Citrus Sinensis ID: 028240

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-
MAEDKKLQVPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEWSLWARDIENEIVPLCRFVRLAVKSV
cccccccccccccccccccEEcccccccccccccccccccHHHHHHHHHHHHHcccccEEccccccccccHHHHHHHHcccccccEEEEEEcccEEcccccccccccHHHHHHHHHHHHcHHccccEEccccccccccccHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHcccccHHHHHHHHHHcccccHHHHHHHHHHcccEEEc
ccccccccccEEEccccccEEEHcccccccccccccccccHHHHHHHHHHHHHccccEEccccccccccHHHHHHHHHccccccEEEEEEEEEEEEcccccccccccHHHHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHHHcccEEEEc
maedkklqvprvklgtqglevsklgygcmslsgcynsplseedgISIIKHAFskgitffdtadkygpytNEILLGKALKELPRENIQVATKFGFVELGFtsvivkgtpeyvRSCCEASLRRLDVEYIDLYYQhrvdtsvpiEETIGEMKKLVEEGKIKyiglseaspdtiRRAHAVHPITAVQLEWSLWARDIENEIVPLCRFVRLAVKSV
maedkklqvprvklgtqglevskLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTNEILLGKALKELPRENIQVATKFGFVELGFTsvivkgtpeyVRSCCEASLRRLDVEYIDLYYqhrvdtsvpieETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEWSLWARDIENEIVPLCRFVRLAVKSV
MAEDKKLQVPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEWSLWARDIENEIVPLCRFVRLAVKSV
************KLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEWSLWARDIENEIVPLCRFVRLAV***
*************LGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEWSLWARDIENEIVPLCRFVRLAVKSV
MAEDKKLQVPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEWSLWARDIENEIVPLCRFVRLAVKSV
******LQVPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEWSLWARDIENEIVPLCRFVRLAVKSV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEDKKLQVPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEWSLWARDIENEIVPLCRFVRLAVKSV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query211 2.2.26 [Sep-21-2011]
C6TBN2 346 Probable aldo-keto reduct no no 0.962 0.586 0.748 9e-91
Q3L181 337 Perakine reductase OS=Rau N/A no 0.947 0.593 0.736 2e-84
Q84M96 346 Probable aldo-keto reduct yes no 0.924 0.563 0.651 4e-72
P40691307 Auxin-induced protein PCN N/A no 0.952 0.654 0.639 3e-71
O22707 345 Probable aldo-keto reduct no no 0.981 0.6 0.628 1e-70
F4HPY8 330 Probable aldo-keto reduct no no 0.981 0.627 0.610 2e-70
Q93ZN2 345 Probable aldo-keto reduct no no 0.943 0.576 0.64 3e-70
Q9ASZ9 345 Probable aldo-keto reduct no no 0.943 0.576 0.625 8e-69
P49249306 IN2-2 protein OS=Zea mays N/A no 0.952 0.656 0.613 2e-68
Q7XT99 351 Probable aldo-keto reduct no no 0.938 0.564 0.626 2e-68
>sp|C6TBN2|AKR1_SOYBN Probable aldo-keto reductase 1 OS=Glycine max GN=AKR1 PE=2 SV=1 Back     alignment and function desciption
 Score =  332 bits (852), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 152/203 (74%), Positives = 176/203 (86%)

Query: 6   KLQVPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKY 65
           + Q+  VKLGTQG EVSKLG+GCM L+G YN PL E+DGIS+IK+AFSKGITFFDTAD Y
Sbjct: 3   QAQIQPVKLGTQGFEVSKLGFGCMGLTGAYNDPLQEQDGISVIKYAFSKGITFFDTADVY 62

Query: 66  GPYTNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVE 125
           G   NE+L+GKALK+LPRE IQ+ATKFG    GF  + ++G+PEYVRSCCE  L+RLDVE
Sbjct: 63  GANANELLVGKALKQLPREKIQIATKFGIASRGFPDMKIEGSPEYVRSCCETGLKRLDVE 122

Query: 126 YIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLE 185
           YIDLYYQHRVDTSVPIEET+GE+KKLVEEGK+KYIGLSEASPDTIRRAHA+HPITAVQ+E
Sbjct: 123 YIDLYYQHRVDTSVPIEETVGELKKLVEEGKVKYIGLSEASPDTIRRAHAIHPITAVQIE 182

Query: 186 WSLWARDIENEIVPLCRFVRLAV 208
           WSLW RDIE EIVPLCR + + +
Sbjct: 183 WSLWTRDIEEEIVPLCRELGIGI 205
May interfere with the nodulation process and inhibits nodule development.
Glycine max (taxid: 3847)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q3L181|PERR_RAUSE Perakine reductase OS=Rauvolfia serpentina GN=PR PE=1 SV=1 Back     alignment and function description
>sp|Q84M96|ALKR2_ARATH Probable aldo-keto reductase 2 OS=Arabidopsis thaliana GN=AGD2 PE=1 SV=1 Back     alignment and function description
>sp|P40691|A115_TOBAC Auxin-induced protein PCNT115 OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|O22707|ALKR3_ARATH Probable aldo-keto reductase 3 OS=Arabidopsis thaliana GN=At1g60690 PE=3 SV=1 Back     alignment and function description
>sp|F4HPY8|AKR6_ARATH Probable aldo-keto reductase 6 OS=Arabidopsis thaliana GN=At1g60750 PE=3 SV=1 Back     alignment and function description
>sp|Q93ZN2|ALKR4_ARATH Probable aldo-keto reductase 4 OS=Arabidopsis thaliana GN=At1g60710 PE=1 SV=1 Back     alignment and function description
>sp|Q9ASZ9|ALKR5_ARATH Probable aldo-keto reductase 5 OS=Arabidopsis thaliana GN=At1g60730 PE=2 SV=1 Back     alignment and function description
>sp|P49249|IN22_MAIZE IN2-2 protein OS=Zea mays GN=IN2-2 PE=2 SV=1 Back     alignment and function description
>sp|Q7XT99|AKR2_ORYSJ Probable aldo-keto reductase 2 OS=Oryza sativa subsp. japonica GN=Os04g0338000 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query211
356571605 345 PREDICTED: LOW QUALITY PROTEIN: auxin-in 0.966 0.591 0.764 4e-93
224125632 348 predicted protein [Populus trichocarpa] 0.985 0.597 0.757 2e-91
356573095 346 PREDICTED: LOW QUALITY PROTEIN: auxin-in 0.966 0.589 0.760 1e-90
359487903 335 PREDICTED: auxin-induced protein PCNT115 0.976 0.614 0.755 4e-90
225451316 347 PREDICTED: auxin-induced protein PCNT115 0.976 0.593 0.755 5e-90
255542314 343 aldo/keto reductase, putative [Ricinus c 0.981 0.603 0.740 6e-90
449445274 347 PREDICTED: probable aldo-keto reductase 0.981 0.596 0.735 8e-90
356505965 351 PREDICTED: auxin-induced protein PCNT115 0.985 0.592 0.751 1e-89
356505967 359 PREDICTED: auxin-induced protein PCNT115 0.985 0.579 0.751 3e-89
255542306 350 aldo/keto reductase, putative [Ricinus c 0.985 0.594 0.733 3e-89
>gi|356571605|ref|XP_003553967.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein PCNT115-like [Glycine max] Back     alignment and taxonomy information
 Score =  346 bits (887), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 184/204 (90%)

Query: 5   KKLQVPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADK 64
           + +Q+PRVKLGTQGLEVSKLGYGCM L+G YN PL EE+GIS+IKHAFSKGITFFDT+D 
Sbjct: 3   QSVQMPRVKLGTQGLEVSKLGYGCMGLTGAYNDPLPEEEGISVIKHAFSKGITFFDTSDM 62

Query: 65  YGPYTNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDV 124
           YGP+ NEI+LGKA+K+LPRE IQ+ATKFG  ++  + ++VKGTPEY RSCCEASL+RL V
Sbjct: 63  YGPHANEIVLGKAIKQLPREKIQIATKFGITKIDSSGMVVKGTPEYARSCCEASLKRLGV 122

Query: 125 EYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQL 184
           EYIDLYYQHRVD SVPIEETIGE+KKLVEEGK++YIGLSEASPDTIRRAHAVHPITAVQ+
Sbjct: 123 EYIDLYYQHRVDLSVPIEETIGELKKLVEEGKVRYIGLSEASPDTIRRAHAVHPITAVQM 182

Query: 185 EWSLWARDIENEIVPLCRFVRLAV 208
           EWSLW RDIE+EI+PLC+ + + +
Sbjct: 183 EWSLWTRDIEDEIIPLCKELGIGI 206

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224125632|ref|XP_002319637.1| predicted protein [Populus trichocarpa] gi|222858013|gb|EEE95560.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356573095|ref|XP_003554700.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein PCNT115-like [Glycine max] Back     alignment and taxonomy information
>gi|359487903|ref|XP_003633671.1| PREDICTED: auxin-induced protein PCNT115 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225451316|ref|XP_002278850.1| PREDICTED: auxin-induced protein PCNT115 isoform 1 [Vitis vinifera] gi|298204869|emb|CBI34176.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255542314|ref|XP_002512220.1| aldo/keto reductase, putative [Ricinus communis] gi|223548181|gb|EEF49672.1| aldo/keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449445274|ref|XP_004140398.1| PREDICTED: probable aldo-keto reductase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356505965|ref|XP_003521759.1| PREDICTED: auxin-induced protein PCNT115-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356505967|ref|XP_003521760.1| PREDICTED: auxin-induced protein PCNT115-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|255542306|ref|XP_002512216.1| aldo/keto reductase, putative [Ricinus communis] gi|223548177|gb|EEF49668.1| aldo/keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query211
TAIR|locus:2036591 346 AT1G60680 "AT1G60680" [Arabido 0.976 0.595 0.625 1.1e-66
TAIR|locus:2036611 345 AT1G60690 "AT1G60690" [Arabido 0.981 0.6 0.628 5.8e-66
TAIR|locus:2036504 345 ATB2 [Arabidopsis thaliana (ta 0.943 0.576 0.64 1.5e-65
TAIR|locus:2036551 330 AT1G60750 [Arabidopsis thalian 0.981 0.627 0.610 2.5e-65
TAIR|locus:2196446 344 AT1G10810 "AT1G10810" [Arabido 0.943 0.578 0.625 6.2e-62
TIGR_CMR|SPO_A0345 327 SPO_A0345 "oxidoreductase, ald 0.895 0.577 0.533 3.3e-47
TIGR_CMR|GSU_3126 334 GSU_3126 "oxidoreductase, aldo 0.872 0.550 0.507 1.6e-45
UNIPROTKB|G4NAH9 341 MGG_09715 "Aldo-keto reductase 0.938 0.580 0.429 1.1e-37
POMBASE|SPAC1F7.12 340 yak3 "aldose reductase ARK13 f 0.914 0.567 0.412 1.9e-35
ASPGD|ASPL0000051701 339 AN10217 [Emericella nidulans ( 0.928 0.578 0.412 1.5e-33
TAIR|locus:2036591 AT1G60680 "AT1G60680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 678 (243.7 bits), Expect = 1.1e-66, P = 1.1e-66
 Identities = 130/208 (62%), Positives = 163/208 (78%)

Query:     1 MAEDKKLQVPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFD 60
             MAE    +V R+KLG+QGLEVS  G GCM+LS  Y +P  E D I+++ HA + G+TFFD
Sbjct:     1 MAE--ACRVRRMKLGSQGLEVSAQGLGCMALSARYGAPKPETDAIALLHHAINSGVTFFD 58

Query:    61 TADKYGPYTNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLR 120
             T+D YGP TNE+LLGKALK+  +E +++ATKFGF  +      V+G PEYVR+ CEASL+
Sbjct:    59 TSDMYGPETNELLLGKALKDGVKEKVELATKFGFFIVEGEISEVRGDPEYVRAACEASLK 118

Query:   121 RLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPIT 180
             RLD+  IDLYYQHR+DT VPIE T+ E+KKLVEEGKIKYIGLSEAS  TIRRAHAVHPIT
Sbjct:   119 RLDIACIDLYYQHRIDTRVPIEITMRELKKLVEEGKIKYIGLSEASASTIRRAHAVHPIT 178

Query:   181 AVQLEWSLWARDIENEIVPLCRFVRLAV 208
             AVQ+EWSLW+RD E +I+P+CR + + +
Sbjct:   179 AVQIEWSLWSRDAEEDIIPICRELGIGI 206
GO:0004033 "aldo-keto reductase (NADP) activity" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2036611 AT1G60690 "AT1G60690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036504 ATB2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036551 AT1G60750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196446 AT1G10810 "AT1G10810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_A0345 SPO_A0345 "oxidoreductase, aldo/keto reductase family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3126 GSU_3126 "oxidoreductase, aldo/keto reductase family" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|G4NAH9 MGG_09715 "Aldo-keto reductase yakc" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
POMBASE|SPAC1F7.12 yak3 "aldose reductase ARK13 family YakC" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000051701 AN10217 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
cd06660285 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) 2e-73
COG0667 316 COG0667, Tas, Predicted oxidoreductases (related t 1e-71
pfam00248277 pfam00248, Aldo_ket_red, Aldo/keto reductase famil 7e-59
COG0656280 COG0656, ARA1, Aldo/keto reductases, related to di 5e-30
PLN02587 314 PLN02587, PLN02587, L-galactose dehydrogenase 3e-26
COG4989298 COG4989, COG4989, Predicted oxidoreductase [Genera 4e-26
COG1453 391 COG1453, COG1453, Predicted oxidoreductases of the 1e-24
PRK09912 346 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate r 9e-20
TIGR01293 317 TIGR01293, Kv_beta, voltage-dependent potassium ch 2e-17
PRK10376290 PRK10376, PRK10376, putative oxidoreductase; Provi 9e-17
PRK10625 346 PRK10625, tas, putative aldo-keto reductase; Provi 2e-13
PRK11565275 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A 4e-10
PRK11172267 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B 7e-04
>gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information 
 Score =  223 bits (571), Expect = 2e-73
 Identities = 80/196 (40%), Positives = 110/196 (56%), Gaps = 11/196 (5%)

Query: 11  RVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTN 70
              LG  GL+VS+LG G   L G Y   + EE+  + ++ A   GI F DTAD YG   +
Sbjct: 1   YRTLGKTGLKVSRLGLGTWQLGGGY---VDEEEAAAAVRAALDAGINFIDTADVYGDGES 57

Query: 71  EILLGKALKELP-RENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDL 129
           E LLG+ALKE   RE + +ATK G             +PE++R   E SL+RL  +YIDL
Sbjct: 58  EELLGEALKERGPREEVFIATKVGPRPGDG----RDLSPEHIRRAVEESLKRLGTDYIDL 113

Query: 130 YYQHRVDTSVP-IEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAV--HPITAVQLEW 186
           Y  H  D   P IEET+  +++LV+EGKI+ IG+S  S + +  A A    P    Q+E+
Sbjct: 114 YLLHWPDPDTPDIEETLRALEELVKEGKIRAIGVSNFSAEQLEEALAAAGVPPAVNQVEY 173

Query: 187 SLWARDIENEIVPLCR 202
           +L  R  E E++P CR
Sbjct: 174 NLLDRQAEEELLPYCR 189

AKRs are present in all phyla and are of importance to both health and industrial applications. Members have very distinct functions and include the prokaryotic 2,5-diketo-D-gluconic acid reductases and beta-keto ester reductases, the eukaryotic aldose reductases, aldehyde reductases, hydroxysteroid dehydrogenases, steroid 5beta-reductases, potassium channel beta-subunits and aflatoxin aldehyde reductases, among others. Length = 285
>gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family Back     alignment and domain information
>gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|178198 PLN02587, PLN02587, L-galactose dehydrogenase Back     alignment and domain information
>gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224370 COG1453, COG1453, Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>gnl|CDD|182140 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>gnl|CDD|213602 TIGR01293, Kv_beta, voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>gnl|CDD|236676 PRK10376, PRK10376, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional Back     alignment and domain information
>gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 211
COG0667 316 Tas Predicted oxidoreductases (related to aryl-alc 100.0
KOG1575 336 consensus Voltage-gated shaker-like K+ channel, su 100.0
COG0656280 ARA1 Aldo/keto reductases, related to diketogulona 100.0
PRK09912 346 L-glyceraldehyde 3-phosphate reductase; Provisiona 100.0
TIGR01293 317 Kv_beta voltage-dependent potassium channel beta s 100.0
cd06660285 Aldo_ket_red Aldo-keto reductases (AKRs) are a sup 100.0
PRK10625 346 tas putative aldo-keto reductase; Provisional 100.0
PRK10376290 putative oxidoreductase; Provisional 100.0
PLN02587 314 L-galactose dehydrogenase 100.0
KOG1577300 consensus Aldo/keto reductase family proteins [Gen 100.0
PF00248283 Aldo_ket_red: Aldo/keto reductase family; InterPro 100.0
PRK11172267 dkgB 2,5-diketo-D-gluconate reductase B; Provision 100.0
PRK14863 292 bifunctional regulator KidO; Provisional 100.0
PRK11565275 dkgA 2,5-diketo-D-gluconate reductase A; Provision 100.0
COG4989298 Predicted oxidoreductase [General function predict 100.0
COG1453 391 Predicted oxidoreductases of the aldo/keto reducta 100.0
KOG1576 342 consensus Predicted oxidoreductase [Energy product 100.0
KOG3023285 consensus Glutamate-cysteine ligase regulatory sub 98.17
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 94.86
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 93.2
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 93.04
cd03174 265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 90.8
PRK13958207 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 89.54
PRK01222210 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 89.15
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 88.79
cd00739 257 DHPS DHPS subgroup of Pterin binding enzymes. DHPS 88.63
COG0135 208 TrpF Phosphoribosylanthranilate isomerase [Amino a 88.12
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 86.05
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 85.21
cd00423 258 Pterin_binding Pterin binding enzymes. This family 84.63
COG1140 513 NarY Nitrate reductase beta subunit [Energy produc 84.45
cd00740 252 MeTr MeTr subgroup of pterin binding enzymes. This 83.96
cd03322361 rpsA The starvation sensing protein RpsA from E.co 82.98
COG0635416 HemN Coproporphyrinogen III oxidase and related Fe 82.76
PRK07379 400 coproporphyrinogen III oxidase; Provisional 81.2
PRK05692 287 hydroxymethylglutaryl-CoA lyase; Provisional 80.81
>COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=2e-51  Score=344.14  Aligned_cols=201  Identities=43%  Similarity=0.670  Sum_probs=182.5

Q ss_pred             CCeeecCCCCcccccceeccccCCCCCCCCCCHHHHHHHHHHHHHcCCCeEeCCCCcCCCcHHHHHHHHHhcCC-CCcEE
Q 028240            9 VPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTNEILLGKALKELP-RENIQ   87 (211)
Q Consensus         9 ~~~~~lg~~g~~vs~lg~G~~~~~~~~~~~~~~~~~~~~l~~A~~~Gi~~~DtA~~Yg~g~~E~~lG~~l~~~~-r~~~~   87 (211)
                      |+++++|++|++||+||||||.+|+.+ ...+.+++.++|++|+++||||||||+.||.|.||+++|++|++.+ |++++
T Consensus         1 m~~r~lG~~gl~vs~lglG~~~~g~~~-~~~~~~~a~~il~~A~d~Gin~~DTA~~Yg~g~sE~ilG~~l~~~~~Rd~vv   79 (316)
T COG0667           1 MKYRRLGRSGLKVSPLGLGTMTLGGDT-DDEEEAEAIEILDAALDAGINFFDTADVYGDGRSEEILGEALKERGRRDKVV   79 (316)
T ss_pred             CCceecCCCCceecceeeeccccCCCC-CchhhhHHHHHHHHHHHcCCCEEECccccCCCchHHHHHHHHhccCCCCeEE
Confidence            678999999999999999999998752 2345567888999999999999999999999999999999999876 89999


Q ss_pred             EEeccccccCCCccc-ccCCChHHHHHHHHHHHhhcCCCceeEEEeecCCCCCCHHHHHHHHHHHHHcCcccEEEeCCCC
Q 028240           88 VATKFGFVELGFTSV-IVKGTPEYVRSCCEASLRRLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEAS  166 (211)
Q Consensus        88 i~tK~~~~~~~~~~~-~~~~s~~~i~~~~~~sL~~Lg~~~iDl~~lh~~~~~~~~~~~~~~l~~l~~~G~ir~iGvs~~~  166 (211)
                      |+||++.....+... ..+.++++|+++++.||+|||+||||+|++|+||+..+.++++++|.+|+++|+||++|+||++
T Consensus        80 IaTK~g~~~~~~~~~~~~~~s~~~i~~~v~~SL~RLgtd~IDl~~iH~~d~~~p~~e~~~aL~~l~~~G~ir~iG~S~~~  159 (316)
T COG0667          80 IATKVGYRPGDPGPNGVFGLSRDHIRRAVEASLKRLGTDYIDLYQLHRPDPETPIEETLEALDELVREGKIRYIGVSNYS  159 (316)
T ss_pred             EEEeeccCCCCCCCCccCCCCHHHHHHHHHHHHHHhCCCceeEEEeCCCCCCCCHHHHHHHHHHHHHcCCeeEEEecCCC
Confidence            999998765432111 3567999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhcc-CCceEEeccCCccccCchhhHHHHHHHcCCeeee
Q 028240          167 PDTIRRAHAV-HPITAVQLEWSLWARDIENEIVPLCRFVRLAVKS  210 (211)
Q Consensus       167 ~~~l~~~~~~-~~~~~~q~~~~~~~~~~~~~~~~~~~~~gi~v~a  210 (211)
                      ++++.++++. .+++++|.+||+++|..+.+++++|+++||++++
T Consensus       160 ~~~i~~a~~~~~~~~~~Q~~ynl~~R~~e~~l~~~~~~~gi~~~~  204 (316)
T COG0667         160 AEQIAEALAVAAPIDSLQPEYNLLERDAEKELLPLCREEGIGLLA  204 (316)
T ss_pred             HHHHHHHHHhcCCceeecccCccccccchhHHHHHHHHcCCeEEE
Confidence            9999999998 5999999999999988777799999999999986

>KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] Back     alignment and domain information
>COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>PRK10625 tas putative aldo-keto reductase; Provisional Back     alignment and domain information
>PRK10376 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN02587 L-galactose dehydrogenase Back     alignment and domain information
>KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] Back     alignment and domain information
>PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] Back     alignment and domain information
>PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>PRK14863 bifunctional regulator KidO; Provisional Back     alignment and domain information
>PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>COG4989 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] Back     alignment and domain information
>KOG3023 consensus Glutamate-cysteine ligase regulatory subunit [Amino acid transport and metabolism] Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>PRK01222 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>cd00739 DHPS DHPS subgroup of Pterin binding enzymes Back     alignment and domain information
>COG0135 TrpF Phosphoribosylanthranilate isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>cd00423 Pterin_binding Pterin binding enzymes Back     alignment and domain information
>COG1140 NarY Nitrate reductase beta subunit [Energy production and conversion] Back     alignment and domain information
>cd00740 MeTr MeTr subgroup of pterin binding enzymes Back     alignment and domain information
>cd03322 rpsA The starvation sensing protein RpsA from E Back     alignment and domain information
>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] Back     alignment and domain information
>PRK07379 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
3v0u_A 338 Crystal Structure Of Perakine Reductase, Founder Me 2e-85
3v0t_A 337 Crystal Structure Of Perakine Reductase, Founder Me 3e-85
3uyi_A 337 Crystal Structure Of Perakine Reductase, Founder Me 7e-85
3v0s_A 337 Crystal Structure Of Perakine Reductase, Founder Me 1e-82
1pyf_A 312 Structure Of Nadph-Dependent Family 11 Aldo-Keto Re 8e-25
1ynp_A 317 Aldo-keto Reductase Akr11c1 From Bacillus Haloduran 6e-23
3n2t_A 348 Structure Of The Glycerol Dehydrogenase Akr11b4 Fro 1e-22
1pz1_A 333 Structure Of Nadph-Dependent Family 11 Aldo-Keto Re 4e-22
4aub_A 366 The Complex Structure Of The Bacterial Aldo-Keto Re 1e-18
3n6q_A 346 Crystal Structure Of Yghz From E. Coli Length = 346 1e-18
3erp_A 353 Structure Of Idp01002, A Putative Oxidoreductase Fr 1e-17
3lut_A 367 A Structural Model For The Full-Length Shaker Potas 1e-14
3eau_A 327 Voltage-Dependent K+ Channel Beta Subunit In Comple 2e-14
3eb4_A 327 Voltage-Dependent K+ Channel Beta Subunit (I211r) I 2e-14
1zsx_A 347 Crystal Structure Of Human Potassium Channel Kv Bet 2e-14
1qrq_A 325 Structure Of A Voltage-Dependent K+ Channel Beta Su 2e-14
2a79_A 333 Mammalian Shaker Kv1.2 Potassium Channel- Beta Subu 2e-14
1exb_A 332 Structure Of The Cytoplasmic Beta Subunit-T1 Assemb 2e-14
3eb3_A 327 Voltage-Dependent K+ Channel Beta Subunit (W121a) I 3e-14
1og6_A298 Ydhf, An Aldo-keto Reductase From E.coli Complexed 8e-12
1ur3_M319 Crystal Structure Of The Apo Form Of The E.Coli Ydh 7e-11
3up8_A298 Crystal Structure Of A Putative 2,5-Diketo-D-Glucon 1e-09
3o0k_A283 Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL 1e-09
1vp5_A298 Crystal Structure Of 2,5-diketo-d-gluconic Acid Red 5e-09
2wzm_A283 Crystal Structure Of A Mycobacterium Aldo-Keto Redu 1e-08
2clp_A 347 Crystal Structure Of Human Aflatoxin B1 Aldehyde Re 3e-08
2bp1_B 360 Structure Of The Aflatoxin Aldehyde Reductase In Co 3e-08
2c91_A 338 Mouse Succinic Semialdehyde Reductase, Akr7a5 Lengt 4e-08
4gac_A 324 High Resolution Structure Of Mouse Aldehyde Reducta 1e-07
1qwk_A 317 Structural Genomics Of Caenorhabditis Elegans: Hypo 2e-07
1gve_A 327 Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Live 7e-07
1lqa_A 346 Tas Protein From Escherichia Coli In Complex With N 8e-07
4fzi_A290 Crystal Structure Of Prostaglandin F Synthase From 3e-06
3cv7_A 325 Crystal Structure Of Porcine Aldehyde Reductase Ter 3e-06
2alr_A 324 Aldehyde Reductase Length = 324 5e-06
1cwn_A 324 Crystal Structure Of Porcine Aldehyde Reductase Hol 6e-06
1ae4_A 325 Aldehyde Reductase Complexed With Cofactor And Inhi 6e-06
1z9a_A 321 Crystal Structure Of The Asn-309 To Asp Mutant Of C 7e-06
1jez_A 322 The Structure Of Xylose Reductase, A Dimeric Aldo-K 8e-06
1ye4_A 322 Crystal Structure Of The Lys-274 To Arg Mutant Of C 8e-06
1sm9_A 322 Crystal Structure Of An Engineered K274rn276d Doubl 8e-06
1hqt_A 326 The Crystal Structure Of An Aldehyde Reductase Y50f 9e-06
1r38_A 322 Crystal Structure Of H114a Mutant Of Candida Tenuis 2e-05
3krb_A 334 Structure Of Aldose Reductase From Giardia Lamblia 6e-05
4f40_A288 X-Ray Crystal Structure Of Apo Prostaglandin F Synt 9e-05
1vbj_A281 The Crystal Structure Of Prostaglandin F Synthase F 1e-04
1mzr_A296 Structure Of Dkga From E.Coli At 2.13 A Resolution 2e-04
2bgq_A 344 Apo Aldose Reductase From Barley Length = 344 6e-04
>pdb|3V0U|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 338 Back     alignment and structure 
Iteration: 1

 Score =  311 bits (796), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 175/202 (86%), Gaps = 1/202 (0%)
Query: 8   QVPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGP 67
            +PRVKLGTQGLEVSKLG+GCM LSG YN  L EE GI++IK AF+ GITFFDT+D YG 
Sbjct: 1   HMPRVKLGTQGLEVSKLGFGCMGLSGDYNDALPEEQGIAVIKEAFNCGITFFDTSDIYGE 60
Query: 68  Y-TNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEY 126
             +NE LLGKALK+LPRE IQV TKFG  E+GF+ V  KGTP+YVRSCCEASL+RLDV+Y
Sbjct: 61  NGSNEELLGKALKQLPREKIQVGTKFGIHEIGFSGVKAKGTPDYVRSCCEASLKRLDVDY 120
Query: 127 IDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEW 186
           IDL+Y HR+DT+VPIE T+GE+KKLVEEGKIKY+GLSEASPDTIRRAHAVHP+TA+Q+E+
Sbjct: 121 IDLFYIHRIDTTVPIEITMGELKKLVEEGKIKYVGLSEASPDTIRRAHAVHPVTALQIEY 180
Query: 187 SLWARDIENEIVPLCRFVRLAV 208
           SLW RDIE+EIVPLCR + + +
Sbjct: 181 SLWTRDIEDEIVPLCRQLGIGI 202
>pdb|3V0T|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|3UYI|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|3V0S|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|1PYF|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11a(Apo) Length = 312 Back     alignment and structure
>pdb|1YNP|A Chain A, Aldo-keto Reductase Akr11c1 From Bacillus Halodurans (apo Form) Length = 317 Back     alignment and structure
>pdb|3N2T|A Chain A, Structure Of The Glycerol Dehydrogenase Akr11b4 From Gluconobacter Oxydans Length = 348 Back     alignment and structure
>pdb|1PZ1|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11b(Holo) Length = 333 Back     alignment and structure
>pdb|4AUB|A Chain A, The Complex Structure Of The Bacterial Aldo-Keto Reductase Akr14a1 With Nadp And Citrate Length = 366 Back     alignment and structure
>pdb|3N6Q|A Chain A, Crystal Structure Of Yghz From E. Coli Length = 346 Back     alignment and structure
>pdb|3ERP|A Chain A, Structure Of Idp01002, A Putative Oxidoreductase From And Essential Gene Of Salmonella Typhimurium Length = 353 Back     alignment and structure
>pdb|3LUT|A Chain A, A Structural Model For The Full-Length Shaker Potassium Channel Kv1.2 Length = 367 Back     alignment and structure
>pdb|3EAU|A Chain A, Voltage-Dependent K+ Channel Beta Subunit In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|3EB4|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (I211r) In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|1ZSX|A Chain A, Crystal Structure Of Human Potassium Channel Kv Beta-Subunit (Kcnab2) Length = 347 Back     alignment and structure
>pdb|1QRQ|A Chain A, Structure Of A Voltage-Dependent K+ Channel Beta Subunit Length = 325 Back     alignment and structure
>pdb|2A79|A Chain A, Mammalian Shaker Kv1.2 Potassium Channel- Beta Subunit Complex Length = 333 Back     alignment and structure
>pdb|1EXB|A Chain A, Structure Of The Cytoplasmic Beta Subunit-T1 Assembly Of Voltage-Dependent K Channels Length = 332 Back     alignment and structure
>pdb|3EB3|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (W121a) In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|1OG6|A Chain A, Ydhf, An Aldo-keto Reductase From E.coli Complexed With Nadph Length = 298 Back     alignment and structure
>pdb|1UR3|M Chain M, Crystal Structure Of The Apo Form Of The E.Coli Ydhf Protein Length = 319 Back     alignment and structure
>pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 Back     alignment and structure
>pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 Back     alignment and structure
>pdb|1VP5|A Chain A, Crystal Structure Of 2,5-diketo-d-gluconic Acid Reductase (tm1009) From Thermotoga Maritima At 2.40 A Resolution Length = 298 Back     alignment and structure
>pdb|2WZM|A Chain A, Crystal Structure Of A Mycobacterium Aldo-Keto Reductase In Its Apo And Liganded Form Length = 283 Back     alignment and structure
>pdb|2CLP|A Chain A, Crystal Structure Of Human Aflatoxin B1 Aldehyde Reductase Member 3 Length = 347 Back     alignment and structure
>pdb|2C91|A Chain A, Mouse Succinic Semialdehyde Reductase, Akr7a5 Length = 338 Back     alignment and structure
>pdb|4GAC|A Chain A, High Resolution Structure Of Mouse Aldehyde Reductase (akr1a4) In Its Apo-form Length = 324 Back     alignment and structure
>pdb|1QWK|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Hypothetical 35.2 Kda Protein (Aldose Reductase Family Member) Length = 317 Back     alignment and structure
>pdb|1GVE|A Chain A, Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Liver Length = 327 Back     alignment and structure
>pdb|1LQA|A Chain A, Tas Protein From Escherichia Coli In Complex With Nadph Length = 346 Back     alignment and structure
>pdb|4FZI|A Chain A, Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Cruzi Length = 290 Back     alignment and structure
>pdb|3CV7|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Ternary Complex Length = 325 Back     alignment and structure
>pdb|2ALR|A Chain A, Aldehyde Reductase Length = 324 Back     alignment and structure
>pdb|1CWN|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Holoenzyme Length = 324 Back     alignment and structure
>pdb|1AE4|A Chain A, Aldehyde Reductase Complexed With Cofactor And Inhibitor, Alpha Carbon Atoms Only Length = 325 Back     alignment and structure
>pdb|1Z9A|A Chain A, Crystal Structure Of The Asn-309 To Asp Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 321 Back     alignment and structure
>pdb|1JEZ|A Chain A, The Structure Of Xylose Reductase, A Dimeric Aldo-Keto Reductase From Candida Tenuis Length = 322 Back     alignment and structure
>pdb|1YE4|A Chain A, Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 322 Back     alignment and structure
>pdb|1SM9|A Chain A, Crystal Structure Of An Engineered K274rn276d Double Mutant Of Xylose Reductase From Candida Tenuis Optimized To Utilize Nad Length = 322 Back     alignment and structure
>pdb|1HQT|A Chain A, The Crystal Structure Of An Aldehyde Reductase Y50f Mutant- Nadp Complex And Its Implications For Substrate Binding Length = 326 Back     alignment and structure
>pdb|1R38|A Chain A, Crystal Structure Of H114a Mutant Of Candida Tenuis Xylose Reductase Length = 322 Back     alignment and structure
>pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 Back     alignment and structure
>pdb|4F40|A Chain A, X-Ray Crystal Structure Of Apo Prostaglandin F Synthase From Leishmania Major Friedlin Length = 288 Back     alignment and structure
>pdb|1VBJ|A Chain A, The Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Brucei Length = 281 Back     alignment and structure
>pdb|1MZR|A Chain A, Structure Of Dkga From E.Coli At 2.13 A Resolution Solved By Molecular Replacement Length = 296 Back     alignment and structure
>pdb|2BGQ|A Chain A, Apo Aldose Reductase From Barley Length = 344 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
1pyf_A 312 IOLS protein; beta-alpha barrel, aldo-keto reducta 1e-119
3n2t_A 348 Putative oxidoreductase; aldo/keto reductase super 1e-118
1pz1_A 333 GSP69, general stress protein 69; beta-alpha barre 1e-104
3v0s_A 337 Perakine reductase; AKR superfamily, oxidoreductas 3e-98
1ynp_A 317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 3e-92
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 5e-89
2bp1_A 360 Aflatoxin B1 aldehyde reductase member 2; oxidored 5e-55
3erp_A 353 Putative oxidoreductase; funded by the national in 1e-53
1gve_A 327 Aflatoxin B1 aldehyde reductase member 3; oxidored 1e-52
3eau_A 327 Voltage-gated potassium channel subunit beta-2; kv 3e-52
3lut_A 367 Voltage-gated potassium channel subunit beta-2; vo 8e-51
3n6q_A 346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 2e-50
1lqa_A 346 TAS protein; TIM barrel, structure 2 function proj 8e-39
1qwk_A 317 Aldose reductase, aldo-keto reductase family 1 mem 1e-18
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 5e-18
3buv_A 326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 8e-18
1s1p_A 331 Aldo-keto reductase family 1 member C3; TIM-barrel 1e-17
1us0_A 316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 2e-17
2bgs_A 344 Aldose reductase; holoenzyme, aldo/keto reductase, 3e-17
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 4e-17
3o3r_A 316 Aldo-keto reductase family 1, member B7; aldose re 7e-17
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 8e-17
3h7u_A 335 Aldo-keto reductase; stress response, NADP, drough 8e-17
1mi3_A 322 Xylose reductase, XR; aldo-keto reductase, beta-al 1e-16
2ao0_A 324 Aldehyde dehydrogenase; TIM barrel, aldo-keto redu 1e-16
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 2e-16
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 2e-16
1afs_A 323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 2e-16
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 2e-16
3krb_A 334 Aldose reductase; ssgcid, SBRI, emerald biostructu 3e-16
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 4e-16
3h7r_A 331 Aldo-keto reductase; stress response, NADP, drough 9e-16
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 1e-15
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 3e-15
4gie_A290 Prostaglandin F synthase; structural genomics, nia 4e-15
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 5e-15
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 1e-14
3ln3_A 324 Dihydrodiol dehydrogenase; putative reductase, str 3e-10
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 Back     alignment and structure
 Score =  339 bits (872), Expect = e-119
 Identities = 59/193 (30%), Positives = 106/193 (54%), Gaps = 2/193 (1%)

Query: 11  RVKLGTQGLEVSKLGYGCMSLSG-CYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYT 69
           + KLG   L+V  +G G  ++ G      L+EE G  +++ A   G+T  DTA  YG   
Sbjct: 3   KAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGIGR 62

Query: 70  NEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDL 129
           +E L+G+ L+E  RE++ +ATK    + G    +   +P++++   + SL+RL+ +YIDL
Sbjct: 63  SEELIGEVLREFNREDVVIATKAAHRKQG-NDFVFDNSPDFLKKSVDESLKRLNTDYIDL 121

Query: 130 YYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEWSLW 189
           +Y H  D   P +E +  + ++ + GKI+ IG+S  S + ++ A+    +  +Q E++L 
Sbjct: 122 FYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLEQLKEANKDGLVDVLQGEYNLL 181

Query: 190 ARDIENEIVPLCR 202
            R+ E    P  +
Sbjct: 182 NREAEKTFFPYTK 194
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query211
3v0s_A 337 Perakine reductase; AKR superfamily, oxidoreductas 100.0
3n2t_A 348 Putative oxidoreductase; aldo/keto reductase super 100.0
1pyf_A 312 IOLS protein; beta-alpha barrel, aldo-keto reducta 100.0
1pz1_A 333 GSP69, general stress protein 69; beta-alpha barre 100.0
3n6q_A 346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 100.0
1ynp_A 317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 100.0
3eau_A 327 Voltage-gated potassium channel subunit beta-2; kv 100.0
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 100.0
3erp_A 353 Putative oxidoreductase; funded by the national in 100.0
4exb_A292 Putative uncharacterized protein; aldo-keto reduct 100.0
3lut_A 367 Voltage-gated potassium channel subunit beta-2; vo 100.0
1lqa_A 346 TAS protein; TIM barrel, structure 2 function proj 100.0
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
3ln3_A 324 Dihydrodiol dehydrogenase; putative reductase, str 100.0
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 100.0
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 100.0
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 100.0
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 100.0
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 100.0
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 100.0
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
1afs_A 323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 100.0
3buv_A 326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 100.0
1mi3_A 322 Xylose reductase, XR; aldo-keto reductase, beta-al 100.0
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 100.0
3o3r_A 316 Aldo-keto reductase family 1, member B7; aldose re 100.0
1s1p_A 331 Aldo-keto reductase family 1 member C3; TIM-barrel 100.0
1gve_A 327 Aflatoxin B1 aldehyde reductase member 3; oxidored 100.0
2bp1_A 360 Aflatoxin B1 aldehyde reductase member 2; oxidored 100.0
3h7u_A 335 Aldo-keto reductase; stress response, NADP, drough 100.0
4gie_A290 Prostaglandin F synthase; structural genomics, nia 100.0
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 100.0
1qwk_A 317 Aldose reductase, aldo-keto reductase family 1 mem 100.0
1us0_A 316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 100.0
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 100.0
3h7r_A 331 Aldo-keto reductase; stress response, NADP, drough 100.0
3krb_A 334 Aldose reductase; ssgcid, SBRI, emerald biostructu 100.0
3b3d_A314 YTBE protein, putative morphine dehydrogenase; ald 100.0
2bgs_A 344 Aldose reductase; holoenzyme, aldo/keto reductase, 100.0
4gac_A 324 Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe 100.0
3cf4_A 807 Acetyl-COA decarboxylase/synthase alpha subunit; m 97.61
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 94.54
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 94.51
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 93.76
2o56_A407 Putative mandelate racemase; dehydratase, structur 93.44
2qgy_A391 Enolase from the environmental genome shotgun sequ 92.97
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 92.93
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 92.85
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 92.58
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzy 92.55
2gl5_A410 Putative dehydratase protein; structural genomics, 92.55
3tj4_A372 Mandelate racemase; enolase, dehydratase, enzyme f 91.98
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 91.81
2oz8_A389 MLL7089 protein; structural genomics, unknown func 91.71
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 91.66
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 91.24
1tzz_A392 Hypothetical protein L1841; structural genomics, m 90.81
2poz_A392 Putative dehydratase; octamer, structural genomics 90.72
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 90.66
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 90.65
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSG 90.63
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D-ery 90.44
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 90.22
2qde_A397 Mandelate racemase/muconate lactonizing enzyme FA 90.02
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- li 89.93
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 89.57
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 89.5
1r0m_A375 N-acylamino acid racemase; isomerase; 1.30A {Deino 89.5
2zc8_A369 N-acylamino acid racemase; octamer, TIM beta/alpha 89.41
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 88.98
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: 88.83
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 88.61
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 88.57
3eez_A378 Putative mandelate racemase/muconate lactonizing e 87.72
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 87.54
3rr1_A 405 GALD, putative D-galactonate dehydratase; enolase, 87.4
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; en 87.16
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 87.12
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 86.95
3q45_A368 Mandelate racemase/muconate lactonizing enzyme FA 86.55
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 86.47
1ydn_A 295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 86.37
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 86.29
2ps2_A371 Putative mandelate racemase/muconate lactonizing e 85.97
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 85.11
3ddm_A392 Putative mandelate racemase/muconate lactonizing e 84.38
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 84.26
4dwd_A393 Mandelate racemase/muconate lactonizing enzyme, C 83.73
3p3b_A392 Mandelate racemase/muconate lactonizing protein; e 83.57
3ik4_A365 Mandelate racemase/muconate lactonizing protein; s 83.47
1kko_A413 3-methylaspartate ammonia-lyase; enolase superfami 82.35
4dye_A398 Isomerase; enolase family protein, EFI, enzym func 81.97
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 81.86
4h83_A388 Mandelate racemase/muconate lactonizing enzyme; st 81.17
3fv9_G386 Mandelate racemase/muconate lactonizing enzyme; st 81.14
3my9_A377 Muconate cycloisomerase; structural genomics, PSI- 80.68
4a35_A441 Mitochondrial enolase superfamily member 1; isomer 80.64
2ftp_A 302 Hydroxymethylglutaryl-COA lyase; structural genomi 80.3
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Back     alignment and structure
Probab=100.00  E-value=1.5e-53  Score=359.94  Aligned_cols=202  Identities=71%  Similarity=1.185  Sum_probs=181.2

Q ss_pred             CCeeecCCCCcccccceeccccCCCCCCCCCCHHHHHHHHHHHHHcCCCeEeCCCCcCC-CcHHHHHHHHHhcCCCCcEE
Q 028240            9 VPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGP-YTNEILLGKALKELPRENIQ   87 (211)
Q Consensus         9 ~~~~~lg~~g~~vs~lg~G~~~~~~~~~~~~~~~~~~~~l~~A~~~Gi~~~DtA~~Yg~-g~~E~~lG~~l~~~~r~~~~   87 (211)
                      |+|++||++|++||+||||||++|+.|+...+++++.++|++|++.||||||||+.||. |.+|+.+|++|++.+|++++
T Consensus         1 M~~~~lg~tg~~vs~lglGt~~~g~~~~~~~~~~~~~~~l~~Al~~Gi~~~DTA~~Yg~~G~sE~~lG~al~~~~R~~~~   80 (337)
T 3v0s_A            1 MPRVKLGTQGLEVSKLGFGCMGLSGDYNDALPEEQGIAVIKEAFNCGITFFDTSDIYGENGSNEELLGKALKQLPREXIQ   80 (337)
T ss_dssp             CCEEECSSSSCEEESSCEECGGGC-------CHHHHHHHHHHHHHTTCCEEECCTTSSSTTHHHHHHHHHHTTSCGGGCE
T ss_pred             CCeeecCCCCceecCeeecccccCCCCCCCCCHHHHHHHHHHHHHcCCCEEEChhhhCCCCcHHHHHHHHHhhcCCcceE
Confidence            78999999999999999999999987776678899999999999999999999999997 68999999999976799999


Q ss_pred             EEeccccccCCCcccccCCChHHHHHHHHHHHhhcCCCceeEEEeecCCCCCCHHHHHHHHHHHHHcCcccEEEeCCCCH
Q 028240           88 VATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASP  167 (211)
Q Consensus        88 i~tK~~~~~~~~~~~~~~~s~~~i~~~~~~sL~~Lg~~~iDl~~lh~~~~~~~~~~~~~~l~~l~~~G~ir~iGvs~~~~  167 (211)
                      |+||++......+....+.+++.+++++++||++||+||||+|++|||++..+++++|++|++|+++||||+||||||++
T Consensus        81 i~TK~~~~~~~~~~~~~~~~~~~i~~~~~~SL~rLg~dyiDl~~lH~p~~~~~~~e~~~al~~l~~~Gkir~iGvSn~~~  160 (337)
T 3v0s_A           81 VGTKFGIHEIGFSGVKAXGTPDYVRSCCEASLKRLDVDYIDLFYIHRIDTTVPIEITMGELXXLVEEGKIXYVGLSEASP  160 (337)
T ss_dssp             EEEEECEEEEETTEEEECCCHHHHHHHHHHHHHHHTCSCEEEEEESSCCTTSCHHHHHHHHHHHHHTTSEEEEEEESCCH
T ss_pred             EEeeeccccCCCCcccCCCCHHHHHHHHHHHHHHhCCCCeeEEEecCCCCCCCHHHHHHHHHHHHHCCCeeEEeccCCCH
Confidence            99999865322222334668999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhccCCceEEeccCCccccCchhhHHHHHHHcCCeeee
Q 028240          168 DTIRRAHAVHPITAVQLEWSLWARDIENEIVPLCRFVRLAVKS  210 (211)
Q Consensus       168 ~~l~~~~~~~~~~~~q~~~~~~~~~~~~~~~~~~~~~gi~v~a  210 (211)
                      ++++++++..+++++|++||++++..+.+++++|+++||+|+|
T Consensus       161 ~~l~~~~~~~~~~~~Q~~~~~~~~~~e~~l~~~~~~~gi~v~a  203 (337)
T 3v0s_A          161 DTIRRAHAVHPVTALQIEYSLWTRDIEDEIVPLCRQLGIGIVP  203 (337)
T ss_dssp             HHHHHHHHHSCCCEEEEECBTTBCGGGTTHHHHHHHHTCEEEE
T ss_pred             HHHHHHhccCCceEEEeeccccccchhHHHHHHHHHcCceEEE
Confidence            9999999999999999999999998777899999999999987
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 Back     alignment and structure
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Back     alignment and structure
>4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Back     alignment and structure
>3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Back     alignment and structure
>4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* Back     alignment and structure
>3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>3p3b_A Mandelate racemase/muconate lactonizing protein; enolase superfamily fold, galacturonate dehydratase, D-tartr galacturonate, lyase; HET: TAR; 1.65A {Geobacillus SP} PDB: 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>3ik4_A Mandelate racemase/muconate lactonizing protein; structural genomics, enolase, epimerase, PSI-2, protein STRU initiative; 2.10A {Herpetosiphon aurantiacus atcc 23779} Back     alignment and structure
>1kko_A 3-methylaspartate ammonia-lyase; enolase superfamily, TIM barrel; 1.33A {Citrobacter amalonaticus} SCOP: c.1.11.2 d.54.1.1 PDB: 1kkr_A* Back     alignment and structure
>4dye_A Isomerase; enolase family protein, EFI, enzym function initiative; 1.60A {Streptomyces coelicolor} PDB: 2oqh_A Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>4h83_A Mandelate racemase/muconate lactonizing enzyme; structural genomics, enzyme function initiative; 2.09A {Marine actinobacterium PHSC20C1} PDB: 3no1_A 3msy_A Back     alignment and structure
>3fv9_G Mandelate racemase/muconate lactonizing enzyme; structural genomics, mandelate racemase/muconatelactonizing hydrolase, PSI-2; 1.90A {Roseovarius nubinhibens ism} PDB: 2pce_A Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Back     alignment and structure
>4a35_A Mitochondrial enolase superfamily member 1; isomerase; 1.74A {Homo sapiens} Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 211
d1pyfa_ 311 c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu 3e-42
d1lqaa_ 346 c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 6e-39
d1pz1a_ 333 c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu 2e-34
d3eaua1 326 c.1.7.1 (A:36-361) Voltage-dependent K+ channel be 3e-34
d1mi3a_ 319 c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu 7e-30
d1s1pa_ 315 c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak 1e-29
d1us0a_ 314 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 2e-29
d1afsa_ 319 c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase 1e-28
d1hqta_ 324 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 3e-28
d1qwka_ 312 c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod 4e-28
d1vp5a_284 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 4e-28
d1ur3m_298 c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc 2e-25
d1mzra_274 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 3e-24
d1frba_ 315 c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce 2e-23
d1gvea_ 324 c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) 6e-22
d1hw6a_262 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 3e-20
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Putative oxidoreductase IolS
species: Bacillus subtilis [TaxId: 1423]

 Score =  142 bits (358), Expect = 3e-42
 Identities = 61/193 (31%), Positives = 107/193 (55%), Gaps = 2/193 (1%)

Query: 11  RVKLGTQGLEVSKLGYGCMSLSGCYNSP-LSEEDGISIIKHAFSKGITFFDTADKYGPYT 69
           + KLG   L+V  +G G  ++ G    P L+EE G  +++ A   G+T  DTA  YG   
Sbjct: 2   KAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGIGR 61

Query: 70  NEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDL 129
           +E L+G+ L+E  RE++ +ATK    + G   V    +P++++   + SL+RL+ +YIDL
Sbjct: 62  SEELIGEVLREFNREDVVIATKAAHRKQGNDFVFDN-SPDFLKKSVDESLKRLNTDYIDL 120

Query: 130 YYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEWSLW 189
           +Y H  D   P +E +  + ++ + GKI+ IG+S  S + ++ A+    +  +Q E++L 
Sbjct: 121 FYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLEQLKEANKDGLVDVLQGEYNLL 180

Query: 190 ARDIENEIVPLCR 202
            R+ E    P  +
Sbjct: 181 NREAEKTFFPYTK 193
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query211
d1pyfa_ 311 Putative oxidoreductase IolS {Bacillus subtilis [T 100.0
d1pz1a_ 333 Putative oxidoreductase YhdN {Bacillus subtilis [T 100.0
d1ur3m_298 Hypothetical oxidoreductase YdhF {Escherichia coli 100.0
d1gvea_ 324 Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus 100.0
d1lqaa_ 346 Tas protein {Escherichia coli [TaxId: 562]} 100.0
d3eaua1 326 Voltage-dependent K+ channel beta subunit {Rat (Ra 100.0
d1hw6a_262 2,5-diketo-D-gluconic acid reductase A {Corynebact 100.0
d1qwka_ 312 Hypothetical protein C07D8.6 {Nematode (Caenorhabd 100.0
d1s1pa_ 315 Prostaglandin d2 11-ketoreductase (akr1c3) {Human 100.0
d1vp5a_284 2,5-diketo-D-gluconic acid reductase A {Thermotoga 100.0
d1afsa_ 319 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus 100.0
d1us0a_ 314 Aldose reductase (aldehyde reductase) {Human (Homo 100.0
d1mzra_274 2,5-diketo-D-gluconic acid reductase A {Escherichi 100.0
d1mi3a_ 319 Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 100.0
d1hqta_ 324 Aldose reductase (aldehyde reductase) {Pig (Sus sc 100.0
d1frba_ 315 FR-1 (fibroblast growth factor-induced) protein {M 100.0
d1yeya1252 RTS beta protein {Xanthomonas campestris pv. campe 91.1
d1kcza1253 beta-Methylaspartase {Clostridium tetanomorphum [T 90.72
d1kkoa1251 beta-Methylaspartase {Citrobacter amalonaticus [Ta 89.31
d1jdfa1 309 D-glucarate dehydratase {Escherichia coli [TaxId: 88.31
d1r0ma1243 N-acylamino acid racemase {Deinococcus radiodurans 87.98
d1wufa1244 N-acylamino acid racemase {Listeria innocua [TaxId 87.61
d1sjda1242 N-acylamino acid racemase {Amycolatopsis sp. [TaxI 87.59
d1jpma1234 L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 86.22
d2chra1244 Chlormuconate cycloisomerase {Alcaligenes eutrophu 84.49
d2gl5a1278 Putative dehydratase protein STM2273 {Salmonella t 84.45
d1wuea1241 N-acylamino acid racemase {Enterococcus faecalis [ 83.44
d1nu5a1243 Chlormuconate cycloisomerase {Pseudomonas sp. p51 82.72
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Putative oxidoreductase IolS
species: Bacillus subtilis [TaxId: 1423]

Probab=100.00  E-value=5.6e-48  Score=319.98  Aligned_cols=200  Identities=30%  Similarity=0.545  Sum_probs=184.9

Q ss_pred             CeeecCCCCcccccceeccccCCCCC-CCCCCHHHHHHHHHHHHHcCCCeEeCCCCcCCCcHHHHHHHHHhcCCCCcEEE
Q 028240           10 PRVKLGTQGLEVSKLGYGCMSLSGCY-NSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTNEILLGKALKELPRENIQV   88 (211)
Q Consensus        10 ~~~~lg~~g~~vs~lg~G~~~~~~~~-~~~~~~~~~~~~l~~A~~~Gi~~~DtA~~Yg~g~~E~~lG~~l~~~~r~~~~i   88 (211)
                      ++++||+||++||+||||||++|+.+ +...+++++.++|++|++.|||+||||+.||+|.+|+.+|++++..+|++++|
T Consensus         1 ~~~rLG~tgl~vS~iglGt~~~g~~~~~~~~~~~~a~~~l~~A~~~Gin~~DTA~~Yg~g~sE~~lg~~l~~~~r~~~~i   80 (311)
T d1pyfa_           1 KKAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGIGRSEELIGEVLREFNREDVVI   80 (311)
T ss_dssp             CCEECTTSCCEECSBCEECTTSSCTTTCSSCCHHHHHHHHHHHHHTTCCEEECCTTTTTTHHHHHHHHHHTTSCGGGCEE
T ss_pred             CCcccCCCCCeecceeeeCcccCCCCCCCCCCHHHHHHHHHHHHHcCCCEEEehhhcCCCccHHHHhhhhhcccccceec
Confidence            57999999999999999999998642 34578999999999999999999999999999999999999999988999999


Q ss_pred             EeccccccCCCcccccCCChHHHHHHHHHHHhhcCCCceeEEEeecCCCCCCHHHHHHHHHHHHHcCcccEEEeCCCCHH
Q 028240           89 ATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPD  168 (211)
Q Consensus        89 ~tK~~~~~~~~~~~~~~~s~~~i~~~~~~sL~~Lg~~~iDl~~lh~~~~~~~~~~~~~~l~~l~~~G~ir~iGvs~~~~~  168 (211)
                      +||++...... ....+.+++.+++++++||++|+++|+|++++|+|++..+.++++++|++|+++|+||+||+||++++
T Consensus        81 ~tK~~~~~~~~-~~~~~~~~~~i~~s~~~SL~rl~~d~iDl~~lh~~~~~~~~~~~~~~l~~l~~~Gkir~iGvs~~~~~  159 (311)
T d1pyfa_          81 ATKAAHRKQGN-DFVFDNSPDFLKKSVDESLKRLNTDYIDLFYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLE  159 (311)
T ss_dssp             EEEECEEEETT-EEEECCCHHHHHHHHHHHHHHHTSSCBSEEEECSCCSSSCHHHHHHHHHHHHHTTSBSCEEEESCCHH
T ss_pred             ceeccCCCCCc-ccccccchHHHHHHHHhhHHhhCCcHHhhhcccCCCcccchhhHHHHHHHHHhCCeEEeecccCCcHH
Confidence            99998654332 23456789999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhccCCceEEeccCCccccCchhhHHHHHHHcCCeeee
Q 028240          169 TIRRAHAVHPITAVQLEWSLWARDIENEIVPLCRFVRLAVKS  210 (211)
Q Consensus       169 ~l~~~~~~~~~~~~q~~~~~~~~~~~~~~~~~~~~~gi~v~a  210 (211)
                      .+.++....+++++|++||++++....+++++|+++||+|++
T Consensus       160 ~~~~~~~~~~~~~~q~~~n~~~~~~~~~~~~~~~~~~i~v~~  201 (311)
T d1pyfa_         160 QLKEANKDGLVDVLQGEYNLLNREAEKTFFPYTKEHNISFIP  201 (311)
T ss_dssp             HHHHHTTTSCCCEEEEECBTTBCGGGTTHHHHHHHHTCEEEE
T ss_pred             HHHHHhhcCCcceEeeeecccchhhhHHHHHHHHHCCceEEE
Confidence            999999999999999999999998888899999999999987
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d1kcza1 c.1.11.2 (A:161-413) beta-Methylaspartase {Clostridium tetanomorphum [TaxId: 1553]} Back     information, alignment and structure
>d1kkoa1 c.1.11.2 (A:161-411) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]} Back     information, alignment and structure
>d1jdfa1 c.1.11.2 (A:138-446) D-glucarate dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0ma1 c.1.11.2 (A:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d1sjda1 c.1.11.2 (A:126-367) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} Back     information, alignment and structure
>d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d2gl5a1 c.1.11.2 (A:123-400) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wuea1 c.1.11.2 (A:1127-1367) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nu5a1 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} Back     information, alignment and structure