Citrus Sinensis ID: 028234

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-
MAAVSTPTIICSCSSSSSSSSRLSSKQAHNTKQQQQQLSFDPKKRFFEVGIGLLASSVIALTPLEADATRIEYYATTADPPCEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPMHVGGKRKLQIPPELAYGPEPAGCFSGDCNIPANATLVYDINFVGIYSGNRK
cccccccccccccccccccccccccHHHcccHHHHHccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEcccccEEEEEEcccccccccccEEEEEEEEEcccccEEcccccccccEEEEcccccEEccccccccccccccccccccEEEEEEcccccccccccccccccccccccccEEEEEEEEEEEccccc
cccEcccEEEEEcccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccEEcccccEEEEEEcccccccccccEEEEEEEEEEccccEEEEHHHHcccEEEEHccccccHHHHHHHcccccccccccccEEEEEEccHHccccccccccccccccccccEEEEEEEEEEEcccccc
maavstptiicscssssssssrlsskqahNTKQQQqqlsfdpkkrFFEVGIGLLASSVIaltpleadATRIEYyattadppcefsfarsglgycdiasgsgveapygelINVHYtarfadgiifdssykrarpltmriGVGKVikgldqgilggdgvppmhvggkrklqippelaygpepagcfsgdcnipanatlvyDINFVGIYSGNRK
maavstptiicscssssssssRLSSKQAHNTKqqqqqlsfdpKKRFFEVGIGLLASSVIALTPLEADATRIEYYATTADPPCEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPMHVGGKRKLQIPPELAYGPEPAGCFSGDCNIPANATLVYDINFVGIYSGNRK
MAAVSTPTIICscssssssssrlssKQAHNTKqqqqqLSFDPKKRFFEVGIGLLASSVIALTPLEADATRIEYYATTADPPCEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPMHVGGKRKLQIPPELAYGPEPAGCFSGDCNIPANATLVYDINFVGIYSGNRK
*******************************************KRFFEVGIGLLASSVIALTPLEADATRIEYYATTADPPCEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPMHVGGKRKLQIPPELAYGPEPAGCFSGDCNIPANATLVYDINFVGIY*****
*************************************************GIGLLASS****************************FARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPMHVGGKRKLQIPPELAYGPEPAGCFSGDCNIPANATLVYDINFV*IYS****
***************************************FDPKKRFFEVGIGLLASSVIALTPLEADATRIEYYATTADPPCEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPMHVGGKRKLQIPPELAYGPEPAGCFSGDCNIPANATLVYDINFVGIYSGNRK
***VSTPTIICSCSSSSSSSSRLSSKQAHNTKQQQQQLSFDPKKRFFEVGIGLLASSVIALTPLEADATRIEYYATTADPPCEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPMHVGGKRKLQIPPELAYGPEPAGCFSGDCNIPANATLVYDINFVGIYS****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAVSTPTIICSCSSSSSSSSRLSSKQAHNTKQQQQQLSFDPKKRFFEVGIGLLASSVIALTPLEADATRIEYYATTADPPCEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPMHVGGKRKLQIPPELAYGPEPAGCFSGDCNIPANATLVYDINFVGIYSGNRK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query211 2.2.26 [Sep-21-2011]
Q9SCY3217 Peptidyl-prolyl cis-trans yes no 0.791 0.769 0.784 2e-75
Q9SCY2208 Peptidyl-prolyl cis-trans no no 0.862 0.875 0.448 4e-38
P0A0W2109 FK506-binding protein OS= yes no 0.511 0.990 0.436 2e-18
P56989109 FK506-binding protein OS= yes no 0.483 0.935 0.442 3e-18
P0A0W3109 FK506-binding protein OS= N/A no 0.483 0.935 0.442 4e-18
Q54SR7133 FK506-binding protein 2 O yes no 0.440 0.699 0.451 3e-17
Q41649151 FK506-binding protein 2 O N/A no 0.440 0.615 0.423 4e-17
Q6CGG3144 FK506-binding protein 2 O yes no 0.459 0.673 0.449 5e-17
Q6BP84135 FK506-binding protein 2 O yes no 0.436 0.681 0.442 2e-16
P20080120 Peptidyl-prolyl cis-trans N/A no 0.436 0.766 0.436 3e-16
>sp|Q9SCY3|FK162_ARATH Peptidyl-prolyl cis-trans isomerase FKBP16-2, chloroplastic OS=Arabidopsis thaliana GN=FKBP16-2 PE=1 SV=1 Back     alignment and function desciption
 Score =  281 bits (720), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 150/167 (89%)

Query: 43  KKRFFEVGIGLLASSVIALTPLEADATRIEYYATTADPPCEFSFARSGLGYCDIASGSGV 102
           KKR F VG+G LASS+++LTPL+ADATRI+YYAT  DP CE+S+A+SGLG+CD+  G G 
Sbjct: 48  KKRVFGVGLGFLASSILSLTPLDADATRIDYYATVGDPLCEYSYAKSGLGFCDLDVGFGD 107

Query: 103 EAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPMHV 162
           EAP G L+N+HYTARFADG +FDSSYKRARPLTMRIGVGKVI+GLDQGILGG+GVPPM V
Sbjct: 108 EAPRGVLVNIHYTARFADGTLFDSSYKRARPLTMRIGVGKVIRGLDQGILGGEGVPPMRV 167

Query: 163 GGKRKLQIPPELAYGPEPAGCFSGDCNIPANATLVYDINFVGIYSGN 209
           GGKRKLQIPP+LAYGPEPAGCFSGDCNIP NATL+YDINFV IY G+
Sbjct: 168 GGKRKLQIPPKLAYGPEPAGCFSGDCNIPGNATLLYDINFVEIYPGS 214
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity). Probable subunit of the chloroplast NAD(P)H dehydrogenase (NDH) lumen subcomplex L that seems to be essential for stabilizing the NDH subcomplex A.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q9SCY2|FKB13_ARATH Peptidyl-prolyl cis-trans isomerase FKBP13, chloroplastic OS=Arabidopsis thaliana GN=FKBP13 PE=1 SV=2 Back     alignment and function description
>sp|P0A0W2|FKBP_NEIMB FK506-binding protein OS=Neisseria meningitidis serogroup B (strain MC58) GN=fbp PE=1 SV=1 Back     alignment and function description
>sp|P56989|FKBP_NEIMA FK506-binding protein OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=fbp PE=3 SV=1 Back     alignment and function description
>sp|P0A0W3|FKBP_NEIMC FK506-binding protein OS=Neisseria meningitidis serogroup C GN=fbp PE=3 SV=1 Back     alignment and function description
>sp|Q54SR7|FKBP2_DICDI FK506-binding protein 2 OS=Dictyostelium discoideum GN=fkbp2 PE=3 SV=1 Back     alignment and function description
>sp|Q41649|FKB15_VICFA FK506-binding protein 2 OS=Vicia faba GN=FKBP15 PE=1 SV=1 Back     alignment and function description
>sp|Q6CGG3|FKBP2_YARLI FK506-binding protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FPR2 PE=3 SV=1 Back     alignment and function description
>sp|Q6BP84|FKBP2_DEBHA FK506-binding protein 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FPR2 PE=3 SV=2 Back     alignment and function description
>sp|P20080|FKB1A_NEUCR Peptidyl-prolyl cis-trans isomerase fkr-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fkr-2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query211
225438635206 PREDICTED: probable FKBP-type peptidyl-p 0.876 0.898 0.751 1e-79
354464679229 fk506-binding protein [Carica papaya] 0.881 0.812 0.737 5e-77
118489786226 unknown [Populus trichocarpa x Populus d 0.995 0.929 0.656 2e-76
449451467211 PREDICTED: peptidyl-prolyl cis-trans iso 0.777 0.777 0.835 3e-76
449504843163 PREDICTED: peptidyl-prolyl cis-trans iso 0.772 1.0 0.840 9e-76
224081186185 predicted protein [Populus trichocarpa] 0.796 0.908 0.791 6e-75
351721116221 uncharacterized protein LOC100500547 [Gl 0.971 0.927 0.669 2e-74
297802080216 hypothetical protein ARALYDRAFT_490753 [ 0.791 0.773 0.784 7e-74
18420509217 putative FKBP-type peptidyl-prolyl cis-t 0.791 0.769 0.784 9e-74
357519563213 hypothetical protein MTR_8g091410 [Medic 0.914 0.906 0.663 2e-72
>gi|225438635|ref|XP_002281281.1| PREDICTED: probable FKBP-type peptidyl-prolyl cis-trans isomerase 4, chloroplastic [Vitis vinifera] gi|296082462|emb|CBI21467.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  301 bits (771), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 161/193 (83%), Gaps = 8/193 (4%)

Query: 27  QAHNTKQQQQQLSFDP--------KKRFFEVGIGLLASSVIALTPLEADATRIEYYATTA 78
           Q   T   +  LSF P        K+   +VGIGLLA+SV+AL+PLEA ATRIEYYAT  
Sbjct: 14  QTLQTHHPKPSLSFKPIANCISSTKRPVLDVGIGLLAASVVALSPLEATATRIEYYATVG 73

Query: 79  DPPCEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRI 138
           +P CE +FA+SGLGYCD+A GSG EAP+GELINVHYTARFADG +FDSSYKRARPLTMRI
Sbjct: 74  EPNCELNFAKSGLGYCDVAVGSGEEAPFGELINVHYTARFADGTVFDSSYKRARPLTMRI 133

Query: 139 GVGKVIKGLDQGILGGDGVPPMHVGGKRKLQIPPELAYGPEPAGCFSGDCNIPANATLVY 198
           G GK+IKGLDQGILGG+GVPPM VGGKRKL+IPP LAYGPEPAGCFSGDCNIPANATL+Y
Sbjct: 134 GAGKLIKGLDQGILGGEGVPPMLVGGKRKLRIPPALAYGPEPAGCFSGDCNIPANATLLY 193

Query: 199 DINFVGIYSGNRK 211
           DINFVGIYSGN K
Sbjct: 194 DINFVGIYSGNAK 206

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|354464679|gb|AER26535.1| fk506-binding protein [Carica papaya] Back     alignment and taxonomy information
>gi|118489786|gb|ABK96693.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|449451467|ref|XP_004143483.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP16-2, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449504843|ref|XP_004162310.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP16-2, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224081186|ref|XP_002306326.1| predicted protein [Populus trichocarpa] gi|222855775|gb|EEE93322.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351721116|ref|NP_001235919.1| uncharacterized protein LOC100500547 [Glycine max] gi|255630603|gb|ACU15661.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297802080|ref|XP_002868924.1| hypothetical protein ARALYDRAFT_490753 [Arabidopsis lyrata subsp. lyrata] gi|297314760|gb|EFH45183.1| hypothetical protein ARALYDRAFT_490753 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18420509|ref|NP_568067.1| putative FKBP-type peptidyl-prolyl cis-trans isomerase 4 [Arabidopsis thaliana] gi|75202771|sp|Q9SCY3.1|FK162_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP16-2, chloroplastic; Short=PPIase FKBP16-2; AltName: Full=FK506-binding protein 16-2; Short=AtFKBP16-2; AltName: Full=Immunophilin FKBP16-2; AltName: Full=Photosynthetic NDH subcomplex L 4; AltName: Full=Rotamase; Flags: Precursor gi|6686798|emb|CAB64721.1| FKBP like protein [Arabidopsis thaliana] gi|332661707|gb|AEE87107.1| putative FKBP-type peptidyl-prolyl cis-trans isomerase 4 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357519563|ref|XP_003630070.1| hypothetical protein MTR_8g091410 [Medicago truncatula] gi|355524092|gb|AET04546.1| hypothetical protein MTR_8g091410 [Medicago truncatula] gi|388504494|gb|AFK40313.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query211
TAIR|locus:2135287217 PnsL4 "AT4G39710" [Arabidopsis 0.791 0.769 0.784 2.9e-71
UNIPROTKB|Q6Z8J5230 P0431B06.35 "Peptidyl-prolyl c 0.777 0.713 0.634 1.4e-55
TAIR|locus:2171958208 FKBP13 "AT5G45680" [Arabidopsi 0.582 0.591 0.585 3.5e-36
UNIPROTKB|Q653Z1218 OSJNBb0065C04.47 "Peptidyl-pro 0.582 0.564 0.555 9.2e-36
UNIPROTKB|A8J3L4194 FKB16-2a "Peptidyl-prolyl cis- 0.530 0.577 0.487 9.7e-25
UNIPROTKB|A8J3L3175 FKB16-5 "Peptidyl-prolyl cis-t 0.530 0.64 0.470 1e-22
UNIPROTKB|P73037201 ytfC "Peptidyl-prolyl cis-tran 0.559 0.587 0.465 9e-22
UNIPROTKB|Q7NMC5161 glr0841 "Peptidyl-prolyl cis-t 0.526 0.689 0.426 5.1e-19
UNIPROTKB|Q74AS7156 GSU2274 "Peptidyl-prolyl cis-t 0.502 0.679 0.418 6.5e-19
TIGR_CMR|GSU_2274156 GSU_2274 "FKBP-type peptidyl-p 0.502 0.679 0.418 6.5e-19
TAIR|locus:2135287 PnsL4 "AT4G39710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 721 (258.9 bits), Expect = 2.9e-71, P = 2.9e-71
 Identities = 131/167 (78%), Positives = 150/167 (89%)

Query:    43 KKRFFEVGIGLLASSVIALTPLEADATRIEYYATTADPPCEFSFARSGLGYCDIASGSGV 102
             KKR F VG+G LASS+++LTPL+ADATRI+YYAT  DP CE+S+A+SGLG+CD+  G G 
Sbjct:    48 KKRVFGVGLGFLASSILSLTPLDADATRIDYYATVGDPLCEYSYAKSGLGFCDLDVGFGD 107

Query:   103 EAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPMHV 162
             EAP G L+N+HYTARFADG +FDSSYKRARPLTMRIGVGKVI+GLDQGILGG+GVPPM V
Sbjct:   108 EAPRGVLVNIHYTARFADGTLFDSSYKRARPLTMRIGVGKVIRGLDQGILGGEGVPPMRV 167

Query:   163 GGKRKLQIPPELAYGPEPAGCFSGDCNIPANATLVYDINFVGIYSGN 209
             GGKRKLQIPP+LAYGPEPAGCFSGDCNIP NATL+YDINFV IY G+
Sbjct:   168 GGKRKLQIPPKLAYGPEPAGCFSGDCNIPGNATLLYDINFVEIYPGS 214
GO:0000413 "protein peptidyl-prolyl isomerization" evidence=IBA
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS;IBA
GO:0005528 "FK506 binding" evidence=ISS;IBA
GO:0005576 "extracellular region" evidence=ISM
GO:0006457 "protein folding" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0018208 "peptidyl-proline modification" evidence=IBA
GO:0009543 "chloroplast thylakoid lumen" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0031679 "NADH dehydrogenase (plastoquinone) activity" evidence=IMP
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0010598 "NAD(P)H dehydrogenase complex (plastoquinone)" evidence=IDA
UNIPROTKB|Q6Z8J5 P0431B06.35 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2171958 FKBP13 "AT5G45680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q653Z1 OSJNBb0065C04.47 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|A8J3L4 FKB16-2a "Peptidyl-prolyl cis-trans isomerase" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|A8J3L3 FKB16-5 "Peptidyl-prolyl cis-trans isomerase" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|P73037 ytfC "Peptidyl-prolyl cis-trans isomerase" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] Back     alignment and assigned GO terms
UNIPROTKB|Q7NMC5 glr0841 "Peptidyl-prolyl cis-trans isomerase" [Gloeobacter violaceus PCC 7421 (taxid:251221)] Back     alignment and assigned GO terms
UNIPROTKB|Q74AS7 GSU2274 "Peptidyl-prolyl cis-trans isomerase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2274 GSU_2274 "FKBP-type peptidyl-prolyl cis-trans isomerase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SCY3FK162_ARATH5, ., 2, ., 1, ., 80.78440.79140.7695yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.766
4th Layer5.2.1.80.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 8e-33
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 2e-31
COG1047174 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans 6e-17
PRK10902269 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- 1e-15
PRK11570206 PRK11570, PRK11570, peptidyl-prolyl cis-trans isom 3e-12
PRK15095156 PRK15095, PRK15095, FKBP-type peptidyl-prolyl cis- 1e-07
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  116 bits (293), Expect = 8e-33
 Identities = 50/117 (42%), Positives = 65/117 (55%), Gaps = 13/117 (11%)

Query: 89  SGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLD 148
           SGL Y  + +G G     G+ + VHYT    DG +FDSSY R +P      +G VI G D
Sbjct: 101 SGLQYKVLKAGDGAAPKKGDTVTVHYTGTLIDGTVFDSSYDRGQPAEFP--LGGVIPGWD 158

Query: 149 QGILGGDGVPPMHVGGKRKLQIPPELAYGPEPAGCFSGDCNIPANATLVYDINFVGI 205
           +G+ G      M VGGKRKL IPPELAYG        G   IP N+TLV+++  + +
Sbjct: 159 EGLQG------MKVGGKRKLTIPPELAYGERGVP---GV--IPPNSTLVFEVELLDV 204

Length = 205
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information
>gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|183207 PRK11570, PRK11570, peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|237908 PRK15095, PRK15095, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 211
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.98
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.96
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.95
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.95
KOG0552226 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.95
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.94
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.94
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.88
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.71
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.64
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.61
PRK10737196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.57
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.17
TIGR00115 408 tig trigger factor. Trigger factor is a ribosome-a 99.0
PRK01490 435 tig trigger factor; Provisional 98.9
COG0544 441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 98.7
KOG0545 329 consensus Aryl-hydrocarbon receptor-interacting pr 97.71
KOG0549 188 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.66
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.98  E-value=1.3e-31  Score=214.60  Aligned_cols=124  Identities=40%  Similarity=0.702  Sum_probs=113.8

Q ss_pred             hhhhhhccCCCCCCeeecCCccEEEEEecCCCCCCCCCCEEEEEEEEEEcCCcEEecccCCCCceEEeccCCcccHHHHH
Q 028234           70 RIEYYATTADPPCEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQ  149 (211)
Q Consensus        70 ~~~~~~~~~~~~~~~~~~~~G~~~~~l~~G~G~~~~~gd~V~v~y~~~~~~G~~~~st~~~~~p~~~~lg~~~~i~g~~~  149 (211)
                      ..+.+...+.....+.++++|++|++++.|+|+.|+.+|.|.+||++++.||++|||+|++++|+.|.+|  .+|+||.+
T Consensus        82 ~~~~f~~~~~k~~~v~~~~sgl~y~~~~~G~G~~~~~~~~V~vhY~G~l~~G~vFDsS~~rg~p~~f~l~--~vI~Gw~e  159 (205)
T COG0545          82 EGKAFLEKNAKEKGVKTLPSGLQYKVLKAGDGAAPKKGDTVTVHYTGTLIDGTVFDSSYDRGQPAEFPLG--GVIPGWDE  159 (205)
T ss_pred             hHHHHHhhhcccCCceECCCCcEEEEEeccCCCCCCCCCEEEEEEEEecCCCCccccccccCCCceeecC--CeeehHHH
Confidence            3344555566677889999999999999999999999999999999999999999999999999999996  99999999


Q ss_pred             HHcCCCCCCCcccCcEEEEEECCCCCCCCCCCCCCCCCCCCCCCCeEEEEEEEEeee
Q 028234          150 GILGGDGVPPMHVGGKRKLQIPPELAYGPEPAGCFSGDCNIPANATLVYDINFVGIY  206 (211)
Q Consensus       150 al~g~~~~~~m~~G~~~~v~vp~~~~yg~~g~~~~~~~~~ip~~~~l~~~vel~~i~  206 (211)
                      +|.+      |++|++|+++||++++||..|.++     .||||++|+|+|||++|.
T Consensus       160 gl~~------M~vG~k~~l~IP~~laYG~~g~~g-----~Ippns~LvFeVeLl~v~  205 (205)
T COG0545         160 GLQG------MKVGGKRKLTIPPELAYGERGVPG-----VIPPNSTLVFEVELLDVK  205 (205)
T ss_pred             HHhh------CCCCceEEEEeCchhccCcCCCCC-----CCCCCCeEEEEEEEEecC
Confidence            9999      999999999999999999999763     499999999999999974

>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
1u79_A129 Crystal Structure Of Atfkbp13 Length = 129 1e-37
3vaw_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 7e-21
4ggq_C209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 7e-21
3uqa_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 7e-21
4dz3_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 8e-21
2ke0_A117 Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso 1e-20
2y78_A133 Crystal Structure Of Bpss1823, A Mip-Like Chaperone 1e-20
3uf8_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 3e-20
3uqb_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 6e-20
4dz2_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 7e-18
2pbc_A102 Fk506-Binding Protein 2 Length = 102 2e-15
1yat_A113 Improved Calcineurin Inhibition By Yeast Fkbp12-Dru 7e-14
1pbk_A116 Homologous Domain Of Human Fkbp25 Length = 116 9e-13
2lgo_A130 Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol 1e-12
3jxv_A 356 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 2e-12
3jym_A 377 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 2e-12
3kz7_A119 C-Terminal Domain Of Murine Fkbp25 Rapamycin Comple 2e-12
3uqi_A108 Crystallographic Structure Of Fkbp12 From Aedes Aeg 2e-12
1jvw_A167 Trypanosoma Cruzi Macrophage Infectivity Potentiato 4e-11
4dip_A125 Crystal Structure Of Human Peptidyl-Prolyl Cis-Tran 8e-11
2dg9_A107 Fk506-Binding Protein Mutant Wl59 Complexed With Ra 3e-10
1c9h_A107 Crystal Structure Of Fkbp12.6 In Complex With Rapam 5e-10
1fkk_A107 Atomic Structure Of Fkbp12, An Immunophilin Binding 6e-10
1fd9_A213 Crystal Structure Of The Macrophage Infectivity Pot 8e-10
2uz5_A137 Solution Structure Of The Fkbp-Domain Of Legionella 9e-10
3h9r_B109 Crystal Structure Of The Kinase Domain Of Type I Ac 1e-09
1fkb_A107 Atomic Structure Of The Rapamycin Human Immunophili 1e-09
2dg4_A107 Fk506-Binding Protein Mutant Wf59 Complexed With Ra 1e-09
2fap_A107 The Structure Of The Immunophilin-Immunosuppressant 1e-09
1kt0_A 457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 1e-09
1tco_C107 Ternary Complex Of A Calcineurin A Fragment, Calcin 1e-09
3o5e_A144 Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 1e-09
4drh_A144 Co-crystal Structure Of The Ppiase Domain Of Fkbp51 1e-09
1kt1_A 457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 2e-09
3o5d_A 264 Crystal Structure Of A Fragment Of Fkbp51 Comprisin 2e-09
2ppp_A107 Crystal Structure Of E60q Mutant Of Fkbp12 Length = 2e-09
3o5g_A128 Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 2e-09
3o5l_A128 Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Le 2e-09
2ppo_A107 Crystal Structure Of E60a Mutant Of Fkbp12 Length = 2e-09
1bkf_A107 Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX 3e-09
1eym_A107 Fk506 Binding Protein Mutant, Homodimeric Complex L 5e-09
1bl4_A107 Fkbp Mutant F36v Complexed With Remodeled Synthetic 7e-09
1rot_A149 Structure Of Fkbp59-I, The N-Terminal Domain Of A 5 8e-09
1n1a_A140 Crystal Structure Of The N-Terminal Domain Of Human 2e-08
4drj_A144 O-crystal Structure Of The Ppiase Domain Of Fkbp52, 2e-08
1q6u_A245 Crystal Structure Of Fkpa From Escherichia Coli Len 3e-08
1q1c_A 280 Crystal Structure Of N(1-260) Of Human Fkbp52 Lengt 3e-08
1q6h_A224 Crystal Structure Of A Truncated Form Of Fkpa From 3e-08
2ki3_A126 Structural And Biochemical Characterization Of Fk50 4e-06
1r9h_A135 Structural Genomics Of C.Elegans: Fkbp-Type Peptidy 1e-05
2vn1_A129 Crystal Structure Of The Fk506-Binding Domain Of Pl 4e-05
2ofn_A135 Solution Structure Of Fk506-Binding Domain (Fkbd)of 4e-05
4dt4_A169 Crystal Structure Of The Ppiase-Chaperone Slpa With 2e-04
1ix5_A151 Solution Structure Of The Methanococcus Thermolitho 4e-04
>pdb|1U79|A Chain A, Crystal Structure Of Atfkbp13 Length = 129 Back     alignment and structure 
Iteration: 1

 Score =  152 bits (384), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 72/123 (58%), Positives = 87/123 (70%)
Query: 82  CEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVG 141
           CEFS + SGL +CD   G G EA  G+LI  HY  +  +G +FDSSY R +PLT RIGVG
Sbjct: 5   CEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVG 64
Query: 142 KVIKGLDQGILGGDGVPPMHVGGKRKLQIPPELAYGPEPAGCFSGDCNIPANATLVYDIN 201
           +VIKG DQGILG DG+PPM  GGKR L+IPPELAYG   AGC  G C IP  + L++DI 
Sbjct: 65  EVIKGWDQGILGSDGIPPMLTGGKRTLRIPPELAYGDRGAGCKGGSCLIPPASVLLFDIE 124
Query: 202 FVG 204
           ++G
Sbjct: 125 YIG 127
>pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 Back     alignment and structure
>pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 Back     alignment and structure
>pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 Back     alignment and structure
>pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4DZ2|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation R92g From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|2PBC|A Chain A, Fk506-Binding Protein 2 Length = 102 Back     alignment and structure
>pdb|1YAT|A Chain A, Improved Calcineurin Inhibition By Yeast Fkbp12-Drug Complexes. Crystallographic And Functional Analysis Length = 113 Back     alignment and structure
>pdb|1PBK|A Chain A, Homologous Domain Of Human Fkbp25 Length = 116 Back     alignment and structure
>pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 Back     alignment and structure
>pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 Back     alignment and structure
>pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 377 Back     alignment and structure
>pdb|3KZ7|A Chain A, C-Terminal Domain Of Murine Fkbp25 Rapamycin Complex Length = 119 Back     alignment and structure
>pdb|3UQI|A Chain A, Crystallographic Structure Of Fkbp12 From Aedes Aegypti Length = 108 Back     alignment and structure
>pdb|1JVW|A Chain A, Trypanosoma Cruzi Macrophage Infectivity Potentiator (Tcmip) Length = 167 Back     alignment and structure
>pdb|4DIP|A Chain A, Crystal Structure Of Human Peptidyl-Prolyl Cis-Trans Isomerase Fkbp14 Length = 125 Back     alignment and structure
>pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 Back     alignment and structure
>pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 Back     alignment and structure
>pdb|1FD9|A Chain A, Crystal Structure Of The Macrophage Infectivity Potentiator Protein (Mip) A Major Virulence Factor From Legionella Pneumophila Length = 213 Back     alignment and structure
>pdb|2UZ5|A Chain A, Solution Structure Of The Fkbp-Domain Of Legionella Pneumophila Mip Length = 137 Back     alignment and structure
>pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 Back     alignment and structure
>pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 Back     alignment and structure
>pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 Back     alignment and structure
>pdb|3O5E|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 Back     alignment and structure
>pdb|4DRH|A Chain A, Co-crystal Structure Of The Ppiase Domain Of Fkbp51, Rapamycin And The Frb Fragment Of Mtor At Low Ph Length = 144 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|3O5D|A Chain A, Crystal Structure Of A Fragment Of Fkbp51 Comprising The Fk1 And Fk2 Domains Length = 264 Back     alignment and structure
>pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|3O5G|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|3O5L|A Chain A, Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 Back     alignment and structure
>pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 Back     alignment and structure
>pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 Back     alignment and structure
>pdb|1ROT|A Chain A, Structure Of Fkbp59-I, The N-Terminal Domain Of A 59 Kda Fk506-Binding Protein, Nmr, Minimized Average Structure Length = 149 Back     alignment and structure
>pdb|1N1A|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Fkbp52 Length = 140 Back     alignment and structure
>pdb|4DRJ|A Chain A, O-crystal Structure Of The Ppiase Domain Of Fkbp52, Rapamycin And The Frb Fragment Of Mtor Length = 144 Back     alignment and structure
>pdb|1Q6U|A Chain A, Crystal Structure Of Fkpa From Escherichia Coli Length = 245 Back     alignment and structure
>pdb|1Q1C|A Chain A, Crystal Structure Of N(1-260) Of Human Fkbp52 Length = 280 Back     alignment and structure
>pdb|1Q6H|A Chain A, Crystal Structure Of A Truncated Form Of Fkpa From Escherichia Coli Length = 224 Back     alignment and structure
>pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 Back     alignment and structure
>pdb|1R9H|A Chain A, Structural Genomics Of C.Elegans: Fkbp-Type Peptidylprolyl Isomerase Length = 135 Back     alignment and structure
>pdb|2VN1|A Chain A, Crystal Structure Of The Fk506-Binding Domain Of Plasmodium Falciparum Fkbp35 In Complex With Fk506 Length = 129 Back     alignment and structure
>pdb|2OFN|A Chain A, Solution Structure Of Fk506-Binding Domain (Fkbd)of Fkbp35 From Plasmodium Falciparum Length = 135 Back     alignment and structure
>pdb|4DT4|A Chain A, Crystal Structure Of The Ppiase-Chaperone Slpa With The Chaperone Binding Site Occupied By The Linker Of The Purification Tag Length = 169 Back     alignment and structure
>pdb|1IX5|A Chain A, Solution Structure Of The Methanococcus Thermolithotrophicus Fkbp Length = 151 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 1e-55
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 1e-39
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 6e-39
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 2e-37
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 3e-37
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 3e-37
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 4e-37
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 6e-37
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 8e-37
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 9e-37
2ppn_A107 FK506-binding protein 1A; high resolution protein 3e-36
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 7e-36
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 3e-35
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 8e-35
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 1e-27
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 7e-25
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 3e-34
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 2e-21
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 3e-34
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 2e-33
1jvw_A167 Macrophage infectivity potentiator; chagas disease 1e-32
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 4e-31
1fd9_A213 Protein (macrophage infectivity potentiator prote; 2e-30
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 4e-30
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 6e-30
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 1e-29
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 2e-28
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 4e-27
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 1e-16
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 8e-22
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 1e-17
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 5e-15
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 7e-15
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 2e-14
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 2e-13
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 9e-13
3prb_A 231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 1e-12
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 1e-11
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 4e-11
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
 Score =  172 bits (437), Expect = 1e-55
 Identities = 72/125 (57%), Positives = 87/125 (69%)

Query: 81  PCEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGV 140
            CEFS + SGL +CD   G G EA  G+LI  HY  +  +G +FDSSY R +PLT RIGV
Sbjct: 4   SCEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGV 63

Query: 141 GKVIKGLDQGILGGDGVPPMHVGGKRKLQIPPELAYGPEPAGCFSGDCNIPANATLVYDI 200
           G+VIKG DQGILG DG+PPM  GGKR L+IPPELAYG   AGC  G C IP  + L++DI
Sbjct: 64  GEVIKGWDQGILGSDGIPPMLTGGKRTLRIPPELAYGDRGAGCKGGSCLIPPASVLLFDI 123

Query: 201 NFVGI 205
            ++G 
Sbjct: 124 EYIGK 128
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Length = 151 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} PDB: 3pra_A Length = 157 Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Length = 231 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Length = 158 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query211
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 99.96
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.95
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.95
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.95
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.95
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.95
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.95
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.95
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.95
1fd9_A213 Protein (macrophage infectivity potentiator prote; 99.95
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.95
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.95
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.94
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.94
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.94
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.94
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 99.94
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.94
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 99.94
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.94
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.93
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.92
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.91
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.9
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.88
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.87
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.87
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.86
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.82
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 99.76
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.74
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 99.72
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 99.72
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.71
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.7
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 99.7
3prb_A231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 99.69
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.65
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 99.61
1w26_A 432 Trigger factor, TF; chaperone, protein folding, ri 99.43
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.33
1t11_A 392 Trigger factor, TF; helix-turn-helix, four-helix-b 99.27
3gty_X 433 Trigger factor, TF; chaperone-client complex, cell 97.94
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
Probab=99.96  E-value=9.4e-29  Score=187.49  Aligned_cols=125  Identities=58%  Similarity=1.103  Sum_probs=112.2

Q ss_pred             CCCeeecCCccEEEEEecCCCCCCCCCCEEEEEEEEEEcCCcEEecccCCCCceEEeccCCcccHHHHHHHcCCCCCCCc
Q 028234           81 PCEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPM  160 (211)
Q Consensus        81 ~~~~~~~~~G~~~~~l~~G~G~~~~~gd~V~v~y~~~~~~G~~~~st~~~~~p~~~~lg~~~~i~g~~~al~g~~~~~~m  160 (211)
                      ..++.++++|++|+++++|+|..++.||.|++||++++.||++|++++++++|+.|.+|.+++++||+++|.|+++|++|
T Consensus         4 ~~~~~~~~~Gl~~~~l~~G~G~~~~~gd~V~v~Y~g~~~dG~~fdss~~~~~p~~f~lG~~~~i~G~~~~L~G~~~~~~m   83 (129)
T 1u79_A            4 SCEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVGEVIKGWDQGILGSDGIPPM   83 (129)
T ss_dssp             -CCCEECTTSCEEEEEECCSSCBCCTTCEEEEEEEEECTTSCEEEEHHHHTSCEEEETTSSSSCHHHHHHHHCBTTBCCC
T ss_pred             CCccEECCCCeEEEEEEcCCCCCCCCCCEEEEEEEEEECCCCEEEecCCCCCCEEEEeCCCCccHHHHHHhccccccccc
Confidence            45688999999999999999999999999999999999999999999876789999999999999999999987889999


Q ss_pred             ccCcEEEEEECCCCCCCCCCCCCCCCCCCCCCCCeEEEEEEEEee
Q 028234          161 HVGGKRKLQIPPELAYGPEPAGCFSGDCNIPANATLVYDINFVGI  205 (211)
Q Consensus       161 ~~G~~~~v~vp~~~~yg~~g~~~~~~~~~ip~~~~l~~~vel~~i  205 (211)
                      ++|++++|+||++++||..+....++.+.||||++|+|+|+|++|
T Consensus        84 ~~Ge~~~v~ip~~~aYG~~~~~~~~~~~~Ip~~~~l~f~vel~~i  128 (129)
T 1u79_A           84 LTGGKRTLRIPPELAYGDRGAGCKGGSCLIPPASVLLFDIEYIGK  128 (129)
T ss_dssp             BTTCEEEEEECGGGTTGGGCEEEETTEEEECTTCCEEEEEEEEEE
T ss_pred             CCCCEEEEEEChHHccCCCCCCccccCCcCCCCCeEEEEEEEEEe
Confidence            999999999999999999875210112279999999999999987
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 211
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 2e-30
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 9e-22
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 3e-19
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 9e-19
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 1e-18
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 4e-18
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 5e-18
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 5e-17
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 6e-17
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 7e-16
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 4e-15
d1jvwa_160 d.26.1.1 (A:) Macrophage infectivity potentiator p 5e-15
d1hxva_85 d.26.1.1 (A:) Trigger factor PPIase domain {Mycopl 1e-10
d1ix5a_151 d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu 9e-10
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKBP13
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score =  106 bits (265), Expect = 2e-30
 Identities = 72/124 (58%), Positives = 87/124 (70%)

Query: 82  CEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVG 141
           CEFS + SGL +CD   G G EA  G+LI  HY  +  +G +FDSSY R +PLT RIGVG
Sbjct: 1   CEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVG 60

Query: 142 KVIKGLDQGILGGDGVPPMHVGGKRKLQIPPELAYGPEPAGCFSGDCNIPANATLVYDIN 201
           +VIKG DQGILG DG+PPM  GGKR L+IPPELAYG   AGC  G C IP  + L++DI 
Sbjct: 61  EVIKGWDQGILGSDGIPPMLTGGKRTLRIPPELAYGDRGAGCKGGSCLIPPASVLLFDIE 120

Query: 202 FVGI 205
           ++G 
Sbjct: 121 YIGK 124
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query211
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.97
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.96
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.96
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.96
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.96
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.96
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.96
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.96
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.95
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.92
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.89
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.69
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 99.61
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 99.18
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 99.05
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKBP13
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.97  E-value=3.1e-32  Score=203.84  Aligned_cols=124  Identities=58%  Similarity=1.111  Sum_probs=114.1

Q ss_pred             CCeeecCCccEEEEEecCCCCCCCCCCEEEEEEEEEEcCCcEEecccCCCCceEEeccCCcccHHHHHHHcCCCCCCCcc
Q 028234           82 CEFSFARSGLGYCDIASGSGVEAPYGELINVHYTARFADGIIFDSSYKRARPLTMRIGVGKVIKGLDQGILGGDGVPPMH  161 (211)
Q Consensus        82 ~~~~~~~~G~~~~~l~~G~G~~~~~gd~V~v~y~~~~~~G~~~~st~~~~~p~~~~lg~~~~i~g~~~al~g~~~~~~m~  161 (211)
                      +++.++++||+|+++++|+|+.|+.||.|.|||++++.||++|++|++.+.|+.|.+|.+.+++||++++.+.|+|+.|+
T Consensus         1 ~~~~~~psGl~y~~~~~G~G~~p~~gd~V~v~y~g~l~~G~~fdss~~~~~p~~~~~g~~~~i~g~~~~i~g~~~l~~M~   80 (125)
T d1u79a_           1 CEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVGEVIKGWDQGILGSDGIPPML   80 (125)
T ss_dssp             CCCEECTTSCEEEEEECCSSCBCCTTCEEEEEEEEECTTSCEEEEHHHHTSCEEEETTSSSSCHHHHHHHHCBTTBCCCB
T ss_pred             CCcEECCCCCEEEEEEeccCCCCCCCCEEEEEEEeeecCCcEEecccccCcceeEecCccccccchhhhccchhhccccc
Confidence            46889999999999999999999999999999999999999999999888999999999999999999998888999999


Q ss_pred             cCcEEEEEECCCCCCCCCCCCCCCCCCCCCCCCeEEEEEEEEee
Q 028234          162 VGGKRKLQIPPELAYGPEPAGCFSGDCNIPANATLVYDINFVGI  205 (211)
Q Consensus       162 ~G~~~~v~vp~~~~yg~~g~~~~~~~~~ip~~~~l~~~vel~~i  205 (211)
                      +|++++|+||++++||++|.......+.||||++|+|+|||+++
T Consensus        81 ~G~k~~v~iP~~laYG~~G~~~~~~~~~IPp~s~LifeieLl~~  124 (125)
T d1u79a_          81 TGGKRTLRIPPELAYGDRGAGCKGGSCLIPPASVLLFDIEYIGK  124 (125)
T ss_dssp             TTCEEEEEECGGGTTGGGCEEEETTEEEECTTCCEEEEEEEEEE
T ss_pred             CCCEEEEEECHHHCCCCCCcCCcCCCCcCCcCCeEEEEEEEEEe
Confidence            99999999999999999875322223369999999999999986
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure