Citrus Sinensis ID: 028302


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210
MEGMARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKTMRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGVKIIATKRSWASHSQVSCQSSGMLGPLSDGETHH
cccccccccccccEEEEEccccccHHHHHHHHHcccccEEEcccccccHHHHcccccEEEEEcccccHHHHHcccccEEEEEcccccccccHHHHHHcccEEEccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccccccEEEEEcccHHHHHHHHHHcccccEEEEEccccccccccEEEccccccccccEEEcc
ccccccccccccEEEEEEccccHHHHHHHHHHHccccEEEEccccHHHHHHHHccccEEEEccccccHHHHHHccccEEEEEcccccccccHHHHHcccEEEEEcccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHccccccEEEccccccEEEEEcccHHHHHHHHHHHHcccEEEEEcccccHHHHHHHccHHHHHHHccEEEEc
megmarssdknitrvlfcgphfpashnytkeylqnypsiqvdvvpisdvpdVIANYHLCVVKTMRLDSNCISRANQMKLIMQFGvglegvdinaatrcgikvaripgdvtgnaaSCAELTIYLMLGLLRKQNEMRMAIEQKklgvptgetllgKTVFILGFGNIGVELAKRLRPFGVKIiatkrswashsqvscqssgmlgplsdgethh
megmarssdkniTRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKTMRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYLMLGLLRKQNEMRMAIEQKklgvptgetlLGKTVFILGFGNIGVELAKRLRPFGVKIIAtkrswashsqvscqssgmlgplsdgethh
MEGMARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPsiqvdvvpisdvpdviANYHLCVVKTMRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGVKIIATKRSWASHSQVSCQSSGMLGPLSDGETHH
***********ITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKTMRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGVKIIATKRSWA***********************
**************VLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKTMRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGVKIIATKRSWASHSQVSCQSSGMLGPLSDGETHH
*********KNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKTMRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGVKIIATK***************************
*****RSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKTMRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGVKIIATKRSWASHSQVSCQSSGMLGPLSDGETHH
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGMARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKTMRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGVKIIATKRSWASHSQVSCQSSGMLGPLSDGETHH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query210 2.2.26 [Sep-21-2011]
O29445 527 D-3-phosphoglycerate dehy yes no 0.6 0.239 0.366 4e-13
A1RYE4 339 Glyoxylate reductase OS=T yes no 0.595 0.368 0.357 1e-12
A5GFY8 533 D-3-phosphoglycerate dehy yes no 0.557 0.219 0.367 2e-11
A5A6P1 533 D-3-phosphoglycerate dehy yes no 0.590 0.232 0.345 2e-11
O43175 533 D-3-phosphoglycerate dehy yes no 0.590 0.232 0.345 2e-11
P35136 525 D-3-phosphoglycerate dehy yes no 0.666 0.266 0.278 2e-11
Q60HD7 533 D-3-phosphoglycerate dehy N/A no 0.590 0.232 0.338 3e-11
Q5EAD2 533 D-3-phosphoglycerate dehy yes no 0.590 0.232 0.345 4e-11
O08651 533 D-3-phosphoglycerate dehy yes no 0.604 0.238 0.323 6e-11
Q61753 533 D-3-phosphoglycerate dehy yes no 0.604 0.238 0.330 6e-11
>sp|O29445|SERA_ARCFU D-3-phosphoglycerate dehydrogenase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=serA PE=3 SV=1 Back     alignment and function desciption
 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 77/142 (54%), Gaps = 16/142 (11%)

Query: 46  ISDVPDVIANYHLCVVKTM-RLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVAR 104
           I +VP     Y   VV++  ++D+  I  A  +K+I + GVG++ +DINAAT+ GI V  
Sbjct: 36  IREVP----KYEAIVVRSQTKVDAEVIQAAKNLKIIGRAGVGVDNIDINAATQRGIVVVN 91

Query: 105 IPGDVTGNAASCAELTIYLMLGLLRKQNEMRMAI-----EQKKLGVPTGETLLGKTVFIL 159
            PG   GN  S AE  I LML   RK  +   ++     E+KK     G  L GKT  ++
Sbjct: 92  APG---GNTISTAEHAIALMLAAARKIPQADRSVKEGKWERKKF---MGIELRGKTAGVI 145

Query: 160 GFGNIGVELAKRLRPFGVKIIA 181
           G G +G E+AKR +   + ++A
Sbjct: 146 GLGRVGFEVAKRCKALEMNVLA 167





Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) (taxid: 224325)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 9EC: 5
>sp|A1RYE4|GYAR_THEPD Glyoxylate reductase OS=Thermofilum pendens (strain Hrk 5) GN=gyaR PE=3 SV=1 Back     alignment and function description
>sp|A5GFY8|SERA_PIG D-3-phosphoglycerate dehydrogenase OS=Sus scrofa GN=PHGDH PE=3 SV=1 Back     alignment and function description
>sp|A5A6P1|SERA_PANTR D-3-phosphoglycerate dehydrogenase OS=Pan troglodytes GN=PHGDH PE=2 SV=1 Back     alignment and function description
>sp|O43175|SERA_HUMAN D-3-phosphoglycerate dehydrogenase OS=Homo sapiens GN=PHGDH PE=1 SV=4 Back     alignment and function description
>sp|P35136|SERA_BACSU D-3-phosphoglycerate dehydrogenase OS=Bacillus subtilis (strain 168) GN=serA PE=3 SV=3 Back     alignment and function description
>sp|Q60HD7|SERA_MACFA D-3-phosphoglycerate dehydrogenase OS=Macaca fascicularis GN=PHGDH PE=2 SV=4 Back     alignment and function description
>sp|Q5EAD2|SERA_BOVIN D-3-phosphoglycerate dehydrogenase OS=Bos taurus GN=PHGDH PE=2 SV=3 Back     alignment and function description
>sp|O08651|SERA_RAT D-3-phosphoglycerate dehydrogenase OS=Rattus norvegicus GN=Phgdh PE=1 SV=3 Back     alignment and function description
>sp|Q61753|SERA_MOUSE D-3-phosphoglycerate dehydrogenase OS=Mus musculus GN=Phgdh PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query210
224136053 343 predicted protein [Populus trichocarpa] 0.938 0.574 0.776 4e-87
118488445 343 unknown [Populus trichocarpa] 0.938 0.574 0.776 4e-87
255561522 380 phosphoglycerate dehydrogenase, putative 0.957 0.528 0.733 9e-84
363807464 391 uncharacterized protein LOC100785085 [Gl 0.914 0.491 0.723 4e-79
359493304 333 PREDICTED: d-3-phosphoglycerate dehydrog 0.890 0.561 0.737 2e-78
225460279 373 PREDICTED: d-3-phosphoglycerate dehydrog 0.961 0.541 0.712 6e-78
296089431 343 unnamed protein product [Vitis vinifera] 0.947 0.580 0.718 2e-77
357455585 382 D-3-phosphoglycerate dehydrogenase [Medi 0.895 0.492 0.702 1e-76
449503247 337 PREDICTED: d-3-phosphoglycerate dehydrog 0.904 0.563 0.715 1e-76
388510518 344 unknown [Medicago truncatula] 0.895 0.546 0.702 2e-76
>gi|224136053|ref|XP_002327369.1| predicted protein [Populus trichocarpa] gi|222835739|gb|EEE74174.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  326 bits (835), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 153/197 (77%), Positives = 176/197 (89%)

Query: 4   MARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKT 63
           M  +SDK+ITRVLFCGP+FPASH YTKEYLQ YP IQVD VP++ VPDVI+NY++C+VK 
Sbjct: 1   MVGNSDKHITRVLFCGPYFPASHQYTKEYLQKYPFIQVDDVPLAVVPDVISNYNICIVKN 60

Query: 64  MRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYL 123
           MRL SN ISRA QMKLIMQFGVG+EGVDI+AAT+ GIKVARIPGD TGNAASCAE+ IYL
Sbjct: 61  MRLTSNIISRATQMKLIMQFGVGIEGVDIDAATKYGIKVARIPGDATGNAASCAEMAIYL 120

Query: 124 MLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGVKIIATK 183
           MLGLLRKQNEM+++I+QK+LG P GETL GKTVFI+GFGNIG++LAKRLRPFGVKIIATK
Sbjct: 121 MLGLLRKQNEMQISIKQKRLGEPAGETLFGKTVFIMGFGNIGIDLAKRLRPFGVKIIATK 180

Query: 184 RSWASHSQVSCQSSGML 200
           RSWA HS+ S QS+G L
Sbjct: 181 RSWALHSEGSLQSNGFL 197




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|118488445|gb|ABK96037.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255561522|ref|XP_002521771.1| phosphoglycerate dehydrogenase, putative [Ricinus communis] gi|223538984|gb|EEF40581.1| phosphoglycerate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|363807464|ref|NP_001242647.1| uncharacterized protein LOC100785085 [Glycine max] gi|255645066|gb|ACU23032.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|359493304|ref|XP_003634565.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225460279|ref|XP_002282092.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296089431|emb|CBI39250.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357455585|ref|XP_003598073.1| D-3-phosphoglycerate dehydrogenase [Medicago truncatula] gi|355487121|gb|AES68324.1| D-3-phosphoglycerate dehydrogenase [Medicago truncatula] Back     alignment and taxonomy information
>gi|449503247|ref|XP_004161907.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388510518|gb|AFK43325.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query210
TAIR|locus:2207046 373 AT1G72190 [Arabidopsis thalian 0.885 0.498 0.623 3.4e-61
TIGR_CMR|CHY_2698 525 CHY_2698 "D-3-phosphoglycerate 0.580 0.232 0.359 1.1e-12
UNIPROTKB|Q0BWN7 328 gyaR "Glyoxylate reductase" [H 0.542 0.347 0.357 1.6e-12
UNIPROTKB|E1C7Y3 525 PHGDH "Uncharacterized protein 0.571 0.228 0.344 1.8e-12
ZFIN|ZDB-GENE-030131-647 528 phgdh "phosphoglycerate dehydr 0.585 0.232 0.341 3.9e-12
UNIPROTKB|Q5SZU1 499 PHGDH "D-3-phosphoglycerate de 0.557 0.234 0.359 7.3e-12
UNIPROTKB|O43175 533 PHGDH "D-3-phosphoglycerate de 0.557 0.219 0.359 8.3e-12
UNIPROTKB|A5GFY8 533 PHGDH "D-3-phosphoglycerate de 0.557 0.219 0.367 8.3e-12
MGI|MGI:1355330 533 Phgdh "3-phosphoglycerate dehy 0.571 0.225 0.344 1.1e-11
RGD|61987 533 Phgdh "phosphoglycerate dehydr 0.571 0.225 0.336 1.1e-11
TAIR|locus:2207046 AT1G72190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 626 (225.4 bits), Expect = 3.4e-61, P = 3.4e-61
 Identities = 116/186 (62%), Positives = 147/186 (79%)

Query:     1 MEGMARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPXXXXXXXXXXXXXXXXANYHLCV 60
             +E +    D ++TRVLFCGPHFP S+N+T+EYLQ YP                 NYH+CV
Sbjct:    40 IERIVEKEDMHVTRVLFCGPHFPDSYNFTREYLQPYPFIKVDVVHYRDVPEVIKNYHICV 99

Query:    61 VKTMRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELT 120
               TM++DSN ISRA+ +KLIMQ+GVGL+GVDI+AAT+ GIKVARIP + TGNAASC+E+ 
Sbjct:   100 AMTMQMDSNVISRASNIKLIMQYGVGLDGVDIDAATKHGIKVARIPSEGTGNAASCSEMA 159

Query:   121 IYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGVKII 180
             IYLMLGLL+KQNEM++++  + LG PTG+TLLGKTVFILG+GNIG+ELAKRL+PFG ++I
Sbjct:   160 IYLMLGLLKKQNEMQISLRNRLLGEPTGDTLLGKTVFILGYGNIGIELAKRLKPFGSRVI 219

Query:   181 ATKRSW 186
             ATKR W
Sbjct:   220 ATKRFW 225




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=ISS
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0048037 "cofactor binding" evidence=IEA
GO:0051287 "NAD binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TIGR_CMR|CHY_2698 CHY_2698 "D-3-phosphoglycerate dehydrogenase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|Q0BWN7 gyaR "Glyoxylate reductase" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
UNIPROTKB|E1C7Y3 PHGDH "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-647 phgdh "phosphoglycerate dehydrogenase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5SZU1 PHGDH "D-3-phosphoglycerate dehydrogenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O43175 PHGDH "D-3-phosphoglycerate dehydrogenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A5GFY8 PHGDH "D-3-phosphoglycerate dehydrogenase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1355330 Phgdh "3-phosphoglycerate dehydrogenase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|61987 Phgdh "phosphoglycerate dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query210
PLN02928 347 PLN02928, PLN02928, oxidoreductase family protein 1e-122
cd12175 311 cd12175, 2-Hacid_dh_11, Putative D-isomer specific 7e-60
cd12172 306 cd12172, PGDH_like_2, Putative D-3-Phosphoglycerat 3e-29
cd12173 304 cd12173, PGDH_4, Phosphoglycerate dehydrogenases, 7e-25
COG0111 324 COG0111, SerA, Phosphoglycerate dehydrogenase and 7e-25
COG1052 324 COG1052, LdhA, Lactate dehydrogenase and related d 2e-24
cd05198 302 cd05198, formate_dh_like, Formate/glycerate and re 3e-24
cd05303 301 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (P 2e-23
pfam00389 312 pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxy 7e-23
PRK13581 526 PRK13581, PRK13581, D-3-phosphoglycerate dehydroge 7e-22
cd12178 317 cd12178, 2-Hacid_dh_13, Putative D-isomer specific 1e-21
TIGR01327 525 TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenas 9e-21
cd05301 309 cd05301, GDH, D-glycerate dehydrogenase/hydroxypyr 2e-20
cd12171 310 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 6e-20
cd12177 321 cd12177, 2-Hacid_dh_12, Putative D-isomer specific 1e-19
cd12179 306 cd12179, 2-Hacid_dh_14, Putative D-isomer specific 1e-18
cd12165 314 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 2e-18
cd12156 301 cd12156, HPPR, Hydroxy(phenyl)pyruvate Reductase, 6e-18
cd12168 321 cd12168, Mand_dh_like, D-Mandelate Dehydrogenase-l 2e-17
cd05299 312 cd05299, CtBP_dh, C-terminal binding protein (CtBP 2e-16
PRK13243 333 PRK13243, PRK13243, glyoxylate reductase; Reviewed 6e-16
cd12169 308 cd12169, PGDH_like_1, Putative D-3-Phosphoglycerat 8e-16
cd12174 305 cd12174, PGDH_like_3, Putative D-3-Phosphoglycerat 1e-15
cd01619 323 cd01619, LDH_like, D-Lactate and related Dehydroge 1e-15
cd05300 313 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 1e-15
cd12157 318 cd12157, PTDH, Thermostable Phosphite Dehydrogenas 2e-14
cd12161 315 cd12161, GDH_like_1, Putative glycerate dehydrogen 1e-13
pfam02826175 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydro 4e-13
cd05302 348 cd05302, FDH, NAD-dependent Formate Dehydrogenase 6e-13
cd12159 303 cd12159, 2-Hacid_dh_2, Putative D-isomer specific 2e-12
cd12162 307 cd12162, 2-Hacid_dh_4, Putative D-isomer specific 2e-12
PRK07574 385 PRK07574, PRK07574, formate dehydrogenase; Provisi 6e-12
cd12187 329 cd12187, LDH_like_1, D-Lactate and related Dehydro 1e-11
cd12185 322 cd12185, HGDH_LDH_like, Putative Lactate dehydroge 1e-10
cd12183 328 cd12183, LDH_like_2, D-Lactate and related Dehydro 5e-10
cd12155 314 cd12155, PGDH_1, Phosphoglycerate Dehydrogenase, 2 8e-10
cd12166 300 cd12166, 2-Hacid_dh_7, Putative D-isomer specific 1e-09
PRK06487 317 PRK06487, PRK06487, glycerate dehydrogenase; Provi 1e-09
cd12167 330 cd12167, 2-Hacid_dh_8, Putative D-isomer specific 2e-09
PLN03139 386 PLN03139, PLN03139, formate dehydrogenase; Provisi 1e-08
cd12176 304 cd12176, PGDH_3, Phosphoglycerate dehydrogenases, 4e-08
cd12186 329 cd12186, LDH, D-Lactate dehydrogenase and D-2-Hydr 7e-08
cd12154310 cd12154, FDH_GDH_like, Formate/glycerate dehydroge 2e-07
cd12184 330 cd12184, HGDH_like, (R)-2-Hydroxyglutarate Dehydro 8e-07
cd12158 343 cd12158, ErythrP_dh, D-Erythronate-4-Phosphate Deh 5e-06
PLN02306 386 PLN02306, PLN02306, hydroxypyruvate reductase 1e-05
cd12180 308 cd12180, 2-Hacid_dh_15, Putative D-isomer specific 1e-05
PRK08410 311 PRK08410, PRK08410, 2-hydroxyacid dehydrogenase; P 3e-05
PRK06436 303 PRK06436, PRK06436, glycerate dehydrogenase; Provi 8e-05
cd12160 310 cd12160, 2-Hacid_dh_3, Putative D-isomer specific 9e-05
PRK08605 332 PRK08605, PRK08605, D-lactate dehydrogenase; Valid 3e-04
PRK06932 314 PRK06932, PRK06932, glycerate dehydrogenase; Provi 0.001
cd12163 334 cd12163, 2-Hacid_dh_5, Putative D-isomer specific 0.002
>gnl|CDD|215501 PLN02928, PLN02928, oxidoreductase family protein Back     alignment and domain information
 Score =  348 bits (896), Expect = e-122
 Identities = 131/195 (67%), Positives = 160/195 (82%)

Query: 1   MEGMARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCV 60
           ++     SD   TRVLFCGP FPAS++YT+EYLQ YP IQVD V   DVPDVIANY +CV
Sbjct: 7   IDKRVHHSDMRPTRVLFCGPEFPASYSYTREYLQKYPFIQVDAVAREDVPDVIANYDICV 66

Query: 61  VKTMRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELT 120
            K MRLD++ I+RA+QMKLIMQFGVGLEGVD++AAT+ GIKVARIP + TGNAASCAE+ 
Sbjct: 67  PKMMRLDADIIARASQMKLIMQFGVGLEGVDVDAATKHGIKVARIPSEGTGNAASCAEMA 126

Query: 121 IYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGVKII 180
           IYLMLGLLRKQNEM+++++ ++LG P G+TL GKTVFILG+G IG+ELAKRLRPFGVK++
Sbjct: 127 IYLMLGLLRKQNEMQISLKARRLGEPIGDTLFGKTVFILGYGAIGIELAKRLRPFGVKLL 186

Query: 181 ATKRSWASHSQVSCQ 195
           AT+RSW S  +    
Sbjct: 187 ATRRSWTSEPEDGLL 201


Length = 347

>gnl|CDD|240652 cd12175, 2-Hacid_dh_11, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240649 cd12172, PGDH_like_2, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240650 cd12173, PGDH_4, Phosphoglycerate dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|223189 COG0111, SerA, Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223980 COG1052, LdhA, Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|240622 cd05198, formate_dh_like, Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxy acid dehydrogenase family Back     alignment and domain information
>gnl|CDD|240628 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (PGDH) NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|215893 pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain Back     alignment and domain information
>gnl|CDD|237436 PRK13581, PRK13581, D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240655 cd12178, 2-Hacid_dh_13, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|233358 TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>gnl|CDD|240626 cd05301, GDH, D-glycerate dehydrogenase/hydroxypyruvate reductase (GDH) Back     alignment and domain information
>gnl|CDD|240648 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240654 cd12177, 2-Hacid_dh_12, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240656 cd12179, 2-Hacid_dh_14, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240642 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240633 cd12156, HPPR, Hydroxy(phenyl)pyruvate Reductase, D-isomer-specific 2-hydroxyacid-related dehydrogenase Back     alignment and domain information
>gnl|CDD|240645 cd12168, Mand_dh_like, D-Mandelate Dehydrogenase-like dehydrogenases Back     alignment and domain information
>gnl|CDD|240624 cd05299, CtBP_dh, C-terminal binding protein (CtBP), D-isomer-specific 2-hydroxyacid dehydrogenases related repressor Back     alignment and domain information
>gnl|CDD|183914 PRK13243, PRK13243, glyoxylate reductase; Reviewed Back     alignment and domain information
>gnl|CDD|240646 cd12169, PGDH_like_1, Putative D-3-Phosphoglycerate Dehydrogenases Back     alignment and domain information
>gnl|CDD|240651 cd12174, PGDH_like_3, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240620 cd01619, LDH_like, D-Lactate and related Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240625 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 2-hydroxyacid dehydrogenase Back     alignment and domain information
>gnl|CDD|240634 cd12157, PTDH, Thermostable Phosphite Dehydrogenase Back     alignment and domain information
>gnl|CDD|240638 cd12161, GDH_like_1, Putative glycerate dehydrogenase and related proteins of the D-specific 2-hydroxy dehydrogenase family Back     alignment and domain information
>gnl|CDD|217244 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|240627 cd05302, FDH, NAD-dependent Formate Dehydrogenase (FDH) Back     alignment and domain information
>gnl|CDD|240636 cd12159, 2-Hacid_dh_2, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240639 cd12162, 2-Hacid_dh_4, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|181041 PRK07574, PRK07574, formate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240663 cd12187, LDH_like_1, D-Lactate and related Dehydrogenase like proteins, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240661 cd12185, HGDH_LDH_like, Putative Lactate dehydrogenase and (R)-2-Hydroxyglutarate Dehydrogenase-like proteins, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240659 cd12183, LDH_like_2, D-Lactate and related Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240632 cd12155, PGDH_1, Phosphoglycerate Dehydrogenase, 2-hydroxyacid dehydrogenase family Back     alignment and domain information
>gnl|CDD|240643 cd12166, 2-Hacid_dh_7, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|180588 PRK06487, PRK06487, glycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240644 cd12167, 2-Hacid_dh_8, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|178684 PLN03139, PLN03139, formate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240653 cd12176, PGDH_3, Phosphoglycerate dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240662 cd12186, LDH, D-Lactate dehydrogenase and D-2-Hydroxyisocaproic acid dehydrogenase (D-HicDH), NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240631 cd12154, FDH_GDH_like, Formate/glycerate dehydrogenases, D-specific 2-hydroxy acid dehydrogenases and related dehydrogenases Back     alignment and domain information
>gnl|CDD|240660 cd12184, HGDH_like, (R)-2-Hydroxyglutarate Dehydrogenase and related dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240635 cd12158, ErythrP_dh, D-Erythronate-4-Phosphate Dehydrogenase NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|177941 PLN02306, PLN02306, hydroxypyruvate reductase Back     alignment and domain information
>gnl|CDD|240657 cd12180, 2-Hacid_dh_15, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|181414 PRK08410, PRK08410, 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235800 PRK06436, PRK06436, glycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240637 cd12160, 2-Hacid_dh_3, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|181499 PRK08605, PRK08605, D-lactate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235890 PRK06932, PRK06932, glycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240640 cd12163, 2-Hacid_dh_5, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 210
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 100.0
PLN02928 347 oxidoreductase family protein 100.0
COG0111 324 SerA Phosphoglycerate dehydrogenase and related de 100.0
PRK06487 317 glycerate dehydrogenase; Provisional 100.0
COG1052 324 LdhA Lactate dehydrogenase and related dehydrogena 100.0
PRK06932 314 glycerate dehydrogenase; Provisional 100.0
PRK15409 323 bifunctional glyoxylate/hydroxypyruvate reductase 100.0
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 100.0
PRK13243 333 glyoxylate reductase; Reviewed 100.0
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 100.0
PRK07574 385 formate dehydrogenase; Provisional 100.0
PLN03139 386 formate dehydrogenase; Provisional 100.0
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 100.0
PLN02306 386 hydroxypyruvate reductase 100.0
PRK12480 330 D-lactate dehydrogenase; Provisional 100.0
KOG0068 406 consensus D-3-phosphoglycerate dehydrogenase, D-is 100.0
PRK08605 332 D-lactate dehydrogenase; Validated 100.0
PRK15469 312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 100.0
PRK06436 303 glycerate dehydrogenase; Provisional 100.0
PRK15438 378 erythronate-4-phosphate dehydrogenase PdxB; Provis 100.0
PRK00257 381 erythronate-4-phosphate dehydrogenase; Validated 100.0
KOG0069 336 consensus Glyoxylate/hydroxypyruvate reductase (D- 99.97
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 99.86
PF00389133 2-Hacid_dh: D-isomer specific 2-hydroxyacid dehydr 99.71
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 99.68
KOG0067 435 consensus Transcription factor CtBP [Transcription 99.68
PRK08306296 dipicolinate synthase subunit A; Reviewed 99.36
PTZ00075 476 Adenosylhomocysteinase; Provisional 99.24
PRK13403 335 ketol-acid reductoisomerase; Provisional 98.95
PRK05476 425 S-adenosyl-L-homocysteine hydrolase; Provisional 98.26
PRK05479 330 ketol-acid reductoisomerase; Provisional 98.17
PLN02494 477 adenosylhomocysteinase 98.14
cd01075 200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 98.04
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 97.94
TIGR00936 406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 97.93
TIGR00465 314 ilvC ketol-acid reductoisomerase. This is the seco 97.89
cd00401 413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 97.79
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 97.78
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.7
PRK05225 487 ketol-acid reductoisomerase; Validated 97.69
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 97.45
PLN02712 667 arogenate dehydrogenase 97.44
cd01076 227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 97.36
TIGR00518 370 alaDH alanine dehydrogenase. The family of known L 97.3
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 97.24
PLN02256 304 arogenate dehydrogenase 97.21
cd05313 254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 97.2
cd05211 217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 97.08
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 97.06
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 96.95
PRK09414 445 glutamate dehydrogenase; Provisional 96.92
PRK08818 370 prephenate dehydrogenase; Provisional 96.91
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 96.85
PLN02712 667 arogenate dehydrogenase 96.8
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 96.78
PRK14031 444 glutamate dehydrogenase; Provisional 96.77
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 96.75
PLN02477 410 glutamate dehydrogenase 96.72
PLN02545 295 3-hydroxybutyryl-CoA dehydrogenase 96.71
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.7
KOG0023 360 consensus Alcohol dehydrogenase, class V [Secondar 96.69
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.68
COG0499 420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 96.62
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 96.61
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.56
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.55
KOG0409 327 consensus Predicted dehydrogenase [General functio 96.52
TIGR02356 202 adenyl_thiF thiazole biosynthesis adenylyltransfer 96.52
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 96.52
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.5
PRK14030 445 glutamate dehydrogenase; Provisional 96.49
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 96.49
PLN02858 1378 fructose-bisphosphate aldolase 96.48
COG0059 338 IlvC Ketol-acid reductoisomerase [Amino acid trans 96.39
COG0287 279 TyrA Prephenate dehydrogenase [Amino acid transpor 96.36
PRK05690 245 molybdopterin biosynthesis protein MoeB; Provision 96.34
TIGR01035 417 hemA glutamyl-tRNA reductase. This enzyme, togethe 96.34
cd00757 228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 96.29
PLN02272 421 glyceraldehyde-3-phosphate dehydrogenase 96.24
cd01492 197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 96.22
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 96.22
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.21
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 96.07
PLN02858 1378 fructose-bisphosphate aldolase 96.04
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.03
PRK06719157 precorrin-2 dehydrogenase; Validated 96.0
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 95.99
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.97
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.95
PRK00045 423 hemA glutamyl-tRNA reductase; Reviewed 95.94
PRK13302 271 putative L-aspartate dehydrogenase; Provisional 95.92
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 95.91
PTZ00079 454 NADP-specific glutamate dehydrogenase; Provisional 95.91
PF00208 244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 95.91
PRK07530 292 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.9
PRK08328 231 hypothetical protein; Provisional 95.88
PRK06718 202 precorrin-2 dehydrogenase; Reviewed 95.87
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 95.86
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 95.85
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.82
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 95.79
PRK07819 286 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.76
PRK05808 282 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.75
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.75
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 95.73
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 95.72
TIGR01470 205 cysG_Nterm siroheme synthase, N-terminal domain. T 95.72
COG1064 339 AdhP Zn-dependent alcohol dehydrogenases [General 95.69
PRK07679 279 pyrroline-5-carboxylate reductase; Reviewed 95.68
cd01078 194 NAD_bind_H4MPT_DH NADP binding domain of methylene 95.66
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 95.66
PF00044151 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, 95.64
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.61
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 95.53
COG0334 411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 95.5
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.46
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 95.42
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.41
PRK01390 460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.41
TIGR02354 200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 95.4
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 95.4
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.37
PTZ00431 260 pyrroline carboxylate reductase; Provisional 95.33
PLN00203 519 glutamyl-tRNA reductase 95.32
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 95.32
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.31
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.3
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.29
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.25
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 95.25
cd05311 226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 95.21
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 95.17
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 95.16
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 95.16
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.15
KOG1370 434 consensus S-adenosylhomocysteine hydrolase [Coenzy 94.99
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 94.98
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 94.93
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 94.92
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 94.85
PRK12549284 shikimate 5-dehydrogenase; Reviewed 94.83
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 94.77
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.76
PRK07411 390 hypothetical protein; Validated 94.75
TIGR02355 240 moeB molybdopterin synthase sulfurylase MoeB. This 94.74
PRK04148134 hypothetical protein; Provisional 94.71
TIGR01921 324 DAP-DH diaminopimelate dehydrogenase. This model r 94.65
PRK01368 454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.63
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 94.63
cd01485 198 E1-1_like Ubiquitin activating enzyme (E1), repeat 94.55
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 94.53
PRK00676 338 hemA glutamyl-tRNA reductase; Validated 94.52
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 94.47
PRK03803 448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.44
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.39
PLN02948 577 phosphoribosylaminoimidazole carboxylase 94.23
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 94.16
cd01483143 E1_enzyme_family Superfamily of activating enzymes 94.15
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.12
PRK12548 289 shikimate 5-dehydrogenase; Provisional 94.11
KOG2380 480 consensus Prephenate dehydrogenase (NADP+) [Amino 94.08
PRK03806 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.05
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 94.03
PF01210 157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 93.96
PRK13940 414 glutamyl-tRNA reductase; Provisional 93.92
PRK06197 306 short chain dehydrogenase; Provisional 93.92
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 93.77
PRK08644 212 thiamine biosynthesis protein ThiF; Provisional 93.75
KOG0022 375 consensus Alcohol dehydrogenase, class III [Second 93.68
PRK08217 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.63
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 93.61
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 93.57
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 93.53
PRK06153 393 hypothetical protein; Provisional 93.5
PRK14982 340 acyl-ACP reductase; Provisional 93.47
COG0027 394 PurT Formate-dependent phosphoribosylglycinamide f 93.44
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.39
PRK12828 239 short chain dehydrogenase; Provisional 93.36
PRK08703 239 short chain dehydrogenase; Provisional 93.34
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 93.3
PRK07523 255 gluconate 5-dehydrogenase; Provisional 93.26
TIGR01381 664 E1_like_apg7 E1-like protein-activating enzyme Gsa 93.25
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 93.22
PTZ00245 287 ubiquitin activating enzyme; Provisional 93.11
PRK09496 453 trkA potassium transporter peripheral membrane com 93.1
PRK06841 255 short chain dehydrogenase; Provisional 93.01
TIGR03366 280 HpnZ_proposed putative phosphonate catabolism asso 92.97
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 92.92
PRK05786 238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.89
PRK06523 260 short chain dehydrogenase; Provisional 92.83
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 92.8
PRK06398 258 aldose dehydrogenase; Validated 92.73
PRK07231 251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.66
COG0373 414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 92.66
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 92.62
cd00755 231 YgdL_like Family of activating enzymes (E1) of ubi 92.57
PTZ00117 319 malate dehydrogenase; Provisional 92.57
TIGR01832 248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 92.54
PRK07634 245 pyrroline-5-carboxylate reductase; Reviewed 92.53
cd05312 279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 92.49
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 92.43
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 92.38
PRK06057 255 short chain dehydrogenase; Provisional 92.34
PRK08223 287 hypothetical protein; Validated 92.28
PRK06949 258 short chain dehydrogenase; Provisional 92.26
PRK15116 268 sulfur acceptor protein CsdL; Provisional 92.25
COG1249 454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 92.25
PLN02780 320 ketoreductase/ oxidoreductase 92.15
PRK12826 251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 92.1
PRK08264 238 short chain dehydrogenase; Validated 92.1
PRK05717 255 oxidoreductase; Validated 92.02
cd08230 355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 91.99
PRK07576 264 short chain dehydrogenase; Provisional 91.92
PRK08993 253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 91.88
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.88
PTZ00082 321 L-lactate dehydrogenase; Provisional 91.86
PRK07890 258 short chain dehydrogenase; Provisional 91.79
PRK08265 261 short chain dehydrogenase; Provisional 91.77
COG0540316 PyrB Aspartate carbamoyltransferase, catalytic cha 91.76
PRK06172 253 short chain dehydrogenase; Provisional 91.73
PRK08862 227 short chain dehydrogenase; Provisional 91.69
PRK09880 343 L-idonate 5-dehydrogenase; Provisional 91.66
PRK07060 245 short chain dehydrogenase; Provisional 91.65
TIGR03325 262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 91.65
PRK06550 235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 91.64
PRK09186 256 flagellin modification protein A; Provisional 91.64
PLN00141 251 Tic62-NAD(P)-related group II protein; Provisional 91.63
TIGR01202 308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 91.6
PRK08339 263 short chain dehydrogenase; Provisional 91.58
PRK07831 262 short chain dehydrogenase; Provisional 91.54
TIGR03201 349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 91.53
PRK08945 247 putative oxoacyl-(acyl carrier protein) reductase; 91.49
PRK08628 258 short chain dehydrogenase; Provisional 91.48
PRK07806 248 short chain dehydrogenase; Provisional 91.44
COG1648 210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 91.44
PRK05562 223 precorrin-2 dehydrogenase; Provisional 91.42
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 91.42
PRK06125 259 short chain dehydrogenase; Provisional 91.42
TIGR02822 329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 91.39
PLN02740 381 Alcohol dehydrogenase-like 91.34
cd01491 286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 91.28
PRK06114 254 short chain dehydrogenase; Provisional 91.26
PRK07062 265 short chain dehydrogenase; Provisional 91.18
PRK08085 254 gluconate 5-dehydrogenase; Provisional 91.15
PRK07856 252 short chain dehydrogenase; Provisional 91.14
PLN02358 338 glyceraldehyde-3-phosphate dehydrogenase 91.14
PRK06138 252 short chain dehydrogenase; Provisional 91.11
PRK07326 237 short chain dehydrogenase; Provisional 91.08
PRK06505 271 enoyl-(acyl carrier protein) reductase; Provisiona 91.08
PRK06079 252 enoyl-(acyl carrier protein) reductase; Provisiona 91.05
TIGR02818 368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 91.05
PLN02586 360 probable cinnamyl alcohol dehydrogenase 91.04
PRK06124 256 gluconate 5-dehydrogenase; Provisional 91.03
PF03949 255 Malic_M: Malic enzyme, NAD binding domain; InterPr 91.01
PRK05867 253 short chain dehydrogenase; Provisional 91.01
PRK12429 258 3-hydroxybutyrate dehydrogenase; Provisional 91.01
TIGR03736 244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 91.01
PRK09072 263 short chain dehydrogenase; Provisional 91.0
PRK07774 250 short chain dehydrogenase; Provisional 90.99
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 90.99
cd00762 254 NAD_bind_malic_enz NAD(P) binding domain of malic 90.97
PRK06935 258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 90.97
cd08239 339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 90.89
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 90.87
PTZ00434 361 cytosolic glyceraldehyde 3-phosphate dehydrogenase 90.86
cd08301 369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 90.85
PRK12829 264 short chain dehydrogenase; Provisional 90.85
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 90.81
PRK07533 258 enoyl-(acyl carrier protein) reductase; Provisiona 90.8
PRK12859 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 90.79
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.79
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 90.77
PRK12748 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 90.77
PRK07814 263 short chain dehydrogenase; Provisional 90.75
PRK08594 257 enoyl-(acyl carrier protein) reductase; Provisiona 90.72
PRK06500 249 short chain dehydrogenase; Provisional 90.7
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 90.58
PLN02178 375 cinnamyl-alcohol dehydrogenase 90.58
PRK08213 259 gluconate 5-dehydrogenase; Provisional 90.57
PRK07825 273 short chain dehydrogenase; Provisional 90.56
PRK12862 763 malic enzyme; Reviewed 90.55
PRK08415 274 enoyl-(acyl carrier protein) reductase; Provisiona 90.55
PRK03562 621 glutathione-regulated potassium-efflux system prot 90.52
PLN02253 280 xanthoxin dehydrogenase 90.51
PRK06198 260 short chain dehydrogenase; Provisional 90.49
PRK14851 679 hypothetical protein; Provisional 90.49
PRK05653 246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.49
PRK08278 273 short chain dehydrogenase; Provisional 90.49
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 90.48
TIGR03206 250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 90.47
PRK12823 260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 90.47
PRK06200 263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 90.44
PRK05876 275 short chain dehydrogenase; Provisional 90.43
PRK05866 293 short chain dehydrogenase; Provisional 90.42
COG0281 432 SfcA Malic enzyme [Energy production and conversio 90.4
PRK12939 250 short chain dehydrogenase; Provisional 90.39
PRK12861 764 malic enzyme; Reviewed 90.36
cd01493 425 APPBP1_RUB Ubiquitin activating enzyme (E1) subuni 90.34
PRK12481 251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 90.32
PRK07889 256 enoyl-(acyl carrier protein) reductase; Provisiona 90.27
PRK14852 989 hypothetical protein; Provisional 90.25
PRK06171 266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 90.24
PRK06141 314 ornithine cyclodeaminase; Validated 90.23
PRK06194 287 hypothetical protein; Provisional 90.23
PRK09288 395 purT phosphoribosylglycinamide formyltransferase 2 90.21
PRK08589 272 short chain dehydrogenase; Validated 90.21
TIGR03451 358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 90.17
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 90.16
PLN03096 395 glyceraldehyde-3-phosphate dehydrogenase A; Provis 90.15
PRK08289 477 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 90.11
PRK07478 254 short chain dehydrogenase; Provisional 90.11
PRK09242 257 tropinone reductase; Provisional 90.09
PRK07035 252 short chain dehydrogenase; Provisional 90.09
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 90.08
cd08300 368 alcohol_DH_class_III class III alcohol dehydrogena 90.07
COG1250 307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 90.06
PRK07063 260 short chain dehydrogenase; Provisional 90.03
PRK06603 260 enoyl-(acyl carrier protein) reductase; Provisiona 90.03
PRK11730 715 fadB multifunctional fatty acid oxidation complex 89.97
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 89.97
cd08245 330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 89.93
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 89.93
PRK12367 245 short chain dehydrogenase; Provisional 89.89
PRK12749 288 quinate/shikimate dehydrogenase; Reviewed 89.85
PRK05565 247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 89.84
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 89.82
PRK07577 234 short chain dehydrogenase; Provisional 89.78
PRK05875 276 short chain dehydrogenase; Provisional 89.77
PRK08277 278 D-mannonate oxidoreductase; Provisional 89.77
PRK13529 563 malate dehydrogenase; Provisional 89.76
PLN02240 352 UDP-glucose 4-epimerase 89.74
cd08277 365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 89.73
PRK06196 315 oxidoreductase; Provisional 89.73
PRK14027283 quinate/shikimate dehydrogenase; Provisional 89.7
PRK07067 257 sorbitol dehydrogenase; Provisional 89.7
PLN02896 353 cinnamyl-alcohol dehydrogenase 89.66
PRK12742 237 oxidoreductase; Provisional 89.65
PRK07984 262 enoyl-(acyl carrier protein) reductase; Provisiona 89.56
PRK05872 296 short chain dehydrogenase; Provisional 89.52
PRK08226 263 short chain dehydrogenase; Provisional 89.51
cd08281 371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 89.49
PRK05993 277 short chain dehydrogenase; Provisional 89.49
cd08242 319 MDR_like Medium chain dehydrogenases/reductase (MD 89.46
cd08296 333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 89.43
PLN03154 348 putative allyl alcohol dehydrogenase; Provisional 89.42
PRK08690 261 enoyl-(acyl carrier protein) reductase; Provisiona 89.4
PRK03659 601 glutathione-regulated potassium-efflux system prot 89.36
PRK08416 260 7-alpha-hydroxysteroid dehydrogenase; Provisional 89.33
PRK04663 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.27
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 89.24
PRK13394 262 3-hydroxybutyrate dehydrogenase; Provisional 89.23
PRK08159 272 enoyl-(acyl carrier protein) reductase; Provisiona 89.2
PLN02237 442 glyceraldehyde-3-phosphate dehydrogenase B 89.19
PRK10669558 putative cation:proton antiport protein; Provision 89.18
PRK06720169 hypothetical protein; Provisional 89.1
PRK06997 260 enoyl-(acyl carrier protein) reductase; Provisiona 89.08
PRK05854 313 short chain dehydrogenase; Provisional 89.04
PRK08303 305 short chain dehydrogenase; Provisional 88.99
cd08295 338 double_bond_reductase_like Arabidopsis alkenal dou 88.97
cd05283 337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 88.92
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 88.82
cd08255 277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 88.78
PRK06139 330 short chain dehydrogenase; Provisional 88.77
PRK08936 261 glucose-1-dehydrogenase; Provisional 88.76
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 88.72
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 88.71
PRK12439 341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 88.67
KOG1687168 consensus NADH-ubiquinone oxidoreductase, NUFS7/PS 88.65
PTZ00325 321 malate dehydrogenase; Provisional 88.64
PRK06182 273 short chain dehydrogenase; Validated 88.48
cd05293 312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 88.45
PLN02653 340 GDP-mannose 4,6-dehydratase 88.43
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 88.38
PRK07097 265 gluconate 5-dehydrogenase; Provisional 88.32
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 88.31
PRK09135 249 pteridine reductase; Provisional 88.3
PLN02514 357 cinnamyl-alcohol dehydrogenase 88.29
PRK07985 294 oxidoreductase; Provisional 88.29
PLN02695 370 GDP-D-mannose-3',5'-epimerase 88.28
PRK07370 258 enoyl-(acyl carrier protein) reductase; Validated 88.23
COG5322 351 Predicted dehydrogenase [General function predicti 88.23
PRK08324 681 short chain dehydrogenase; Validated 88.17
PRK14573 809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 88.14
PRK07666 239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 88.14
PRK06113 255 7-alpha-hydroxysteroid dehydrogenase; Validated 88.14
cd08269 312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 88.09
TIGR01316 449 gltA glutamate synthase (NADPH), homotetrameric. T 88.05
cd08231 361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 88.03
PRK06180 277 short chain dehydrogenase; Provisional 88.01
PRK07251 438 pyridine nucleotide-disulfide oxidoreductase; Prov 87.98
PRK06914 280 short chain dehydrogenase; Provisional 87.98
PRK06701 290 short chain dehydrogenase; Provisional 87.93
cd08234 334 threonine_DH_like L-threonine dehydrogenase. L-thr 87.89
COG1063 350 Tdh Threonine dehydrogenase and related Zn-depende 87.85
PRK07904 253 short chain dehydrogenase; Provisional 87.7
PLN03209 576 translocon at the inner envelope of chloroplast su 87.69
PRK07877 722 hypothetical protein; Provisional 87.68
PRK10637 457 cysG siroheme synthase; Provisional 87.66
PRK07424 406 bifunctional sterol desaturase/short chain dehydro 87.59
PRK04523 335 N-acetylornithine carbamoyltransferase; Reviewed 87.59
PRK08220 252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 87.58
KOG2304 298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 87.56
PRK10309 347 galactitol-1-phosphate dehydrogenase; Provisional 87.54
PRK06179 270 short chain dehydrogenase; Provisional 87.52
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 87.48
TIGR02825 325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 87.47
KOG0024 354 consensus Sorbitol dehydrogenase [Secondary metabo 87.41
PRK08642 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 87.3
PRK12831 464 putative oxidoreductase; Provisional 87.25
PRK12936 245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 87.18
PLN02827 378 Alcohol dehydrogenase-like 87.15
PRK12827 249 short chain dehydrogenase; Provisional 87.12
PRK07454 241 short chain dehydrogenase; Provisional 87.11
cd08289 326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 86.95
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 86.94
cd08288 324 MDR_yhdh Yhdh putative quinone oxidoreductases. Yh 86.93
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 86.91
PRK06463 255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 86.88
TIGR03316 357 ygeW probable carbamoyltransferase YgeW. Members o 86.88
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 86.87
cd08260 345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 86.85
PRK07340 304 ornithine cyclodeaminase; Validated 86.84
PRK07453 322 protochlorophyllide oxidoreductase; Validated 86.78
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 86.73
PRK12744 257 short chain dehydrogenase; Provisional 86.68
PRK12935 247 acetoacetyl-CoA reductase; Provisional 86.67
TIGR02632 676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 86.67
PRK07109 334 short chain dehydrogenase; Provisional 86.65
PLN02214 342 cinnamoyl-CoA reductase 86.63
cd08293 345 PTGR2 Prostaglandin reductase. Prostaglandins and 86.63
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 86.61
PLN03129 581 NADP-dependent malic enzyme; Provisional 86.6
PRK06327 475 dihydrolipoamide dehydrogenase; Validated 86.54
PLN02730 303 enoyl-[acyl-carrier-protein] reductase 86.53
PRK12810 471 gltD glutamate synthase subunit beta; Reviewed 86.49
PLN02427 386 UDP-apiose/xylose synthase 86.48
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 86.45
cd08237 341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 86.4
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 86.38
PRK05557 248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 86.33
PRK12831 464 putative oxidoreductase; Provisional 86.32
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 86.24
PLN00106 323 malate dehydrogenase 86.2
cd08294 329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 86.18
PRK12814 652 putative NADPH-dependent glutamate synthase small 86.04
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 85.95
cd08233 351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 85.95
PRK06128 300 oxidoreductase; Provisional 85.87
PLN02602 350 lactate dehydrogenase 85.83
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 85.8
TIGR01316 449 gltA glutamate synthase (NADPH), homotetrameric. T 85.76
PLN02572 442 UDP-sulfoquinovose synthase 85.61
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 85.6
PRK09754 396 phenylpropionate dioxygenase ferredoxin reductase 85.6
PRK07791 286 short chain dehydrogenase; Provisional 85.51
PRK05249 461 soluble pyridine nucleotide transhydrogenase; Prov 85.49
PRK13512 438 coenzyme A disulfide reductase; Provisional 85.45
PRK14804311 ornithine carbamoyltransferase; Provisional 85.42
cd08299 373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 85.4
PTZ00317 559 NADP-dependent malic enzyme; Provisional 85.37
cd08282 375 PFDH_like Pseudomonas putida aldehyde-dismutating 85.36
COG0493 457 GltD NADPH-dependent glutamate synthase beta chain 85.32
PRK12938 246 acetyacetyl-CoA reductase; Provisional 85.23
PRK01713 334 ornithine carbamoyltransferase; Provisional 84.99
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 84.95
TIGR01283456 nifE nitrogenase molybdenum-iron cofactor biosynth 84.94
PRK12937 245 short chain dehydrogenase; Provisional 84.9
PRK06370 463 mercuric reductase; Validated 84.86
PTZ00058 561 glutathione reductase; Provisional 84.84
cd08274 350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 84.83
PF00185158 OTCace: Aspartate/ornithine carbamoyltransferase, 84.82
KOG1209 289 consensus 1-Acyl dihydroxyacetone phosphate reduct 84.81
PRK06116 450 glutathione reductase; Validated 84.8
PRK06292 460 dihydrolipoamide dehydrogenase; Validated 84.7
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 84.67
PRK06416 462 dihydrolipoamide dehydrogenase; Reviewed 84.61
PLN02206 442 UDP-glucuronate decarboxylase 84.56
KOG1201 300 consensus Hydroxysteroid 17-beta dehydrogenase 11 84.55
COG0362 473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 84.55
PRK08063 250 enoyl-(acyl carrier protein) reductase; Provisiona 84.52
PRK15182425 Vi polysaccharide biosynthesis protein TviB; Provi 84.47
PRK05579 399 bifunctional phosphopantothenoylcysteine decarboxy 84.43
PRK07846 451 mycothione reductase; Reviewed 84.39
PRK06300 299 enoyl-(acyl carrier protein) reductase; Provisiona 84.37
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.31
cd08264 325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 84.31
KOG0029 501 consensus Amine oxidase [Secondary metabolites bio 84.22
cd08285 351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 84.18
PRK12747 252 short chain dehydrogenase; Provisional 84.14
TIGR01421 450 gluta_reduc_1 glutathione-disulfide reductase, ani 84.08
PRK07201 657 short chain dehydrogenase; Provisional 84.07
PLN02583 297 cinnamoyl-CoA reductase 84.03
PRK12550272 shikimate 5-dehydrogenase; Reviewed 84.02
COG0460 333 ThrA Homoserine dehydrogenase [Amino acid transpor 83.99
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 83.94
cd08284 344 FDH_like_2 Glutathione-dependent formaldehyde dehy 83.91
PRK08618 325 ornithine cyclodeaminase; Validated 83.85
PRK13984 604 putative oxidoreductase; Provisional 83.8
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 83.79
PRK09134 258 short chain dehydrogenase; Provisional 83.75
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.5e-41  Score=287.99  Aligned_cols=161  Identities=24%  Similarity=0.352  Sum_probs=148.0

Q ss_pred             CCChhhhcCCceEEEEcCCCCCHHHHhcCCCceEEEEccccCCccchhHHhhCCcEEEecCCCCCCCchhHHHHHHHHHH
Q 028302           46 ISDVPDVIANYHLCVVKTMRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYLML  125 (210)
Q Consensus        46 ~~~~~~~~~~adv~i~~~~~~~~~~l~~~p~Lk~i~~~~aG~d~id~~~~~~~gi~v~~~~~~~~~~a~~vAE~~l~~~L  125 (210)
                      .+++.+.++++|+++.+..+++++.++.+|+||||++.++|+|++|+++++++||.|+|+||+   ++.+||||+++++|
T Consensus        33 ~~~~~~~~~~~d~ii~~~~~~~~~~l~~~~~Lk~I~~~~~G~d~id~~~~~~~gI~v~n~~g~---~~~~VAE~a~~l~L  109 (311)
T PRK08410         33 PEEVIERIKDANIIITNKVVIDKEVLSQLPNLKLICITATGTNNVDIEYAKKKGIAVKNVAGY---STESVAQHTFAMLL  109 (311)
T ss_pred             HHHHHHHhCCCCEEEECCCCCCHHHHhhCCCCeEEEEcccccccccHHHHHhCCCEEEcCCCC---CChHHHHHHHHHHH
Confidence            456678889999998876789999999999999999999999999999999999999999999   88999999999999


Q ss_pred             HHHhhHHHHHHHHHhCCCCCC--------cccccccCeEEEEecChHHHHHHHHhccCCCEEEEEcCCCCC---------
Q 028302          126 GLLRKQNEMRMAIEQKKLGVP--------TGETLLGKTVFILGFGNIGVELAKRLRPFGVKIIATKRSWAS---------  188 (210)
Q Consensus       126 ~~~R~~~~~~~~~~~~~w~~~--------~~~~l~~~tvGIiG~G~IG~~vA~~~~~fg~~V~~~~~~~~~---------  188 (210)
                      +++|++..+++.++++.|...        .+++|+||||||||+|+||+++|+++++|||+|++|||+.+.         
T Consensus       110 ~~~R~~~~~~~~~~~g~w~~~~~~~~~~~~~~~L~gktvGIiG~G~IG~~vA~~~~~fgm~V~~~d~~~~~~~~~~~~~~  189 (311)
T PRK08410        110 SLLGRINYYDRYVKSGEYSESPIFTHISRPLGEIKGKKWGIIGLGTIGKRVAKIAQAFGAKVVYYSTSGKNKNEEYERVS  189 (311)
T ss_pred             HHHhCHHHHHHHHHcCCCCcCCCccccCccccccCCCEEEEECCCHHHHHHHHHHhhcCCEEEEECCCccccccCceeec
Confidence            999999999999999999742        146899999999999999999999999999999999997532         


Q ss_pred             --CCcccCceeEEecCCCCCCCCC
Q 028302          189 --HSQVSCQSSGMLGPLSDGETHH  210 (210)
Q Consensus       189 --~~~~~~~~~~~~~Plt~~~T~h  210 (210)
                        +++.++|.+++.||+|+ +|+|
T Consensus       190 l~ell~~sDvv~lh~Plt~-~T~~  212 (311)
T PRK08410        190 LEELLKTSDIISIHAPLNE-KTKN  212 (311)
T ss_pred             HHHHhhcCCEEEEeCCCCc-hhhc
Confidence              15789999999999999 9997



>PLN02928 oxidoreductase family protein Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PF00389 2-Hacid_dh: D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain; InterPro: IPR006139 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>KOG0067 consensus Transcription factor CtBP [Transcription] Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PTZ00245 ubiquitin activating enzyme; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0540 PyrB Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02358 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02237 glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG1687 consensus NADH-ubiquinone oxidoreductase, NUFS7/PSST/20 kDa subunit [Energy production and conversion] Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK04523 N-acetylornithine carbamoyltransferase; Reviewed Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR03316 ygeW probable carbamoyltransferase YgeW Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK14804 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>PTZ00317 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK01713 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>TIGR01283 nifE nitrogenase molybdenum-iron cofactor biosynthesis protein NifE Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query210
2g76_A 335 Crystal Structure Of Human 3-Phosphoglycerate Dehyd 4e-12
2d0i_A 333 Crystal Structure Ph0520 Protein From Pyrococcus Ho 7e-12
2ekl_A 313 Structure Of St1218 Protein From Sulfolobus Tokodai 8e-11
1gdh_A 320 Crystal Structure Of A Nad-Dependent D-Glycerate De 3e-08
3ddn_A 528 Crystal Structure Of Hydroxypyruvic Acid Phosphate 1e-07
1ygy_A 529 Crystal Structure Of D-3-Phosphoglycerate Dehydroge 1e-07
4dgs_A 340 The Crystals Structure Of Dehydrogenase From Rhizob 7e-07
2ome_A 336 Crystal Structure Of Human Ctbp2 Dehydrogenase Comp 7e-07
2gcg_A 330 Ternary Crystal Structure Of Human Glyoxylate Reduc 8e-07
4g2n_A 345 Crystal Structure Of Putative D-Isomer Specific 2-H 9e-07
2h1s_A 328 Crystal Structure Of A GlyoxylateHYDROXYPYRUVATE RE 1e-06
2fss_A 365 Candida Boidinii Formate Dehydrogenase (Fdh) K47e M 6e-06
2j6i_A 364 Candida Boidinii Formate Dehydrogenase (Fdh) C-Term 6e-06
1hl3_A 358 CtbpBARS IN TERNARY COMPLEX WITH NAD(H) AND PIDLSKK 7e-06
1hku_A 358 CtbpBARS: A DUAL-Function Protein Involved In Trans 7e-06
1mx3_A 347 Crystal Structure Of Ctbp Dehydrogenase Core Holo F 9e-06
1dxy_A 333 Structure Of D-2-Hydroxyisocaproate Dehydrogenase L 1e-05
3ba1_A 333 Structure Of Hydroxyphenylpyruvate Reductase From C 1e-05
1wwk_A 307 Crystal Structure Of Phosphoglycerate Dehydrogenase 1e-05
3ga0_A 358 Ctbp1BARS GLY172->glu Mutant Structure: Impairing N 5e-05
2dbr_A 334 Crystal Structure Of Glyoxylate Reductase (Ph0597) 8e-05
2dbq_A 334 Crystal Structure Of Glyoxylate Reductase (Ph0597) 1e-04
3fn4_A 401 Apo-form Of Nad-dependent Formate Dehydrogenase Fro 3e-04
2gsd_A 402 Nad-dependent Formate Dehydrogenase From Bacterium 3e-04
3kb6_A 334 Crystal Structure Of D-lactate Dehydrogenase From A 3e-04
2go1_A 401 Nad-Dependent Formate Dehydrogenase From Pseudomona 3e-04
2nac_A 393 High Resolution Structures Of Holo And Apo Formate 3e-04
2gug_A 401 Nad-dependent Formate Dehydrogenase From Pseudomona 4e-04
2cuk_A 311 Crystal Structure Of Tt0316 Protein From Thermus Th 7e-04
>pdb|2G76|A Chain A, Crystal Structure Of Human 3-Phosphoglycerate Dehydrogenase Length = 335 Back     alignment and structure

Iteration: 1

Score = 67.8 bits (164), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 46/128 (35%), Positives = 74/128 (57%), Gaps = 11/128 (8%) Query: 58 LCVVKTMRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCA 117 L V ++ ++ I+ A +++++ + G G++ VD+ AATR GI V P GN+ S A Sbjct: 71 LIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTP---NGNSLSAA 127 Query: 118 ELTIYLMLGLLRKQNEMRMAI-----EQKKLGVPTGETLLGKTVFILGFGNIGVELAKRL 172 ELT +++ L R+ + ++ E+KK G L GKT+ ILG G IG E+A R+ Sbjct: 128 ELTCGMIMCLARQIPQATASMKDGKWERKKF---MGTELNGKTLGILGLGRIGREVATRM 184 Query: 173 RPFGVKII 180 + FG+K I Sbjct: 185 QSFGMKTI 192
>pdb|2D0I|A Chain A, Crystal Structure Ph0520 Protein From Pyrococcus Horikoshii Ot3 Length = 333 Back     alignment and structure
>pdb|2EKL|A Chain A, Structure Of St1218 Protein From Sulfolobus Tokodaii Length = 313 Back     alignment and structure
>pdb|1GDH|A Chain A, Crystal Structure Of A Nad-Dependent D-Glycerate Dehydrogenase At 2.4 Angstroms Resolution Length = 320 Back     alignment and structure
>pdb|3DDN|A Chain A, Crystal Structure Of Hydroxypyruvic Acid Phosphate Bound D-3- Phosphoglycerate Dehydrogenase In Mycobacterium Tuberculosis Length = 528 Back     alignment and structure
>pdb|1YGY|A Chain A, Crystal Structure Of D-3-Phosphoglycerate Dehydrogenase From Mycobacterium Tuberculosis Length = 529 Back     alignment and structure
>pdb|4DGS|A Chain A, The Crystals Structure Of Dehydrogenase From Rhizobium Meliloti Length = 340 Back     alignment and structure
>pdb|2OME|A Chain A, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed With Nad(H) Length = 336 Back     alignment and structure
>pdb|2GCG|A Chain A, Ternary Crystal Structure Of Human Glyoxylate ReductaseHYDROXYPYRUVATE REDUCTASE Length = 330 Back     alignment and structure
>pdb|4G2N|A Chain A, Crystal Structure Of Putative D-Isomer Specific 2-Hydroxyacid Dehydrogenase, Nad-Binding From Polaromonas Sp. Js6 66 Length = 345 Back     alignment and structure
>pdb|2H1S|A Chain A, Crystal Structure Of A GlyoxylateHYDROXYPYRUVATE REDUCTASE FROM HOMO Sapiens Length = 328 Back     alignment and structure
>pdb|2FSS|A Chain A, Candida Boidinii Formate Dehydrogenase (Fdh) K47e Mutant Length = 365 Back     alignment and structure
>pdb|2J6I|A Chain A, Candida Boidinii Formate Dehydrogenase (Fdh) C-Terminal Mutant Length = 364 Back     alignment and structure
>pdb|1HL3|A Chain A, CtbpBARS IN TERNARY COMPLEX WITH NAD(H) AND PIDLSKK PEPTIDE Length = 358 Back     alignment and structure
>pdb|1HKU|A Chain A, CtbpBARS: A DUAL-Function Protein Involved In Transcription Corepression And Golgi Membrane Fission Length = 358 Back     alignment and structure
>pdb|1MX3|A Chain A, Crystal Structure Of Ctbp Dehydrogenase Core Holo Form Length = 347 Back     alignment and structure
>pdb|1DXY|A Chain A, Structure Of D-2-Hydroxyisocaproate Dehydrogenase Length = 333 Back     alignment and structure
>pdb|3BA1|A Chain A, Structure Of Hydroxyphenylpyruvate Reductase From Coleus Blu Length = 333 Back     alignment and structure
>pdb|1WWK|A Chain A, Crystal Structure Of Phosphoglycerate Dehydrogenase From Pyrococcus Horikoshii Ot3 Length = 307 Back     alignment and structure
>pdb|3GA0|A Chain A, Ctbp1BARS GLY172->glu Mutant Structure: Impairing Nad(H) Binding And Dimerization Length = 358 Back     alignment and structure
>pdb|2DBR|A Chain A, Crystal Structure Of Glyoxylate Reductase (Ph0597) From Pyrococcus Horikoshii Ot3, Complexed With Nadp (P1) Length = 334 Back     alignment and structure
>pdb|2DBQ|A Chain A, Crystal Structure Of Glyoxylate Reductase (Ph0597) From Pyrococcus Horikoshii Ot3, Complexed With Nadp (I41) Length = 334 Back     alignment and structure
>pdb|3FN4|A Chain A, Apo-form Of Nad-dependent Formate Dehydrogenase From Bacterium Moraxella Sp.c-1 In Closed Conformation Length = 401 Back     alignment and structure
>pdb|2GSD|A Chain A, Nad-dependent Formate Dehydrogenase From Bacterium Moraxella Sp.c2 In Complex With Nad And Azide Length = 402 Back     alignment and structure
>pdb|3KB6|A Chain A, Crystal Structure Of D-lactate Dehydrogenase From Aquifex Aeolicus Complexed With Nad And Lactic Acid Length = 334 Back     alignment and structure
>pdb|2GO1|A Chain A, Nad-Dependent Formate Dehydrogenase From Pseudomonas Sp.101 Length = 401 Back     alignment and structure
>pdb|2NAC|A Chain A, High Resolution Structures Of Holo And Apo Formate Dehydrogenase Length = 393 Back     alignment and structure
>pdb|2GUG|A Chain A, Nad-dependent Formate Dehydrogenase From Pseudomonas Sp.101 In Complex With Formate Length = 401 Back     alignment and structure
>pdb|2CUK|A Chain A, Crystal Structure Of Tt0316 Protein From Thermus Thermophilus Hb8 Length = 311 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query210
2nac_A 393 NAD-dependent formate dehydrogenase; oxidoreductas 2e-27
3jtm_A 351 Formate dehydrogenase, mitochondrial; mitochondrio 3e-27
1qp8_A 303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 3e-26
2pi1_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 3e-26
2g76_A 335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 3e-26
2j6i_A 364 Formate dehydrogenase; oxidoreductase, D-specific- 7e-26
2ekl_A 313 D-3-phosphoglycerate dehydrogenase; structural gen 7e-26
1wwk_A 307 Phosphoglycerate dehydrogenase; riken structural g 1e-25
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 6e-25
2d0i_A 333 Dehydrogenase; structural genomics, NPPSFA, nation 7e-25
3gvx_A 290 Glycerate dehydrogenase related protein; NYSGXRC, 8e-25
1mx3_A 347 CTBP1, C-terminal binding protein 1; nuclear prote 2e-24
2dbq_A 334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 3e-24
3evt_A 324 Phosphoglycerate dehydrogenase; structural genomic 3e-24
2cuk_A 311 Glycerate dehydrogenase/glyoxylate reductase; stru 4e-24
1xdw_A 331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 9e-24
1j4a_A 333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 1e-23
1dxy_A 333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 1e-23
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 3e-23
1gdh_A 320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 7e-23
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 8e-23
4e5n_A 330 Thermostable phosphite dehydrogenase; D-2-hydroxya 9e-23
4dgs_A 340 Dehydrogenase; structural genomics, PSI-biology, N 5e-22
3ba1_A 333 HPPR, hydroxyphenylpyruvate reductase; two domain 6e-21
3gg9_A 352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 8e-21
2w2k_A 348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 9e-21
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 1e-20
4g2n_A 345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 1e-20
2gcg_A 330 Glyoxylate reductase/hydroxypyruvate reductase; NA 1e-20
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 1e-19
3hg7_A 324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 5e-14
3pp8_A 315 Glyoxylate/hydroxypyruvate reductase A; structural 3e-12
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 3e-08
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 9e-06
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 7e-05
1leh_A 364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 3e-04
1c1d_A 355 L-phenylalanine dehydrogenase; amino acid dehydrog 4e-04
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Length = 393 Back     alignment and structure
 Score =  106 bits (267), Expect = 2e-27
 Identities = 36/158 (22%), Positives = 63/158 (39%), Gaps = 15/158 (9%)

Query: 39  IQVDVVPISDVPD-----VIANYHLCVVKTM---RLDSNCISRANQMKLIMQFGVGLEGV 90
             + V    D PD      + +  + + +      L    I++A  +KL +  G+G + V
Sbjct: 68  HTLVVTSDKDGPDSVFERELVDADVVISQPFWPAYLTPERIAKAKNLKLALTAGIGSDHV 127

Query: 91  DINAATRCGIKVARIPGDVTGNAASCAELTIYLMLGLLRKQNEMRMAIEQ----KKLGVP 146
           D+ +A    + VA +      N+ S AE  + ++L L+R          +        V 
Sbjct: 128 DLQSAIDRNVTVAEVTY---CNSISVAEHVVMMILSLVRNYLPSHEWARKGGWNIADCVS 184

Query: 147 TGETLLGKTVFILGFGNIGVELAKRLRPFGVKIIATKR 184
               L    V  +  G IG+ + +RL PF V +  T R
Sbjct: 185 HAYDLEAMHVGTVAAGRIGLAVLRRLAPFDVHLHYTDR 222


>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Length = 351 Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Length = 303 Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Length = 335 Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Length = 364 Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Length = 313 Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Length = 307 Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Length = 529 Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Length = 333 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Length = 290 Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Length = 347 Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Length = 334 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Length = 324 Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Length = 311 Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Length = 331 Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Length = 333 Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Length = 333 Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Length = 404 Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Length = 320 Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Length = 416 Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Length = 330 Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Length = 340 Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Length = 333 Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Length = 352 Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Length = 348 Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Length = 381 Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Length = 345 Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Length = 330 Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Length = 380 Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Length = 324 Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Length = 315 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Length = 293 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Length = 286 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Length = 286 Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Length = 364 Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Length = 355 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query210
3kb6_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 100.0
4g2n_A 345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 100.0
3hg7_A 324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 100.0
2pi1_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 100.0
3evt_A 324 Phosphoglycerate dehydrogenase; structural genomic 100.0
4e5n_A 330 Thermostable phosphite dehydrogenase; D-2-hydroxya 100.0
2yq5_A 343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 100.0
4dgs_A 340 Dehydrogenase; structural genomics, PSI-biology, N 100.0
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 100.0
3pp8_A 315 Glyoxylate/hydroxypyruvate reductase A; structural 100.0
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 100.0
1j4a_A 333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 100.0
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 100.0
1dxy_A 333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 100.0
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 100.0
3jtm_A 351 Formate dehydrogenase, mitochondrial; mitochondrio 100.0
2ekl_A 313 D-3-phosphoglycerate dehydrogenase; structural gen 100.0
1xdw_A 331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 100.0
3gg9_A 352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 100.0
2cuk_A 311 Glycerate dehydrogenase/glyoxylate reductase; stru 100.0
1gdh_A 320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 100.0
4hy3_A 365 Phosphoglycerate oxidoreductase; PSI-biology, stru 100.0
2nac_A 393 NAD-dependent formate dehydrogenase; oxidoreductas 100.0
1mx3_A 347 CTBP1, C-terminal binding protein 1; nuclear prote 100.0
3ba1_A 333 HPPR, hydroxyphenylpyruvate reductase; two domain 100.0
2gcg_A 330 Glyoxylate reductase/hydroxypyruvate reductase; NA 100.0
2w2k_A 348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 100.0
2j6i_A 364 Formate dehydrogenase; oxidoreductase, D-specific- 100.0
2d0i_A 333 Dehydrogenase; structural genomics, NPPSFA, nation 100.0
2dbq_A 334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 100.0
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 100.0
1qp8_A 303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 100.0
3gvx_A 290 Glycerate dehydrogenase related protein; NYSGXRC, 100.0
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 100.0
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 99.97
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 99.9
2rir_A300 Dipicolinate synthase, A chain; structural genomic 99.84
1v8b_A 479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 99.6
3d64_A 494 Adenosylhomocysteinase; structural genomics, ssgci 99.6
2vhw_A 377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 99.44
1x13_A 401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 99.24
1l7d_A 384 Nicotinamide nucleotide transhydrogenase, subunit 99.19
3ce6_A 494 Adenosylhomocysteinase; protein-substrate complex, 99.15
2eez_A 369 Alanine dehydrogenase; TTHA0216, structural genomi 99.02
3h9u_A 436 Adenosylhomocysteinase; NAD CO-factor complex, str 98.93
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 98.73
3n58_A 464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 98.69
1gtm_A 419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 98.64
3gvp_A 435 Adenosylhomocysteinase 3; protein CO-factor comple 98.58
1c1d_A 355 L-phenylalanine dehydrogenase; amino acid dehydrog 98.23
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 98.07
2raf_A 209 Putative dinucleotide-binding oxidoreductase; NP_7 98.0
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 97.98
3dtt_A 245 NADP oxidoreductase; structural genomics, joint ce 97.94
4dio_A 405 NAD(P) transhydrogenase subunit alpha PART 1; stru 97.92
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 97.92
1pjc_A 361 Protein (L-alanine dehydrogenase); oxidoreductase, 97.9
3p2y_A 381 Alanine dehydrogenase/pyridine nucleotide transhy; 97.86
1leh_A 364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 97.82
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 97.8
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 97.74
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 97.72
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 97.63
4ezb_A 317 Uncharacterized conserved protein; structural geno 97.61
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 97.55
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 97.54
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 97.54
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 97.5
3qha_A 296 Putative oxidoreductase; seattle structural genomi 97.48
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 97.41
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 97.38
2yjz_A 201 Metalloreductase steap4; oxidoreductase, metabolic 96.49
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 97.35
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 97.34
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.33
3obb_A 300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 97.33
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 97.23
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.12
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 97.11
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.1
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.06
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.03
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.02
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 97.02
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 96.99
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 96.99
3d1l_A 266 Putative NADP oxidoreductase BF3122; structural ge 96.91
4huj_A 220 Uncharacterized protein; PSI-biology, nysgrc, stru 96.91
2vns_A 215 Metalloreductase steap3; metal-binding, transmembr 96.91
1zej_A 293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 96.86
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 96.86
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 96.84
3h9e_O 346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 96.84
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 96.84
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 96.83
1jw9_B 249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 96.77
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 96.71
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 96.71
2ahr_A 259 Putative pyrroline carboxylate reductase; pyrrolin 96.68
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 96.65
2rcy_A 262 Pyrroline carboxylate reductase; malaria, structur 96.62
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 96.62
1id1_A153 Putative potassium channel protein; RCK domain, E. 96.54
3b1f_A 290 Putative prephenate dehydrogenase; enzyme, 4-hydro 96.54
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 96.52
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 96.48
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 96.45
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 96.45
3tri_A 280 Pyrroline-5-carboxylate reductase; amino acid bios 96.42
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 96.4
1nvt_A 287 Shikimate 5'-dehydrogenase; structural genomics, P 96.4
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 96.39
3aog_A 440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 96.39
1v9l_A 421 Glutamate dehydrogenase; protein-NAD complex, oxid 96.38
3dfu_A 232 Uncharacterized protein from 6-phosphogluconate de 96.34
3p2o_A285 Bifunctional protein fold; structural genomics, ce 96.29
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 96.22
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 96.2
3l07_A285 Bifunctional protein fold; structural genomics, ID 96.18
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 96.18
2yfq_A 421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 96.17
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 96.15
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 96.14
3k92_A 424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 96.12
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 96.11
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 96.11
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 96.11
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 96.1
3aoe_E 419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 96.1
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 96.1
1zud_1 251 Adenylyltransferase THIF; thiamin, thiazole, prote 96.1
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 96.05
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 96.04
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 96.02
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 96.01
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 96.0
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 95.94
2tmg_A 415 Protein (glutamate dehydrogenase); metabolic role, 95.91
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 95.91
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 95.88
4fcc_A 450 Glutamate dehydrogenase; protein complex, rossmann 95.79
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 95.76
3tnl_A 315 Shikimate dehydrogenase; structural genomics, cent 95.73
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 95.73
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 95.69
1kyq_A 274 Met8P, siroheme biosynthesis protein Met8; homodim 95.66
3dfz_A 223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 95.65
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 95.65
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 95.64
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 95.52
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 95.5
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 95.5
3e8x_A 236 Putative NAD-dependent epimerase/dehydratase; stru 95.49
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 95.45
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 95.45
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 95.43
2duw_A145 Putative COA-binding protein; ligand binding prote 95.42
2i99_A 312 MU-crystallin homolog; thyroid hormine binding pro 95.41
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 95.41
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 95.4
3mw9_A 501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 95.31
2qyt_A 317 2-dehydropantoate 2-reductase; APC81190, porphyrom 95.31
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 95.3
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 95.29
3t4e_A 312 Quinate/shikimate dehydrogenase; structural genomi 95.25
2bma_A 470 Glutamate dehydrogenase (NADP+); malaria, drug des 95.2
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 95.13
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 95.13
3two_A 348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 95.09
2cdc_A 366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 95.08
2aef_A 234 Calcium-gated potassium channel MTHK; rossmann fol 95.07
1yqd_A 366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 95.07
1bgv_A 449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 95.03
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 95.02
3h8v_A 292 Ubiquitin-like modifier-activating enzyme 5; rossm 95.0
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 94.91
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 94.89
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 94.86
1piw_A 360 Hypothetical zinc-type alcohol dehydrogenase- like 94.82
3ulk_A 491 Ketol-acid reductoisomerase; branched-chain amino 94.75
3r3j_A 456 Glutamate dehydrogenase; rossman fold, oxidoreduct 94.68
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 94.53
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 94.53
3hwr_A 318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 94.52
4fs3_A 256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 94.49
1lu9_A 287 Methylene tetrahydromethanopterin dehydrogenase; a 94.46
1uuf_A 369 YAHK, zinc-type alcohol dehydrogenase-like protein 94.38
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 94.33
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 94.33
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 94.31
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 94.27
2we8_A 386 Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc 94.25
1pqw_A 198 Polyketide synthase; rossmann fold, dimer, structu 94.23
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 94.22
1y8q_A 346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 94.22
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 94.2
2cf5_A 357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 94.15
1rjw_A 339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 94.15
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 94.13
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 94.12
3e5r_O 337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 94.11
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 94.11
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 94.11
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 94.1
4gcm_A 312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 94.1
1e3i_A 376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 94.04
1e3j_A 352 NADP(H)-dependent ketose reductase; oxidoreductase 94.03
3eag_A 326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 94.01
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 94.0
1pl8_A 356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 94.0
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 93.98
2jhf_A 374 Alcohol dehydrogenase E chain; oxidoreductase, met 93.96
1cdo_A 374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 93.95
3s2e_A 340 Zinc-containing alcohol dehydrogenase superfamily; 93.93
3uog_A 363 Alcohol dehydrogenase; structural genomics, protei 93.92
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 93.91
2d8a_A 348 PH0655, probable L-threonine 3-dehydrogenase; pyro 93.91
3bio_A 304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 93.84
3on5_A 362 BH1974 protein; structural genomics, joint center 93.84
1hdo_A 206 Biliverdin IX beta reductase; foetal metabolism, H 93.79
1p0f_A 373 NADP-dependent alcohol dehydrogenase; ADH topology 93.76
3k5i_A 403 Phosphoribosyl-aminoimidazole carboxylase; purine 93.75
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 93.73
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 93.7
2fzw_A 373 Alcohol dehydrogenase class III CHI chain; S-nitro 93.67
3cps_A 354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 93.6
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 93.58
3goh_A 315 Alcohol dehydrogenase, zinc-containing; NP_718042. 93.57
2dq4_A 343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 93.55
1iz0_A 302 Quinone oxidoreductase; APO-enzyme, riken structur 93.49
2bka_A 242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 93.47
4gsl_A 615 Ubiquitin-like modifier-activating enzyme ATG7; ub 93.47
3dhn_A 227 NAD-dependent epimerase/dehydratase; reductase, PF 93.46
1vl6_A 388 Malate oxidoreductase; TM0542, NAD-dependent malic 93.44
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 93.39
2hcy_A 347 Alcohol dehydrogenase 1; tetramer of asymmetric di 93.38
4a5l_A 314 Thioredoxin reductase; oxidoreductase, redox metab 93.37
2o23_A 265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 93.35
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 93.31
2h6e_A 344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 93.3
2dph_A 398 Formaldehyde dismutase; dismutation of aldehydes, 93.29
1o5i_A 249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 93.28
1v3u_A 333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 93.28
3qy9_A 243 DHPR, dihydrodipicolinate reductase; rossmann fold 93.25
3uko_A 378 Alcohol dehydrogenase class-3; alcohol dehydrogena 93.22
2h7i_A 269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 93.21
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 93.19
1j5p_A 253 Aspartate dehydrogenase; TM1643, structural genomi 93.19
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 93.18
3vh1_A 598 Ubiquitin-like modifier-activating enzyme ATG7; au 93.14
1kol_A 398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 93.12
2d59_A144 Hypothetical protein PH1109; COA binding, structur 93.1
1f06_A 320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 93.07
3ip1_A 404 Alcohol dehydrogenase, zinc-containing; structural 93.06
3d3w_A 244 L-xylulose reductase; uronate cycle, short-chain d 93.02
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 93.02
4b7c_A 336 Probable oxidoreductase; NADP cofactor, rossmann f 93.0
3fpc_A 352 NADP-dependent alcohol dehydrogenase; oxydoreducta 92.99
3hja_A 356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 92.97
1cyd_A 244 Carbonyl reductase; short-chain dehydrogenase, oxi 92.97
3grp_A 266 3-oxoacyl-(acyl carrierprotein) reductase; structu 92.96
3ppi_A 281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 92.95
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 92.95
3f1l_A 252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 92.93
3orf_A 251 Dihydropteridine reductase; alpha-beta-alpha sandw 92.91
3tpc_A 257 Short chain alcohol dehydrogenase-related dehydro; 92.88
1ooe_A 236 Dihydropteridine reductase; structural genomics, P 92.88
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 92.86
3rwb_A 247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 92.83
4eye_A 342 Probable oxidoreductase; structural genomics, niai 92.83
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 92.82
2wsb_A 254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 92.8
3un1_A 260 Probable oxidoreductase; structural genomics, PSI- 92.8
2hjr_A 328 Malate dehydrogenase; malaria, structural genomics 92.78
3qiv_A 253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 92.78
1h2b_A 359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 92.76
2b5w_A 357 Glucose dehydrogenase; nucleotide binding motif, o 92.75
1tlt_A 319 Putative oxidoreductase (virulence factor MVIM HO; 92.75
3gms_A 340 Putative NADPH:quinone reductase; structural genom 92.73
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 92.72
1vj0_A 380 Alcohol dehydrogenase, zinc-containing; TM0436, st 92.71
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 92.69
4ej6_A 370 Putative zinc-binding dehydrogenase; structural ge 92.69
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 92.68
1f8f_A 371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 92.68
1iuk_A140 Hypothetical protein TT1466; structural genomics, 92.67
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 92.64
3awd_A 260 GOX2181, putative polyol dehydrogenase; oxidoreduc 92.63
3nv9_A 487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 92.63
4h15_A 261 Short chain alcohol dehydrogenase-related dehydro; 92.62
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 92.62
2j3h_A 345 NADP-dependent oxidoreductase P1; double bond redu 92.62
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 92.61
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 92.58
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 92.57
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 92.57
3m6i_A 363 L-arabinitol 4-dehydrogenase; medium chain dehydro 92.57
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 92.54
1dhr_A 241 Dihydropteridine reductase; oxidoreductase(acting 92.53
1xg5_A 279 ARPG836; short chain dehydrogenase, human, SGC, st 92.52
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 92.52
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 92.5
3oig_A 266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 92.48
2fwm_X 250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 92.45
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 92.45
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 92.44
3fbg_A 346 Putative arginate lyase; structural genomics, unkn 92.44
2q2v_A 255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 92.44
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 92.43
2c07_A 285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 92.43
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 92.42
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 92.41
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 92.36
1yb1_A 272 17-beta-hydroxysteroid dehydrogenase type XI; shor 92.33
2d1y_A 256 Hypothetical protein TT0321; strucrtural genomics, 92.3
2pd6_A 264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 92.27
2a9f_A 398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 92.27
1uzm_A 247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 92.27
3qwb_A 334 Probable quinone oxidoreductase; rossmann fold, qu 92.27
3i1j_A 247 Oxidoreductase, short chain dehydrogenase/reducta; 92.24
1u8f_O 335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 92.23
1yb5_A 351 Quinone oxidoreductase; medium-chain dehydrogenase 92.22
3afn_B 258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 92.21
3qvo_A 236 NMRA family protein; structural genomics, PSI-biol 92.21
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 92.2
1u7z_A 226 Coenzyme A biosynthesis bifunctional protein coabc 92.2
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 92.18
2a35_A 215 Hypothetical protein PA4017; alpha-beta-alpha sand 92.17
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 92.16
2ew8_A 249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 92.15
3ak4_A 263 NADH-dependent quinuclidinone reductase; SDR, (R)- 92.14
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 92.14
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 92.13
2nm0_A 253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 92.1
3tl2_A 315 Malate dehydrogenase; center for structural genomi 92.09
3gem_A 260 Short chain dehydrogenase; structural genomics, AP 92.08
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 92.05
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 92.05
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 92.05
4imr_A 275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 92.02
1hdc_A 254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 92.02
1iy8_A 267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 92.0
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 91.97
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 91.95
1zk4_A 251 R-specific alcohol dehydrogenase; short chain redu 91.94
1fmc_A 255 7 alpha-hydroxysteroid dehydrogenase; short-chain 91.93
1xq6_A 253 Unknown protein; structural genomics, protein stru 91.92
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 91.9
3imf_A 257 Short chain dehydrogenase; structural genomics, in 91.89
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 91.88
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 91.86
1zem_A 262 Xylitol dehydrogenase; rossmann fold, dinucleotide 91.86
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 91.85
4g65_A 461 TRK system potassium uptake protein TRKA; structur 91.85
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 91.84
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 91.83
3ijr_A 291 Oxidoreductase, short chain dehydrogenase/reducta; 91.82
1sny_A 267 Sniffer CG10964-PA; alpha and beta protein, rossma 91.82
1uls_A 245 Putative 3-oxoacyl-acyl carrier protein reductase; 91.81
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 91.8
2wyu_A 261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 91.79
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 91.78
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 91.78
4eso_A 255 Putative oxidoreductase; NADP, structural genomics 91.78
3rkr_A 262 Short chain oxidoreductase; rossmann fold; HET: NA 91.77
2eih_A 343 Alcohol dehydrogenase; zinc ION binding protein, s 91.76
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 91.76
3jyn_A 325 Quinone oxidoreductase; rossmann fold, protein-NAD 91.76
2ae2_A 260 Protein (tropinone reductase-II); oxidoreductase, 91.72
1qsg_A 265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 91.7
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 91.7
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 91.69
2c0c_A 362 Zinc binding alcohol dehydrogenase, domain contain 91.69
3lyl_A 247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 91.69
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 91.67
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 91.66
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 91.66
2jah_A 247 Clavulanic acid dehydrogenase; short-chain dehydro 91.66
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 91.65
2z1n_A 260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 91.65
2j8z_A 354 Quinone oxidoreductase; medium-chain dehydrogenase 91.64
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 91.63
3ftp_A 270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 91.61
3f9i_A 249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 91.58
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 91.58
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 91.58
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 91.58
1qor_A 327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 91.56
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 91.55
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 91.55
1hxh_A 253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 91.54
2a4k_A 263 3-oxoacyl-[acyl carrier protein] reductase; reduct 91.53
1tt5_A 531 APPBP1, amyloid protein-binding protein 1; cell cy 91.53
2zat_A 260 Dehydrogenase/reductase SDR family member 4; alpha 91.51
4iin_A 271 3-ketoacyl-acyl carrier protein reductase (FABG); 91.51
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 91.48
2dvm_A 439 Malic enzyme, 439AA long hypothetical malate oxido 91.48
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 91.48
2b4q_A 276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 91.48
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 91.47
4dqx_A 277 Probable oxidoreductase protein; structural genomi 91.47
2ag5_A 246 DHRS6, dehydrogenase/reductase (SDR family) member 91.46
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 91.44
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 91.44
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 91.44
1sby_A 254 Alcohol dehydrogenase; ternary complex, NAD, trifl 91.43
3uce_A 223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 91.41
3ctm_A 279 Carbonyl reductase; alcohol dehydrogenase, short-c 91.4
1ldn_A 316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 91.4
2o2s_A 315 Enoyl-acyl carrier reductase; enoyl reductase, tri 91.39
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 91.39
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 91.39
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 91.38
4dup_A 353 Quinone oxidoreductase; PSI-biology, structural ge 91.35
1nff_A 260 Putative oxidoreductase RV2002; directed evolution 91.35
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 91.33
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 91.32
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 91.31
3e9n_A 245 Putative short-chain dehydrogenase/reductase; stru 91.31
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 91.27
2o7s_A 523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 91.25
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 91.25
3r6d_A 221 NAD-dependent epimerase/dehydratase; structural ge 91.22
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 91.22
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 91.21
4gkb_A 258 3-oxoacyl-[acyl-carrier protein] reductase; putati 91.2
3uf0_A 273 Short-chain dehydrogenase/reductase SDR; gluconate 91.18
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 91.18
3op4_A 248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 91.16
3hdj_A 313 Probable ornithine cyclodeaminase; APC62486, borde 91.16
4dry_A 281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 91.16
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 91.14
1xa0_A 328 Putative NADPH dependent oxidoreductases; structur 91.13
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 91.11
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 91.09
3h5n_A 353 MCCB protein; ubiquitin-activating enzyme, microci 91.06
3l6e_A 235 Oxidoreductase, short-chain dehydrogenase/reducta; 91.03
1jvb_A 347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 91.02
1omo_A 322 Alanine dehydrogenase; two-domain, beta-sandwich-d 91.02
2gdz_A 267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 91.01
1kjq_A 391 GART 2, phosphoribosylglycinamide formyltransferas 91.01
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 91.0
3nyw_A 250 Putative oxidoreductase; fatty acid synthesis,3-ox 90.98
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 90.95
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 90.93
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 90.92
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 90.92
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 90.91
1y8q_B 640 Anthracycline-, ubiquitin-like 2 activating enzyme 90.89
2qq5_A 260 DHRS1, dehydrogenase/reductase SDR family member 1 90.89
3rih_A 293 Short chain dehydrogenase or reductase; structural 90.88
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 90.86
3ksu_A 262 3-oxoacyl-acyl carrier protein reductase; structur 90.85
3gaf_A 256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 90.81
1tt7_A 330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 90.79
3t4x_A 267 Oxidoreductase, short chain dehydrogenase/reducta; 90.79
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 90.73
2hq1_A 247 Glucose/ribitol dehydrogenase; CTH-1438, structura 90.71
3c1a_A 315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 90.7
2zb4_A 357 Prostaglandin reductase 2; rossmann fold, alternat 90.67
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 90.67
3cxt_A 291 Dehydrogenase with different specificities; rossma 90.67
1wly_A 333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 90.65
2pnf_A 248 3-oxoacyl-[acyl-carrier-protein] reductase; short 90.65
3gdg_A 267 Probable NADP-dependent mannitol dehydrogenase; ro 90.65
3uuw_A 308 Putative oxidoreductase with NAD(P)-binding rossm 90.6
4ibo_A 271 Gluconate dehydrogenase; enzyme function initiativ 90.6
1x1t_A 260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 90.56
1xq1_A 266 Putative tropinone reducatse; structural genomics, 90.51
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 90.49
1yo6_A 250 Putative carbonyl reductase sniffer; tyrosine-depe 90.47
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 90.46
2f00_A 491 UDP-N-acetylmuramate--L-alanine ligase; amide bond 90.43
1oaa_A 259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 90.36
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 90.34
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 90.32
3jv7_A 345 ADH-A; dehydrogenase, nucleotide binding, rossmann 90.3
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 90.29
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 90.27
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 90.27
2ptg_A 319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 90.26
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 90.24
1d7o_A 297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 90.19
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 90.19
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 90.19
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 90.16
4b79_A 242 PA4098, probable short-chain dehydrogenase; oxidor 90.15
1xkq_A 280 Short-chain reductase family member (5D234); parra 90.14
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 90.14
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 90.14
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 90.11
1lnq_A 336 MTHK channels, potassium channel related protein; 90.07
3tl3_A 257 Short-chain type dehydrogenase/reductase; ssgcid, 90.03
2vn8_A 375 Reticulon-4-interacting protein 1; mitochondrion, 90.02
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 89.96
3r3s_A 294 Oxidoreductase; structural genomics, csgid, center 89.96
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 89.93
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 89.9
1ys4_A 354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 89.83
1spx_A 278 Short-chain reductase family member (5L265); paral 89.82
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
Probab=100.00  E-value=5e-41  Score=287.56  Aligned_cols=192  Identities=22%  Similarity=0.320  Sum_probs=162.5

Q ss_pred             ceEEEeCCCCCCchhhHHHHhhcCCCeEEecCCCCC-hhhhcCCceEEEEc-CCCCCHHHHhcCCCceEEEEccccCCcc
Q 028302           13 TRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISD-VPDVIANYHLCVVK-TMRLDSNCISRANQMKLIMQFGVGLEGV   90 (210)
Q Consensus        13 ~~ili~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~-~~~~~~~adv~i~~-~~~~~~~~l~~~p~Lk~i~~~~aG~d~i   90 (210)
                      |+|+++....++ .++.++.++.+ .+++...+..+ ..+.++++|++++. ..++++++++++|+||||++.|+|+|+|
T Consensus         1 Mkil~~~~~~~~-~p~~~e~l~~~-~~~~~~~~~~~~~~~~l~~ad~i~v~~~~~i~~~~l~~~p~Lk~I~~~~~G~d~i   78 (334)
T 3kb6_A            1 MNVLFTSVPQED-VPFYQEALKDL-SLKIYTTDVSKVPENELKKAELISVFVYDKLTEELLSKMPRLKLIHTRSVGFDHI   78 (334)
T ss_dssp             -CEEECSCCTTH-HHHHHHHTTTS-CEEECSSCGGGSCHHHHHHCSEEEECTTSCBCHHHHHTCTTCCEEEESSSCCTTB
T ss_pred             CEEEEeCCCccc-CHHHHHHHHhC-CcEEEeCCcccCCHHHhcCCCEEEEeCCCCCCHHHHhcCCCCcEEEECCcccchh
Confidence            689998755433 55556666554 34443333222 23557889988874 5679999999999999999999999999


Q ss_pred             chhHHhhCCcEEEecCCCCCCCchhHHHHHHHHHHHHHhhHHHHHHHHHhCCCCCC---cccccccCeEEEEecChHHHH
Q 028302           91 DINAATRCGIKVARIPGDVTGNAASCAELTIYLMLGLLRKQNEMRMAIEQKKLGVP---TGETLLGKTVFILGFGNIGVE  167 (210)
Q Consensus        91 d~~~~~~~gi~v~~~~~~~~~~a~~vAE~~l~~~L~~~R~~~~~~~~~~~~~w~~~---~~~~l~~~tvGIiG~G~IG~~  167 (210)
                      |++++.++||.|+|+||+   ++.+||||+++++|++.|++..+++.++++.|...   .+.+|+|+||||||+|+||++
T Consensus        79 d~~~~~~~gI~v~n~p~~---~~~~vAE~~~~l~L~~~r~~~~~~~~~~~~~~~~~~~~~~~~l~g~tvGIiG~G~IG~~  155 (334)
T 3kb6_A           79 DLDYCKKKGILVTHIPAY---SPESVAEHTFAMILTLVKRLKRIEDRVKKLNFSQDSEILARELNRLTLGVIGTGRIGSR  155 (334)
T ss_dssp             CHHHHHHHTCEEECCTTS---CHHHHHHHHHHHHHHHHTTHHHHHHHHHTTCCCCCGGGCBCCGGGSEEEEECCSHHHHH
T ss_pred             cHHHHHHCCCEEEECCCc---CcHHHHHHHHHHHHHHhhccccccccccccccccccccccceecCcEEEEECcchHHHH
Confidence            999999999999999999   88999999999999999999999999999987643   668999999999999999999


Q ss_pred             HHHHhccCCCEEEEEcCCCCCC-------------CcccCceeEEecCCCCCCCCC
Q 028302          168 LAKRLRPFGVKIIATKRSWASH-------------SQVSCQSSGMLGPLSDGETHH  210 (210)
Q Consensus       168 vA~~~~~fg~~V~~~~~~~~~~-------------~~~~~~~~~~~~Plt~~~T~h  210 (210)
                      +|+++++|||+|++||++.++.             ++.++|.+++.||+|+ +|+|
T Consensus       156 va~~~~~fg~~v~~~d~~~~~~~~~~~~~~~~l~ell~~sDivslh~Plt~-~T~~  210 (334)
T 3kb6_A          156 VAMYGLAFGMKVLCYDVVKREDLKEKGCVYTSLDELLKESDVISLHVPYTK-ETHH  210 (334)
T ss_dssp             HHHHHHHTTCEEEEECSSCCHHHHHTTCEECCHHHHHHHCSEEEECCCCCT-TTTT
T ss_pred             HHHhhcccCceeeecCCccchhhhhcCceecCHHHHHhhCCEEEEcCCCCh-hhcc
Confidence            9999999999999999976532             5778999999999999 9998



>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3on5_A BH1974 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, oxidoreductase; 2.80A {Bacillus halodurans} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 210
d1j4aa2134 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogen 3e-13
d1qp8a2121 c.23.12.1 (A:1-82,A:264-302) Putative formate dehy 5e-10
d1mx3a2133 c.23.12.1 (A:27-125,A:319-352) Transcription corep 1e-08
d1gdha2129 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrog 2e-07
d1dxya2131 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproa 4e-07
d1sc6a2132 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate deh 6e-07
d2naca2186 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenas 7e-07
d1ygya2130 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehy 9e-07
d1gdha1191 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyp 3e-04
d1hwxa1 293 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow ( 3e-04
d1li4a1163 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolas 5e-04
d1c1da1 201 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {R 0.001
>d1j4aa2 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Length = 134 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Formate/glycerate dehydrogenase catalytic domain-like
family: Formate/glycerate dehydrogenases, substrate-binding domain
domain: D-lactate dehydrogenase
species: Lactobacillus helveticus [TaxId: 1587]
 Score = 61.9 bits (150), Expect = 3e-13
 Identities = 18/135 (13%), Positives = 44/135 (32%), Gaps = 15/135 (11%)

Query: 13  TRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYH----LCVVKTMRLDS 68
           T++            + KE+   +  ++V+       P+ +A       + V + +   +
Sbjct: 1   TKIFAYAIR-EDEKPFLKEWEDAHKDVEVEYTDKLLTPETVALAKGADGVVVYQQLDYIA 59

Query: 69  NCISRANQMKLIM--QFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYLMLG 126
             +       +       VG++ +D+  A   G ++  +P        S     +  M+ 
Sbjct: 60  ETLQALADNGITKMSLRNVGVDNIDMAKAKELGFQITNVPV------YSYTTHAVRNMVV 113

Query: 127 LLRKQNEMRMAIEQK 141
                N     +E K
Sbjct: 114 KAFDNN--LELVEGK 126


>d1qp8a2 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 121 Back     information, alignment and structure
>d1mx3a2 c.23.12.1 (A:27-125,A:319-352) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1gdha2 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Length = 129 Back     information, alignment and structure
>d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Length = 131 Back     information, alignment and structure
>d1sc6a2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d2naca2 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Length = 186 Back     information, alignment and structure
>d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 130 Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Length = 191 Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Length = 293 Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 163 Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Length = 201 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query210
d1qp8a2121 Putative formate dehydrogenase {Archaeon Pyrobacul 99.92
d1ygya2130 Phosphoglycerate dehydrogenase {Mycobacterium tube 99.92
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 99.92
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 99.91
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 99.91
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 99.91
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 99.91
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 99.9
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 99.89
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 99.88
d1dxya2131 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 99.87
d1sc6a2132 Phosphoglycerate dehydrogenase {Escherichia coli [ 99.85
d1j4aa2134 D-lactate dehydrogenase {Lactobacillus helveticus 99.83
d1gdha2129 D-glycerate dehydrogenase {Hyphomicrobium methylov 99.81
d1mx3a2133 Transcription corepressor CtbP {Human (Homo sapien 99.81
d2naca2186 Formate dehydrogenase {Pseudomonas sp., strain 101 99.79
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 98.84
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 98.15
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 97.94
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.89
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 97.88
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.87
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 97.77
d3cuma2 162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 97.77
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 97.76
d1c1da1 201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 97.71
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 97.68
d2pgda2 176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 97.62
d2g5ca2 171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.43
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 97.26
d1v9la1 242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 97.26
d1leha1 230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 97.11
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.05
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 97.03
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 96.99
d1f0ya2 192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 96.97
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 96.93
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 96.83
d1gtma1 239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 96.8
d1ks9a2 167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.8
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 96.79
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.79
d1wdka3 186 Fatty oxidation complex alpha subunit, middle doma 96.78
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 96.77
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.76
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.67
d1bgva1 255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 96.6
d1b26a1 234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 96.58
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 96.51
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.4
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.36
d1luaa1 191 Methylene-tetrahydromethanopterin dehydrogenase {M 96.31
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 96.27
d1f06a1 170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 96.26
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 96.22
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.19
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.14
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.1
d1np3a2 182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 96.06
d1cf2o1 171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.9
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 95.9
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 95.87
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 95.82
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 95.75
d1jw9b_ 247 Molybdenum cofactor biosynthesis protein MoeB {Esc 95.72
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 95.68
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 95.63
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 95.6
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 95.59
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 95.49
d2czca2 172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.41
d2o23a1 248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 95.39
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 95.3
d1gtea4 196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.27
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.25
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 95.22
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 95.16
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 95.15
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.14
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 95.11
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 95.1
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 95.06
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.05
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 94.99
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 94.99
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 94.95
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 94.94
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 94.91
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 94.9
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 94.86
d1nvta1 177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 94.72
d1vi2a1 182 Putative shikimate dehydrogenase YdiB {Escherichia 94.7
d1pr9a_ 244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 94.68
d1qmga2 226 Class II ketol-acid reductoisomerase (KARI) {Spina 94.68
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 94.66
d1hdoa_ 205 Biliverdin IX beta reductase {Human (Homo sapiens) 94.64
d1dssg1 169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.64
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 94.61
d2h7ma1 268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 94.61
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.6
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 94.47
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 94.46
d1ulua_ 256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 94.43
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 94.41
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 94.4
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 94.39
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 94.36
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 94.33
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 94.3
d1hdgo1 169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.3
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 94.28
d1n1ea2 189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 94.24
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 94.22
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 94.13
d1cyda_ 242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 94.11
d1uzma1 237 beta-keto acyl carrier protein reductase {Mycobact 94.09
d2g82a1 168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.09
d2a4ka1 241 beta-keto acyl carrier protein reductase {Thermus 94.05
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 94.04
d1kola2 195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 93.98
d1gado1 166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.97
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 93.92
d1djqa3 233 Trimethylamine dehydrogenase, middle domain {Methy 93.9
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 93.88
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 93.88
d1qsga_ 258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 93.88
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 93.86
d1xeaa1 167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 93.78
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 93.73
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 93.73
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 93.64
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 93.56
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 93.41
d1o5ia_ 234 beta-keto acyl carrier protein reductase {Thermoto 93.34
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 93.34
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 93.33
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 93.32
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 93.29
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 93.29
d1id1a_153 Rck domain from putative potassium channel Kch {Es 93.26
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 93.22
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 93.22
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 93.13
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 93.08
d2ag5a1 245 Dehydrogenase/reductase SDR family member 6, DHRS6 93.01
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 93.0
d1q7ba_ 243 beta-keto acyl carrier protein reductase {Escheric 92.98
d1obfo1 173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.95
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 92.94
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 92.93
d1nffa_ 244 Putative oxidoreductase Rv2002 {Mycobacterium tube 92.85
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 92.83
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 92.81
d1u8fo1 169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.79
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 92.79
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 92.78
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 92.72
d2ew8a1 247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 92.7
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 92.69
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 92.67
d2d1ya1 248 Hypothetical protein TTHA0369 {Thermus thermophilu 92.6
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 92.6
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 92.6
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 92.57
d2b4ro1 166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.4
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 92.33
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 92.31
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 92.3
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 92.23
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 92.21
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 92.21
d3cmco1 171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.18
d1tlta1 164 Virulence factor MviM {Escherichia coli [TaxId: 56 92.17
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 92.17
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 92.09
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 92.08
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 92.06
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 91.98
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 91.84
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 91.78
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 91.72
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 91.56
d1vl6a1 222 Malate oxidoreductase (malic enzyme) {Thermotoga m 91.54
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 91.54
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 91.54
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 91.54
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 91.5
d1sbya1 254 Drosophila alcohol dehydrogenase {Fly (Drosophila 91.41
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 91.3
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 91.26
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 91.24
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 90.98
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 90.86
d1gu7a2 189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 90.74
d1q1ra1 185 Putidaredoxin reductase {Pseudomonas putida [TaxId 90.51
d1ebfa1 168 Homoserine dehydrogenase {Baker's yeast (Saccharom 90.5
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 90.48
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 90.48
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 90.15
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 90.06
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 90.06
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 90.01
d1h6da1 221 Glucose-fructose oxidoreductase, N-terminal domain 89.96
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 89.85
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 89.67
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 89.63
d1zh8a1 181 Hypothetical protein TM0312 {Thermotoga maritima [ 89.59
d1xhca1 167 NADH oxidase /nitrite reductase {Pyrococcus furios 89.56
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 89.51
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 89.35
d1trba1 190 Thioredoxin reductase {Escherichia coli [TaxId: 56 89.21
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 89.16
d1w4xa2 235 Phenylacetone monooxygenase {Thermobifida fusca [T 88.98
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 88.54
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 88.47
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 87.65
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 87.64
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 87.63
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 87.62
d1pvva2 163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 87.38
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 87.28
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 87.27
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 87.22
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 87.13
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 87.13
d1dxla1 221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 86.71
d2bkaa1 232 TAT-interacting protein TIP30 {Human (Homo sapiens 86.54
d1dlja3108 UDP-glucose dehydrogenase (UDPGDH), C-terminal (UD 86.5
d1cjca1 225 Adrenodoxin reductase of mitochondrial p450 system 86.35
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 86.31
d1lc0a1 172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 86.27
d1vdca1 192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 86.24
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 86.22
d1v59a1 233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 86.17
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 86.07
d1h6va1 235 Mammalian thioredoxin reductase {Rat (Rattus norve 85.93
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 85.62
d1lvla1 220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 84.57
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 84.4
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 84.37
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 84.32
d1dxha2 185 Ornithine transcarbamoylase {Pseudomonas aeruginos 84.26
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 84.25
d2q46a1 252 Hypothetical protein At5g02240 (T7H20_290) {Thale 84.14
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 83.73
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 83.45
d3grsa1 221 Glutathione reductase {Human (Homo sapiens) [TaxId 83.18
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 83.07
d1otha2 170 Ornithine transcarbamoylase {Human (Homo sapiens) 82.93
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 82.63
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 82.42
d1o0sa1 308 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 82.42
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 81.8
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 81.58
d1pj3a1 294 Mitochondrial NAD(P)-dependent malic enzyme {Human 81.22
d1oaaa_ 259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 80.9
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 80.23
d1ml4a2157 Aspartate carbamoyltransferase catalytic subunit { 80.2
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 80.1
d2cvoa1 183 Putative semialdehyde dehydrogenase {Rice (Oryza s 80.1
>d1qp8a2 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Formate/glycerate dehydrogenase catalytic domain-like
family: Formate/glycerate dehydrogenases, substrate-binding domain
domain: Putative formate dehydrogenase
species: Archaeon Pyrobaculum aerophilum [TaxId: 13773]
Probab=99.92  E-value=2.7e-28  Score=178.00  Aligned_cols=121  Identities=17%  Similarity=0.213  Sum_probs=97.6

Q ss_pred             ceEEEeCCCCCCchhhHHHHhhcCCCeEEecCCCCChhhhcCCceEEEEcCCCCCHHHHhcCCCceEEEEccccCCccch
Q 028302           13 TRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKTMRLDSNCISRANQMKLIMQFGVGLEGVDI   92 (210)
Q Consensus        13 ~~ili~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~adv~i~~~~~~~~~~l~~~p~Lk~i~~~~aG~d~id~   92 (210)
                      |||+++.+..++   . ++.++...  ++..      ...++++|+++.  ++++++.++++|+||||++.++|+||+|.
T Consensus         1 Mki~v~~~lp~e---~-~e~L~~~~--~v~~------~~d~~~~d~~l~--~~~~~~~l~~~~~Lk~i~~~~aG~D~i~~   66 (121)
T d1qp8a2           1 MELYVNFELPPE---A-EEELRKYF--KIVR------GGDLGNVEAALV--SRITAEELAKMPRLKFIQVVTAGLDHLPW   66 (121)
T ss_dssp             CEEECCSCCCHH---H-HHHHHTTC--EEEC------SSCCTTBCCCCB--SCCCHHHHHHCTTCCCEEBSSSCCTTSCC
T ss_pred             CEEEEeCCCCHH---H-HHHhhhcc--eEee------cccccccceeee--eccCHHHHhcCCCceEEEecccCcCCCCH
Confidence            688888775432   2 33333322  2221      123567787775  67999999999999999999999999999


Q ss_pred             hHHhhCCcEEEecCCCCCCCchhHHHHHHHHHHHHHhhHHHHHHHHHhCCCCCCcccccccCeEEEEecChHHHHHHHHh
Q 028302           93 NAATRCGIKVARIPGDVTGNAASCAELTIYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRL  172 (210)
Q Consensus        93 ~~~~~~gi~v~~~~~~~~~~a~~vAE~~l~~~L~~~R~~~~~~~~~~~~~w~~~~~~~l~~~tvGIiG~G~IG~~vA~~~  172 (210)
                      +.+ +++|.|+|++|+   |+.+||||+++++|++.|                         +++|+|+|+|||++|+|+
T Consensus        67 ~~~-~~~i~v~n~~g~---~~~~vae~~~~~il~~~r-------------------------~l~i~G~G~iG~~iA~r~  117 (121)
T d1qp8a2          67 ESI-PPHVTVAGNAGS---NGYGNERVWRQMVMEAVR-------------------------NLITYATGGRPRNIAKRE  117 (121)
T ss_dssp             TTS-CTTSCEECCCSS---SSSSCHHHHHHHHHHHHH-------------------------HHHHHHTTSCCSCBCCGG
T ss_pred             HHh-ccCeEEEECCCC---ChHHHHHHHHHHHHHhcC-------------------------CEEEEcCCHHHHHHHHHH
Confidence            987 579999999999   999999999999999997                         368999999999999999


Q ss_pred             ccCC
Q 028302          173 RPFG  176 (210)
Q Consensus       173 ~~fg  176 (210)
                      ++||
T Consensus       118 ~a~G  121 (121)
T d1qp8a2         118 DYIG  121 (121)
T ss_dssp             GTC-
T ss_pred             HhcC
Confidence            9998



>d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1sc6a2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j4aa2 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1gdha2 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1mx3a2 c.23.12.1 (A:27-125,A:319-352) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d2naca2 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dlja3 c.26.3.1 (A:295-402) UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1otha2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure