e-18
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 2e-56
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 4e-55
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 5e-35
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 4e-07
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 2e-52
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 2e-28
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-24
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 5e-21
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 1e-14
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 5e-06
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 4e-10
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 1e-05
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-09
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 4e-08
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 2e-07
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 4e-07
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 9e-05
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 5e-07
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 5e-04
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 7e-07
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 3e-04
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 1e-06
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 2e-06
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 9e-05
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 2e-06
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 1e-05
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 2e-05
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 9e-05
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 2e-04
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 4e-04
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
 Score =  201 bits (513), Expect = 2e-67
 Identities = 48/104 (46%), Positives = 69/104 (66%), Gaps = 1/104 (0%)

Query: 12  LKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFS 71
           L KGPWT EED+ +I  ++K+G   W  + K     R GK CR RW N+L P++K+ +++
Sbjct: 2   LIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKG-RIGKQCRERWHNHLNPEVKKTSWT 60

Query: 72  KEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKK 115
           +EE+  I   H  LGNRW+ IA  LPGRTDN IKN W++ +++K
Sbjct: 61  EEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRK 104
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 100.0
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 100.0
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 100.0
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 100.0
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 100.0
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 100.0
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.97
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.88
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.85
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.81
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.79
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.75
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.75
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.74
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.74
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.72
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.72
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.72
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.72
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.69
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.68
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.68
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.67
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.66
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.65
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.65
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.64
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.64
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.63
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.63
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.62
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.61
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.59
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.59
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.59
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.37
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.57
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.53
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.51
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.5
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.48
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.46
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.46
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.44
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.43
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.41
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.4
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.4
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.09
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.38
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.37
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.37
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.36
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.33
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.32
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.29
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 99.17
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.1
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.08
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.97
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.86
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.84
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.82
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.69
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.67
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.59
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.59
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.56
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.42
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.4
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.35
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 98.26
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.23
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.54
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 98.19
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.18
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.98
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.8
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.77
2crg_A70 Metastasis associated protein MTA3; transcription 97.72
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.6
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.42
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.27
2crg_A70 Metastasis associated protein MTA3; transcription 97.22
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 97.2
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.2
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 97.01
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.83
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 95.69
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 96.6
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 95.28
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 95.14
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 94.73
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 94.24
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 88.82
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 86.35
2xb0_X 270 Chromo domain-containing protein 1; hydrolase, DNA 84.33
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
Probab=100.00  E-value=8.9e-37  Score=231.33  Aligned_cols=105  Identities=46%  Similarity=0.870  Sum_probs=99.7

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCCcchhchhhCCCCCccccchhhhhcccCCCCCCCCCHHHHHHHHHHHHhcCCcHH
Q 028055           11 GLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEETIINLHDMLGNRWS   90 (214)
Q Consensus        11 ~l~kg~WT~EED~~L~~~v~~~g~~nW~~Ia~~~~~~Rt~~qcr~Rw~~~L~p~i~kg~WT~EED~~Ll~l~~~~G~kW~   90 (214)
                      ++++|+||+|||++|+++|.+||..+|..||+.+++ |+++||++||.++|+|.+++++||+|||++|++++.+||++|+
T Consensus         1 ~l~k~~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~~-Rt~~qcr~Rw~~~l~p~~~~~~Wt~eEd~~L~~~~~~~G~~W~   79 (105)
T 1gv2_A            1 ELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKG-RIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWA   79 (105)
T ss_dssp             CCCCSCCCHHHHHHHHHHHHHHCTTCHHHHHTTSTT-CCHHHHHHHHHHTTCCCCCCCCCCHHHHHHHHHHHHHHSSCHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCcHHHHhhhhcC-CCHHHHHHHHHhccCCcccccCCCHHHHHHHHHHHHHhCCCHH
Confidence            478999999999999999999998899999999987 9999999999999999999999999999999999999999999


Q ss_pred             HHHhhCCCCCHHHHHHHHHHHhHHHH
Q 028055           91 AIAGRLPGRTDNEIKNVWHTHLKKKA  116 (214)
Q Consensus        91 ~IA~~lpgRt~~~~knrw~~~lkk~~  116 (214)
                      .||+.|||||+++|++||+.++++++
T Consensus        80 ~Ia~~l~gRt~~~~k~rw~~~~~~~~  105 (105)
T 1gv2_A           80 EIAKLLPGRTDNAIKNHWNSTMRRKV  105 (105)
T ss_dssp             HHHTTCTTCCHHHHHHHHHHHTC---
T ss_pred             HHHHHcCCCCHHHHHHHHHHHHhccC
Confidence            99999999999999999999998753
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 214
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 7e-21
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-10
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 7e-19
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 7e-09
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 4e-16
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 4e-12
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 7e-16
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 1e-15
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 6e-06
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 4e-15
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 2e-06
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 3e-13
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 6e-11
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 4e-13
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 3e-09
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 4e-12
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 1e-07
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 9e-11
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 5e-08
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 1e-10
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 4e-10
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 1e-09
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 2e-05
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 2e-05
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 2e-05
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 79.8 bits (197), Expect = 7e-21
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 12 LKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPD 64
          L KGPWT EED+ LI  ++K+G   W  + K     R GK CR RW N+L P+
Sbjct: 1  LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE 52
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.79
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.78
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.76
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.73
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.7
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.65
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.63
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.62
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.56
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.54
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.54
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.54
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.53
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.53
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.49
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.46
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.46
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.41
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.4
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.39
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.38
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.31
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.3
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.26
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.24
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.04
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.99
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.83
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.27
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.26
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.91
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.85
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 97.68
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.65
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.22
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 97.03
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.01
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 95.71
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 94.74
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 93.65
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 90.36
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 89.66
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.79  E-value=3.9e-22  Score=144.90  Aligned_cols=72  Identities=18%  Similarity=0.193  Sum_probs=66.2

Q ss_pred             CCCCCHHHHHHHHHHHHHhCCC-----CcchhchhhCCCCCccccchhhhhcccCCCCCCCCCHHHHHHHHHHHHhcC
Q 028055           14 KGPWTPEEDRILIVHIKKHGHP-----NWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEETIINLHDMLG   86 (214)
Q Consensus        14 kg~WT~EED~~L~~~v~~~g~~-----nW~~Ia~~~~~~Rt~~qcr~Rw~~~L~p~i~kg~WT~EED~~Ll~l~~~~G   86 (214)
                      |++||+|||++|+++|.+||..     +|..||+.|++ ||++|||.||.++|+|.+++++||.+||++|+.++..+.
T Consensus         1 k~~WT~eED~~L~~~v~~~g~~~~~~~~W~~IA~~lpg-Rt~~qcr~Rw~~~L~p~l~~~~~t~~ed~ll~d~~~~li   77 (86)
T d1igna1           1 KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPN-HTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNLI   77 (86)
T ss_dssp             CCCCCHHHHHHHHHHHHTSGGGTTCSHHHHHHTTTSTT-SCHHHHHHHHHHTTGGGCCCEECBCTTSCBCBCTTSCBC
T ss_pred             CCCCCHHHHHHHHHHHHHhCcCcCCccCHHHHHHHcCC-CCHHHHHHHHHHHcCccccCCCCCCchhHHHHHHhhccc
Confidence            6899999999999999999954     49999999998 999999999999999999999999999999987765544
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure