Citrus Sinensis ID: 028306

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210

MLIRQARNFSKAYAAPLSSSLKTLFPSPADVVPGVAADVADVTGADDLVYTEPPVSSTVKPAMEPSLLQPGVVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRFLFVEGPGLYHQASTAALKVLSHLPLPYSALSSLLIIPRPLRDAVYDYIAKQRYHWFGKSEDCLVLKEKELLERFIDRDEMLGRS

ccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccHHHHHHHHHHcccccEEEEEcccHHHHHHHHHccccHHHcccEEEEEEcccEEEEHHHHHHHHHHHcccccHHHHHHHHccHHHHHHHHHHHHHHHHHcccccccccccccHHHHccccccccccccc

cHHHHHHHcccccccccccHHHHcccccccccHHHHHHHHcccHHHHHcccccccccccccccccccccccEEEEccccHHccHcEEEEEEccccccEEEEccccHHHHHHHHHccccccccccEEEEEEcccEEEEcHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccEEcccHHHHHHHHcHHHHcccc

MLIRQARNFSKayaaplssslktlfpspadvvpgvaadvadvtgaddlvyteppvsstvkpamepsllqpgvviydgvchlchggvKWVIRADKYRKIKFcclqsqaaepylrlcgldrEDVLRRFLfvegpglyhqASTAALKVLshlplpysalsslliiprplrDAVYDYIAKqryhwfgksedcLVLKEKELLERFIDrdemlgrs

mlirqarnFSKAYAAPLSSSLKTLFPSPADVVPGVAADVADVTGADDLVYTEPPVSSTVKPAMEPSLLQPGVVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRFLFVEGPGLYHQASTAALKVLSHLPLPYSALSSLLIIPRPLRDAVYDYIAKQRYhwfgksedclvLKEKELLerfidrdemlgrs

MLIRQARNFSKAYAAPLSSSLKTLFPSpadvvpgvaadvadvtgaddLVYTEPPVSSTVKPAMEPSLLQPGVVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRFLFVEGPGLYHQASTAALKVlshlplpysalssllIIPRPLRDAVYDYIAKQRYHWFGKSEDCLVLKEKELLERFIDRDEMLGRS

***********************LF**PADVVPGVAADVADVTGADDLVYTE*************SLLQPGVVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRFLFVEGPGLYHQASTAALKVLSHLPLPYSALSSLLIIPRPLRDAVYDYIAKQRYHWFGKSEDCLVLKEKELLERFI*********

****************************ADVVPGVAADVAD*****************************GVVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRFLFVEGPGLYHQASTAALKVLSHLPLPYSALSSLLIIPRPLRDAVYDYIAKQRYHWFGKSEDCLVLKEKELLERFID**E*****

********FSKAYAAPLSSSLKTLFPSPADVVPGVAADVADVTGADDLVYTEPPVSSTVKPAMEPSLLQPGVVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRFLFVEGPGLYHQASTAALKVLSHLPLPYSALSSLLIIPRPLRDAVYDYIAKQRYHWFGKSEDCLVLKEKELLERFIDRDEMLGRS

*********************************************DD**YTEPPVSSTVKPAMEPSLLQPGVVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRFLFVEGPGLYHQASTAALKVLSHLPLPYSALSSLLIIPRPLRDAVYDYIAKQRYHWFGKSEDCLVLKEKELLERFIDRDE*****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		210	2.2.26 [Sep-21-2011]
P40761		137	Uncharacterized protein Y	yes	no	0.595	0.912	0.409	5e-22
Q9SSR1		172	DCC family protein At1g52	no	no	0.547	0.668	0.372	3e-15

>sp\|P40761\|YUXK_BACSU Uncharacterized protein YuxK OS=Bacillus subtilis (strain 168) GN=yuxK PE=3 SV=1	Back alignment and function desciption

 Score =  104 bits (259), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 54/132 (40%), Positives = 80/132 (60%), Gaps = 7/132 (5%)

Query: 72  VVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGL--DREDVLRRFLFV 129
           V+++DGVC+LC+G V+++I+ D    I F  LQS+  +  L+  GL  DR D    F+F+
Sbjct: 10  VLLFDGVCNLCNGAVQFIIKRDPDGLISFTSLQSETGQSLLKKSGLPTDRFD---SFVFI 66

Query: 130 EGPGLYHQASTAALKVLSHLPLPYSALSSLLIIPRPLRDAVYDYIAKQRYHWFGKSEDCL 189
           E  G  +  STAA+KV  HL  P+        +P+P+RD VY +IAK RY WFGK  +C+
Sbjct: 67  ED-GQVYTKSTAAIKVFRHLRGPWRLFVLFFAVPKPVRDMVYSFIAKNRYKWFGKKNECM 125

Query: 190 VLKEKELLERFI 201
            L    + +RF+
Sbjct: 126 -LPSPSIKKRFL 136

Bacillus subtilis (strain 168) (taxid: 224308)

>sp\|Q9SSR1\|Y1259_ARATH DCC family protein At1g52590, chloroplastic OS=Arabidopsis thaliana GN=At1g52590 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		210
255588184		213	conserved hypothetical protein [Ricinus	0.828	0.816	0.740	5e-72
359473412		453	PREDICTED: uncharacterized protein LOC10	0.690	0.320	0.834	4e-68
297845448		536	RNase H domain-containing protein [Arabi	0.880	0.345	0.648	4e-68
224099711		208	predicted protein [Populus trichocarpa]	0.776	0.783	0.753	5e-68
118482345		220	unknown [Populus trichocarpa]	0.790	0.754	0.748	1e-67
296086506		216	unnamed protein product [Vitis vinifera]	0.971	0.944	0.641	2e-67
334182808		213	Putative thiol-disulfide oxidoreductase	0.880	0.868	0.643	5e-67
357486077		226	Nucleic acid binding protein [Medicago t	0.842	0.783	0.691	9e-65
147777969		224	hypothetical protein VITISV_018709 [Viti	0.971	0.910	0.6	3e-62
125554691		209	hypothetical protein OsI_22313 [Oryza sa	0.685	0.688	0.777	5e-62

>gi\|255588184\|ref\|XP_002534526.1\| conserved hypothetical protein [Ricinus communis] gi\|223525107\|gb\|EEF27856.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

 Score =  276 bits (705), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 154/181 (85%), Gaps = 7/181 (3%)

Query: 28  PADVVPGVAADVADVTGADDLVYTEPPVSSTVKPAMEPSLLQPGVVIYDGVCHLCHGGVK 87
           P D V   AADVA      +++Y  P  S+   P   P+LLQP VV+YDGVCHLCH GVK
Sbjct: 40  PIDTVSETAADVAG-----EVLY--PDASTLPSPVTLPTLLQPRVVVYDGVCHLCHRGVK 92

Query: 88  WVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRFLFVEGPGLYHQASTAALKVLS 147
           WVI+ADKYRKIKFCCLQS+AAEPYLRLCGLDR+DVLRRFLF+EGP LYHQASTAAL+V+S
Sbjct: 93  WVIKADKYRKIKFCCLQSKAAEPYLRLCGLDRDDVLRRFLFIEGPDLYHQASTAALRVVS 152

Query: 148 HLPLPYSALSSLLIIPRPLRDAVYDYIAKQRYHWFGKSEDCLVLKEKELLERFIDRDEML 207
           +LPLPYSALS+LLIIP PLRDAVYDY+AK RY+WFGK++DCLVLK+KELLERFIDR EM+
Sbjct: 153 YLPLPYSALSTLLIIPTPLRDAVYDYVAKGRYNWFGKADDCLVLKDKELLERFIDRGEMM 212

Query: 208 G 208
           G
Sbjct: 213 G 213

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|359473412\|ref\|XP_002266599.2\| PREDICTED: uncharacterized protein LOC100255243 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297845448\|ref\|XP_002890605.1\| RNase H domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi\|297336447\|gb\|EFH66864.1\| RNase H domain-containing protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|224099711\|ref\|XP_002311587.1\| predicted protein [Populus trichocarpa] gi\|222851407\|gb\|EEE88954.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|118482345\|gb\|ABK93096.1\| unknown [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|296086506\|emb\|CBI32095.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|334182808\|ref\|NP_001185076.1\| Putative thiol-disulfide oxidoreductase DCC [Arabidopsis thaliana] gi\|9369400\|gb\|AAF87148.1\|AC002423_13 T23E23.25 [Arabidopsis thaliana] gi\|332192356\|gb\|AEE30477.1\| Putative thiol-disulfide oxidoreductase DCC [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|357486077\|ref\|XP_003613326.1\| Nucleic acid binding protein [Medicago truncatula] gi\|355514661\|gb\|AES96284.1\| Nucleic acid binding protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|147777969\|emb\|CAN65134.1\| hypothetical protein VITISV_018709 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|125554691\|gb\|EAZ00297.1\| hypothetical protein OsI_22313 [Oryza sativa Indica Group]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		210
UNIPROTKB\|Q481Y2		148	CPS_2420 "Putative uncharacter	0.619	0.878	0.293	1.9e-12
TIGR_CMR\|CPS_2420		148	CPS_2420 "conserved hypothetic	0.619	0.878	0.293	1.9e-12
UNIPROTKB\|Q87WV7		150	PSPTO_4436 "Uncharacterized pr	0.619	0.866	0.338	2.4e-12
TAIR\|locus:2035159		172	AT1G52590 "AT1G52590" [Arabido	0.547	0.668	0.338	5e-12
UNIPROTKB\|Q48N48		122	PSPPH_0898 "Uncharacterized pr	0.290	0.5	0.375	1.8e-07

UNIPROTKB\|Q481Y2 CPS_2420 "Putative uncharacterized protein" [Colwellia psychrerythraea 34H (taxid:167879)]	Back alignment and assigned GO terms

 Score = 166 (63.5 bits), Expect = 1.9e-12, P = 1.9e-12
 Identities = 39/133 (29%), Positives = 65/133 (48%)

Query:    72 VVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRFLFVEG 131
             V+++DGVC LC    +++++ D  ++ K C +QS   +  L    +   D     L VEG
Sbjct:    16 VILFDGVCKLCDFWTQFIVKVDTQQRFKLCSVQSPEGQSILNYFKMPT-DHFDTMLLVEG 74

Query:   132 PGLYHQASTAALKVXXXXXXXXXXXXXXXIIPRPLRDAVYDYIAKQRYHWFGKSEDCLVL 191
                + + S A L                 I+P+ +R+ +YD IA+ RY+ FG+ + C+ L
Sbjct:    75 NQCFDK-SDAFLNTMSKLSYPWRLFTAFKILPKGIRNWLYDRIARNRYYLFGRYDSCM-L 132

Query:   192 KEKELLERFIDRD 204
               KE   RF+  D
Sbjct:   133 PSKENENRFLKGD 145

GO:0003674 "molecular_function" evidence=ND

GO:0005575 "cellular_component" evidence=ND

GO:0008150 "biological_process" evidence=ND

TIGR_CMR\|CPS_2420 CPS_2420 "conserved hypothetical protein" [Colwellia psychrerythraea 34H (taxid:167879)]	Back alignment and assigned GO terms

UNIPROTKB\|Q87WV7 PSPTO_4436 "Uncharacterized protein" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)]	Back alignment and assigned GO terms

TAIR\|locus:2035159 AT1G52590 "AT1G52590" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q48N48 PSPPH_0898 "Uncharacterized protein" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		210
COG3011		137	COG3011, COG3011, Predicted thiol-disulfide oxidor	3e-32
pfam04134		113	pfam04134, DUF393, Protein of unknown function, DU	3e-32

>gnl\|CDD\|225556 COG3011, COG3011, Predicted thiol-disulfide oxidoreductase [General function prediction only]	Back alignment and domain information

 Score =  113 bits (284), Expect = 3e-32
 Identities = 57/124 (45%), Positives = 76/124 (61%), Gaps = 2/124 (1%)

Query: 72  VVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRFLFVEG 131
           VV+YDGVC LC G V+++IR D+  +I+F  LQS+  +  L   GLD EDV    L VE 
Sbjct: 11  VVLYDGVCPLCDGWVRFLIRRDQGGRIRFAALQSEPGQALLEAAGLDPEDV-DSVLLVEA 69

Query: 132 PGLYHQASTAALKVLSHLPLPYSALSSLLIIPRPLRDAVYDYIAKQRYHWFGKSEDCLVL 191
             L    S AA+++L  LP P+  L  L I+PRPLRD VYD+ A  RY WFG+ + C + 
Sbjct: 70  GQLL-VGSDAAIRILRLLPGPWRLLVWLWILPRPLRDRVYDFFADNRYRWFGRKDQCELP 128

Query: 192 KEKE 195
             +E
Sbjct: 129 PPRE 132

Length = 137

>gnl\|CDD\|217918 pfam04134, DUF393, Protein of unknown function, DUF393	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		210
COG3011		137	Predicted thiol-disulfide oxidoreductase [General	100.0
PF04134		114	DUF393: Protein of unknown function, DUF393; Inter	99.97
TIGR02180		84	GRX_euk Glutaredoxin. This model represents eukary	94.72
cd02066		72	GRX_family Glutaredoxin (GRX) family; composed of	94.03
cd03419		82	GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h	93.62
PF13728		215	TraF: F plasmid transfer operon protein	93.31
TIGR02190		79	GlrX-dom Glutaredoxin-family domain. This C-termin	92.72
cd02966		116	TlpA_like_family TlpA-like family; composed of Tlp	91.87
COG3019		149	Predicted metal-binding protein [General function	91.83
PRK10638		83	glutaredoxin 3; Provisional	91.73
PRK11200		85	grxA glutaredoxin 1; Provisional	91.11
PF13098		112	Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_	90.78
cd03027		73	GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg	90.68
TIGR02739		256	TraF type-F conjugative transfer system pilin asse	90.56
cd03418		75	GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b	89.32
cd02982		103	PDI_b'_family Protein Disulfide Isomerase (PDIb')	89.32
cd02973		67	TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-	88.44
PRK13703		248	conjugal pilus assembly protein TraF; Provisional	88.33
TIGR02183		86	GRXA Glutaredoxin, GrxA family. This model include	88.17
cd03029		72	GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb	87.58
cd00570		71	GST_N_family Glutathione S-transferase (GST) famil	87.38
cd03040		77	GST_N_mPGES2 GST_N family; microsomal Prostaglandi	86.78
cd02961		101	PDI_a_family Protein Disulfide Isomerase (PDIa) fa	86.02
cd03060		71	GST_N_Omega_like GST_N family, Omega-like subfamil	85.82
cd02949		97	TRX_NTR TRX domain, novel NADPH thioredoxin reduct	85.34
TIGR00411		82	redox_disulf_1 small redox-active disulfide protei	85.12
TIGR02740		271	TraF-like TraF-like protein. This protein is relat	84.93
cd03041		77	GST_N_2GST_N GST_N family, 2 repeats of the N-term	84.73
PHA03050		108	glutaredoxin; Provisional	83.94
cd03020		197	DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil	83.94
TIGR01126		102	pdi_dom protein disulfide-isomerase domain. This m	83.89
PRK11657		251	dsbG disulfide isomerase/thiol-disulfide oxidase;	83.28
PTZ00051		98	thioredoxin; Provisional	83.2
cd03059		73	GST_N_SspA GST_N family, Stringent starvation prot	83.17
TIGR02181		79	GRX_bact Glutaredoxin, GrxC family. This family of	82.98
TIGR02200		77	GlrX_actino Glutaredoxin-like protein. This family	82.95
cd03028		90	GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte	82.95
cd03023		154	DsbA_Com1_like DsbA family, Com1-like subfamily; c	82.77
PF00085		103	Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio	82.76
TIGR00365		97	monothiol glutaredoxin, Grx4 family. The gene for	81.76
PRK10877		232	protein disulfide isomerase II DsbC; Provisional	81.42
TIGR02189		99	GlrX-like_plant Glutaredoxin-like family. This fam	81.16
cd03045		74	GST_N_Delta_Epsilon GST_N family, Class Delta and	80.71
TIGR02738		153	TrbB type-F conjugative transfer system pilin asse	80.37
cd03056		73	GST_N_4 GST_N family, unknown subfamily 4; compose	80.01

>COG3011 Predicted thiol-disulfide oxidoreductase [General function prediction only]	Back alignment and domain information

Probab=100.00  E-value=1.7e-33  Score=224.62  Aligned_cols=129  Identities=45%  Similarity=0.831  Sum_probs=119.7

Q ss_pred             CeEEEEcCCCcccHHHHHHHHhhcCCCcEEEEeCCCccchhHHHhcCCCHHHhhccEEEEECCCeEEEcHHHHHHHHHhC
Q 028306           70 PGVVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRFLFVEGPGLYHQASTAALKVLSHL  149 (210)
Q Consensus        70 ~~~V~YDG~CplC~~~v~~L~~~d~~~~i~f~~iqs~~~~~~L~~~gi~~e~~~~~l~vv~~~G~~y~GsdAvl~il~~L  149 (210)
                      ..+|+|||.|++|+.+|+||+++|..++++|.++|++.+.+.++..|++.++. .+++++++ |+.+.|+||++++++.+
T Consensus         9 ~~vvlyDG~C~lC~~~vrfLi~~D~~~~i~f~~~q~e~g~~~l~~~~l~~~~~-~s~~~~~~-g~~~~~sdA~~~i~~~L   86 (137)
T COG3011           9 DLVVLYDGVCPLCDGWVRFLIRRDQGGRIRFAALQSEPGQALLEAAGLDPEDV-DSVLLVEA-GQLLVGSDAAIRILRLL   86 (137)
T ss_pred             CEEEEECCcchhHHHHHHHHHHhccCCcEEEEeccCchhhhHHhhcCCChhhh-heeeEecC-CceEeccHHHHHHHHHC
Confidence            46999999999999999999999999999999999999999999999999983 56666654 89999999999999999


Q ss_pred             CCchhHHHHHHhccHhHHHHHHHHHHhhccccCCCCCcccCCCchhhhhccC
Q 028306          150 PLPYSALSSLLIIPRPLRDAVYDYIAKQRYHWFGKSEDCLVLKEKELLERFI  201 (210)
Q Consensus       150 p~~w~ll~~L~~lP~~L~d~~Y~~VArnRyrlfG~~~~C~lp~~~~~~~Rfl  201 (210)
                      |++|+++..+..+|++++|.+|++||+|||+|||+++.|.++ +++.+.||+
T Consensus        87 ~~~Wr~~~~~~~lp~plrD~~Y~~~A~nRyrwfGr~~~~~~~-~~~~~~r~~  137 (137)
T COG3011          87 PGPWRLLVWLWILPRPLRDRVYDFFADNRYRWFGRKDQCELP-PPRERQRFL  137 (137)
T ss_pred             CcceeeeehhhccchHHHHHHHHHHHHhhhhhcCcccccccC-CHHHhhhcC
Confidence            999998888889999999999999999999999999999997 578899985

>PF04134 DUF393: Protein of unknown function, DUF393; InterPro: IPR007263 The DCC family, named after the conserved N-terminal DxxCxxC motif, encompasses COG3011 from COG	Back alignment and domain information

>TIGR02180 GRX_euk Glutaredoxin	Back alignment and domain information

>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>PF13728 TraF: F plasmid transfer operon protein	Back alignment and domain information

>TIGR02190 GlrX-dom Glutaredoxin-family domain	Back alignment and domain information

>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins	Back alignment and domain information

>COG3019 Predicted metal-binding protein [General function prediction only]	Back alignment and domain information

>PRK10638 glutaredoxin 3; Provisional	Back alignment and domain information

>PRK11200 grxA glutaredoxin 1; Provisional	Back alignment and domain information

>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A	Back alignment and domain information

>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions	Back alignment and domain information

>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF	Back alignment and domain information

>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants	Back alignment and domain information

>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)	Back alignment and domain information

>PRK13703 conjugal pilus assembly protein TraF; Provisional	Back alignment and domain information

>TIGR02183 GRXA Glutaredoxin, GrxA family	Back alignment and domain information

>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria	Back alignment and domain information

>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2	Back alignment and domain information

>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants	Back alignment and domain information

>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs	Back alignment and domain information

>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains	Back alignment and domain information

>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1	Back alignment and domain information

>TIGR02740 TraF-like TraF-like protein	Back alignment and domain information

>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins	Back alignment and domain information

>PHA03050 glutaredoxin; Provisional	Back alignment and domain information

>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold	Back alignment and domain information

>TIGR01126 pdi_dom protein disulfide-isomerase domain	Back alignment and domain information

>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional	Back alignment and domain information

>PTZ00051 thioredoxin; Provisional	Back alignment and domain information

>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E	Back alignment and domain information

>TIGR02181 GRX_bact Glutaredoxin, GrxC family	Back alignment and domain information

>TIGR02200 GlrX_actino Glutaredoxin-like protein	Back alignment and domain information

>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins	Back alignment and domain information

>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti	Back alignment and domain information

>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms	Back alignment and domain information

>TIGR00365 monothiol glutaredoxin, Grx4 family	Back alignment and domain information

>PRK10877 protein disulfide isomerase II DsbC; Provisional	Back alignment and domain information

>TIGR02189 GlrX-like_plant Glutaredoxin-like family	Back alignment and domain information

>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB	Back alignment and domain information

>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		210
2klx_A		89	Glutaredoxin; thioredoxin type domain, ssgcid, ele	95.9
3msz_A		89	Glutaredoxin 1; alpha-beta sandwich, center for st	95.81
1fov_A		82	Glutaredoxin 3, GRX3; active site disulfide, CIS P	95.06
2khp_A		92	Glutaredoxin; thioredoxin type domain, ssgcid, ele	94.94
3hxs_A		141	Thioredoxin, TRXP; electron transport; 2.00A {Bact	92.97
1lu4_A		136	Soluble secreted antigen MPT53; thioredoxin-like f	92.9
3qmx_A		99	Glutaredoxin A, glutaredoxin 3; electron transport	92.87
2l57_A		126	Uncharacterized protein; structural genomics, unkn	92.84
2lrn_A		152	Thiol:disulfide interchange protein; structural ge	92.4
1wik_A		109	Thioredoxin-like protein 2; picot homology 2 domai	91.97
1zzo_A		136	RV1677; thioredoxin fold, structural genomics, PSI	91.92
1nho_A		85	Probable thioredoxin; beta sheet, alpha helix, oxi	91.65
1aba_A		87	Glutaredoxin; electron transport; HET: MES; 1.45A	91.64
3erw_A		145	Sporulation thiol-disulfide oxidoreductase A; thio	91.56
1kng_A		156	Thiol:disulfide interchange protein CYCY; thioredo	91.52
3fkf_A		148	Thiol-disulfide oxidoreductase; structural genomic	91.34
1fo5_A		85	Thioredoxin; disulfide oxidoreductase, structural	91.21
1thx_A		115	Thioredoxin, thioredoxin 2; oxido-reductase, elect	91.21
2b5x_A		148	YKUV protein, TRXY; thioredoxin-like, oxidoreducta	91.12
3ha9_A		165	Uncharacterized thioredoxin-like protein; PSI, MCS	91.06
2l5l_A		136	Thioredoxin; structural genomics, electron transpo	90.69
1w4v_A		119	Thioredoxin, mitochondrial; antioxidant enzyme, mi	90.62
2lja_A		152	Putative thiol-disulfide oxidoreductase; structura	90.56
3fk8_A		133	Disulphide isomerase; APC61824.1, xylella fastidio	90.47
3hdc_A		158	Thioredoxin family protein; ATCC53774, DSM 7210, ,	90.47
1nsw_A		105	Thioredoxin, TRX; thermostability, electron transp	90.45
2trx_A		108	Thioredoxin; electron transport; 1.68A {Escherichi	90.45
1kte_A		105	Thioltransferase; redox-active center, electron tr	90.39
2cq9_A		130	GLRX2 protein, glutaredoxin 2; glutathione-S-trans	90.37
2yan_A		105	Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H	90.23
1nm3_A		241	Protein HI0572; hybrid, peroxiredoxin, glutaredoxi	90.11
3die_A		106	Thioredoxin, TRX; electron transport, SWAP domain,	90.08
2f9s_A		151	Thiol-disulfide oxidoreductase RESA; thioredoxin-l	90.08
3tco_A		109	Thioredoxin (TRXA-1); disulfide oxidoreductase, ox	89.79
2i4a_A		107	Thioredoxin; acidophIle, disulfide exchange, oxido	89.67
3or5_A		165	Thiol:disulfide interchange protein, thioredoxin p	89.43
2e7p_A		116	Glutaredoxin; thioredoxin fold, poplar, electron t	89.43
2l6c_A		110	Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu	89.39
3c1r_A		118	Glutaredoxin-1; oxidized form, oxidoreductase, cyt	89.3
3cxg_A		133	Putative thioredoxin; malaria, structural GEN oxid	89.27
1ego_A		85	Glutaredoxin; electron transport; NMR {Escherichia	89.19
3rhb_A		113	ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox	89.15
3ipz_A		109	Monothiol glutaredoxin-S14, chloroplastic; electro	89.01
3uvt_A		111	Thioredoxin domain-containing protein 5; thioredox	88.77
3gx8_A		121	Monothiol glutaredoxin-5, mitochondrial; TRX fold,	88.65
2yzu_A		109	Thioredoxin; redox protein, electron transport, st	88.55
4glt_A		225	Glutathione S-transferase-like protein; structural	88.37
3ia1_A		154	THIO-disulfide isomerase/thioredoxin; oxidoreducta	88.2
3f3q_A		109	Thioredoxin-1; His TAG, electron transport, cytopl	88.18
2i1u_A		121	Thioredoxin, TRX, MPT46; redox protein, electron t	88.11
2e0q_A		104	Thioredoxin; electron transport; 1.49A {Sulfolobus	88.1
3ctg_A		129	Glutaredoxin-2; reduced form, electron transport,	87.94
2b1k_A		168	Thiol:disulfide interchange protein DSBE; C-termin	87.83
1t1v_A		93	SH3BGRL3, SH3 domain-binding glutamic acid-rich pr	87.82
3h8q_A		114	Thioredoxin reductase 3; oxidoreductase, structura	87.82
3kcm_A		154	Thioredoxin family protein; SGX, thioredoxin prote	87.76
2ct6_A		111	SH3 domain-binding glutamic acid-rich-like protein	87.47
2lrt_A		152	Uncharacterized protein; structural genomics, thio	87.35
2ht9_A		146	Glutaredoxin-2; thioredoxin fold, iron-sulfur clus	87.34
1wjk_A		100	C330018D20RIK protein; glutaredoxin, thioredoxin f	87.33
3hcz_A		148	Possible thiol-disulfide isomerase; APC61559.2, cy	87.16
2k8s_A		80	Thioredoxin; dimer, structural genomics, PSI-2, pr	87.15
2wz9_A		153	Glutaredoxin-3; protein binding; 1.55A {Homo sapie	87.15
3gl3_A		152	Putative thiol:disulfide interchange protein DSBE;	87.1
3m9j_A		105	Thioredoxin; oxidoreductase; 1.10A {Homo sapiens}	86.91
2lqo_A		92	Putative glutaredoxin RV3198.1/MT3292; TRX fold, o	86.87
1dby_A		107	Chloroplast thioredoxin M CH2; thioredoxin CH2, ch	86.77
2voc_A		112	Thioredoxin; electron transport, homodimer, disulf	86.73
1fb6_A		105	Thioredoxin M; electron transport; 2.10A {Spinacia	86.55
2xc2_A		117	Thioredoxinn; oxidoreductase, protein disulfide re	86.5
1jfu_A		186	Thiol:disulfide interchange protein TLPA; thioredo	86.46
1x5d_A		133	Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC	86.37
2fwh_A		134	Thiol:disulfide interchange protein DSBD; thioredo	86.13
2hze_A		114	Glutaredoxin-1; thioredoxin fold, arsenic, dimethy	86.07
2l5o_A		153	Putative thioredoxin; structural genomics, unknown	86.05
1t00_A		112	Thioredoxin, TRX; redox regulation, multifunction	85.95
3ewl_A		142	Uncharacterized conserved protein BF1870; alpha-be	85.61
2oe3_A		114	Thioredoxin-3; electron transport, alpha/beta sand	85.5
3drn_A		161	Peroxiredoxin, bacterioferritin comigratory prote	85.37
3d6i_A		112	Monothiol glutaredoxin-3; thioredoxin-like, electr	85.07
4evm_A		138	Thioredoxin family protein; structural genomics, n	85.07
3ul3_B		128	Thioredoxin, thioredoxin-2; PTEX, oxidoreductase;	84.98
4hi7_A		228	GI20122; GST, glutathione S-transferase, enzyme fu	84.76
3zyw_A		111	Glutaredoxin-3; metal binding protein; 1.84A {Homo	84.73
3raz_A		151	Thioredoxin-related protein; structural genomics,	84.63
3s9f_A		165	Tryparedoxin; thioredoxin fold, disulfide reductas	84.4
2vm1_A		118	Thioredoxin, thioredoxin H isoform 1.; oxidoreduct	84.38
2cvb_A		188	Probable thiol-disulfide isomerase/thioredoxin; re	84.37
1h75_A		81	Glutaredoxin-like protein NRDH; electron transport	84.37
1xwb_A		106	Thioredoxin; dimerization, redox regulation, THI X	84.34
3kh7_A		176	Thiol:disulfide interchange protein DSBE; TRX-like	84.33
3fw2_A		150	Thiol-disulfide oxidoreductase; structural genomic	84.17
3gnj_A		111	Thioredoxin domain protein; APC92103, STR genomics	84.0
2ywi_A		196	Hypothetical conserved protein; uncharacterized co	83.99
2o8v_B		128	Thioredoxin 1; disulfide crosslinked complex, oxid	83.78
1xfl_A		124	Thioredoxin H1; AT3G51030, structural genomics, pr	83.66
3eur_A		142	Uncharacterized protein; PSI2,MCSG, conserved prot	83.59
1ep7_A		112	Thioredoxin CH1, H-type; electron transport; 2.10A	83.45
3d22_A		139	TRXH4, thioredoxin H-type; electron transport, cyt	83.39
1o73_A		144	Tryparedoxin; electron transport, trypanosomatid,	83.34
1i5g_A		144	Tryparedoxin II; electron transport; HET: TS5; 1.4	83.18
3qav_A		243	RHO-class glutathione S-transferase; cytosol; 2.10	83.15
2ppt_A		155	Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc	83.14
2wem_A		118	Glutaredoxin-related protein 5; chromosome 14 open	83.14
2dml_A		130	Protein disulfide-isomerase A6; thioredoxin domain	83.1
1xvw_A		160	Hypothetical protein RV2238C/MT2298; thioredoxin f	83.08
3gv1_A		147	Disulfide interchange protein; neisseria gonorrhoe	82.96
1v98_A		140	Thioredoxin; oxidoreductase, structural genomics,	82.86
1v58_A		241	Thiol:disulfide interchange protein DSBG; reduced	82.84
3qfa_C		116	Thioredoxin; protein-protein complex, rossmann fol	82.74
3h79_A		127	Thioredoxin-like protein; thioredoxin fold, cataly	82.71
2kuc_A		130	Putative disulphide-isomerase; structural genomics	82.69
2vim_A		104	Thioredoxin, TRX; thioredoxin fold, oxidoreductase	82.51
1syr_A		112	Thioredoxin; SGPP, structural genomics, PSI, prote	82.3
2vlu_A		122	Thioredoxin, thioredoxin H isoform 2.; oxidoreduct	82.28
4g10_A		265	Glutathione S-transferase homolog; thioredoxin fol	82.07
1o8x_A		146	Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot	82.0
3gyk_A		175	27KDA outer membrane protein; APC61738.2, siliciba	81.88
3p2a_A		148	Thioredoxin 2, putative thioredoxin-like protein;	81.74
3emx_A		135	Thioredoxin; structural genomics, oxidoreductase,	81.72
4fo5_A		143	Thioredoxin-like protein; AHPC/TSA family protein,	81.55
1ti3_A		113	Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul	81.49
1r7h_A		75	NRDH-redoxin; thioredoxin, glutaredoxin, redox pro	81.28
1z6m_A		175	Conserved hypothetical protein; structural genomic	81.25
3tdg_A		273	DSBG, putative uncharacterized protein; thioredoxi	80.77
3aps_A		122	DNAJ homolog subfamily C member 10; thioredoxin fo	80.62
1gh2_A		107	Thioredoxin-like protein; redox-active center, ele	80.11

>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae}	Back alignment and structure

Probab=95.90  E-value=0.029  Score=38.91  Aligned_cols=74  Identities=7%  Similarity=0.023  Sum_probs=48.1

Q ss_pred             CCCCeEEEEcCCCcccHHHHHHHHhhcCCCcEEEEeCCCccchhHHHhc-CCCHHHhhccEEEEECCCeEEEcHHHHHHH
Q 028306           67 LLQPGVVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLC-GLDREDVLRRFLFVEGPGLYHQASTAALKV  145 (210)
Q Consensus        67 ~~~~~~V~YDG~CplC~~~v~~L~~~d~~~~i~f~~iqs~~~~~~L~~~-gi~~e~~~~~l~vv~~~G~~y~GsdAvl~i  145 (210)
                      .+++.++|+-..||.|.+...+|....  -.+..+++......++.+.. |+.      ++=.+.-+|+.+.|++++..+
T Consensus         4 mm~~v~~y~~~~C~~C~~~~~~L~~~~--i~~~~vdv~~~~~~~l~~~~~~~~------~vP~l~~~g~~i~g~~~i~~~   75 (89)
T 2klx_A            4 SMKEIILYTRPNCPYCKRARDLLDKKG--VKYTDIDASTSLRQEMVQRANGRN------TFPQIFIGDYHVGGCDDLYAL   75 (89)
T ss_dssp             CCCCEEEESCSCCTTTHHHHHHHHHHT--CCEEEECSCHHHHHHHHHHHHSSC------CSCEEEETTEECCSHHHHHHH
T ss_pred             CcceEEEEECCCChhHHHHHHHHHHcC--CCcEEEECCHHHHHHHHHHhCCCC------CcCEEEECCEEEeChHHHHHH
Confidence            345788888899999999999998764  36778888711122333333 321      221112268999999998876


Q ss_pred             HHh
Q 028306          146 LSH  148 (210)
Q Consensus       146 l~~  148 (210)
                      ...
T Consensus        76 ~~~   78 (89)
T 2klx_A           76 ENK   78 (89)
T ss_dssp             HHH
T ss_pred             HHc
Confidence            544

PyMOL of 2klx

>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A*	Back alignment and structure

>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A*	Back alignment and structure

>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis}	Back alignment and structure

>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A	Back alignment and structure

>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10	Back alignment and structure

>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0	Back alignment and structure

>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens}	Back alignment and structure

>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP}	Back alignment and structure

>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1	Back alignment and structure

>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A	Back alignment and structure

>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1	Back alignment and structure

>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A	Back alignment and structure

>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0	Back alignment and structure

>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10	Back alignment and structure

>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis}	Back alignment and structure

>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1	Back alignment and structure

>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1	Back alignment and structure

>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A	Back alignment and structure

>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix}	Back alignment and structure

>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus}	Back alignment and structure

>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A	Back alignment and structure

>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus}	Back alignment and structure

>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa}	Back alignment and structure

>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15}	Back alignment and structure

>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A	Back alignment and structure

>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ...	Back alignment and structure

>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A*	Back alignment and structure

>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens}	Back alignment and structure

>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10	Back alignment and structure

>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A	Back alignment and structure

>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A	Back alignment and structure

>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0	Back alignment and structure

>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti}	Back alignment and structure

>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0	Back alignment and structure

>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A	Back alignment and structure

>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A	Back alignment and structure

>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A*	Back alignment and structure

>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum}	Back alignment and structure

>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A	Back alignment and structure

>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A*	Back alignment and structure

>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A	Back alignment and structure

>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A	Back alignment and structure

>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae}	Back alignment and structure

>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A	Back alignment and structure

>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus}	Back alignment and structure

>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus}	Back alignment and structure

>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B	Back alignment and structure

>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A	Back alignment and structure

>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A	Back alignment and structure

>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A*	Back alignment and structure

>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A	Back alignment and structure

>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A	Back alignment and structure

>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0	Back alignment and structure

>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15}	Back alignment and structure

>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus}	Back alignment and structure

>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A*	Back alignment and structure

>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1	Back alignment and structure

>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii}	Back alignment and structure

>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea}	Back alignment and structure

>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A	Back alignment and structure

>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls}	Back alignment and structure

>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ...	Back alignment and structure

>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis}	Back alignment and structure

>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1	Back alignment and structure

>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A	Back alignment and structure

>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C	Back alignment and structure

>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A	Back alignment and structure

>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10	Back alignment and structure

>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A	Back alignment and structure

>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B	Back alignment and structure

>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B}	Back alignment and structure

>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor}	Back alignment and structure

>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis}	Back alignment and structure

>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A	Back alignment and structure

>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0	Back alignment and structure

>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae}	Back alignment and structure

>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae}	Back alignment and structure

>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum}	Back alignment and structure

>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis}	Back alignment and structure

>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens}	Back alignment and structure

>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B}	Back alignment and structure

>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major}	Back alignment and structure

>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A	Back alignment and structure

>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A	Back alignment and structure

>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1	Back alignment and structure

>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A	Back alignment and structure

>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A	Back alignment and structure

>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0	Back alignment and structure

>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus}	Back alignment and structure

>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli}	Back alignment and structure

>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1	Back alignment and structure

>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis}	Back alignment and structure

>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A	Back alignment and structure

>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A	Back alignment and structure

>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10	Back alignment and structure

>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A	Back alignment and structure

>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A*	Back alignment and structure

>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus}	Back alignment and structure

>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A	Back alignment and structure

>3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae}	Back alignment and structure

>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus}	Back alignment and structure

>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A	Back alignment and structure

>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C*	Back alignment and structure

>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0	Back alignment and structure

>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron}	Back alignment and structure

>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica}	Back alignment and structure

>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1	Back alignment and structure

>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A*	Back alignment and structure

>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis}	Back alignment and structure

>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A	Back alignment and structure

>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi}	Back alignment and structure

>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis}	Back alignment and structure

>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix}	Back alignment and structure

>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis}	Back alignment and structure

>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1	Back alignment and structure

>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1	Back alignment and structure

>1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13	Back alignment and structure

>3tdg_A DSBG, putative uncharacterized protein; thioredoxin fold, reductase, oxidoreductase; HET: P6G; 2.10A {Helicobacter pylori}	Back alignment and structure

>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus}	Back alignment and structure

>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		210
d1g7oa2		75	Glutaredoxin 2 {Escherichia coli [TaxId: 562]}	93.19
d1eema2		98	Class omega GST {Human (Homo sapiens) [TaxId: 9606	92.77
d1wjka_		100	Thioredoxin-like structure containing protein C330	92.47
d1v2aa2		83	Class delta GST {Mosquito (Anopheles dirus b), iso	91.45
d1k0ma2		86	Chloride intracellular channel 1 (clic1) {Human (H	91.25
d1gwca2		83	Class tau GST {Aegilops tauschii, also known as Tr	90.61
d1v58a1		169	Thiol:disulfide interchange protein DsbG, C-termin	89.95
d1e6ba2		80	Class zeta GST {Mouse-ear cress (Arabidopsis thali	89.6
d1ljra2		79	Class theta GST {Human (Homo sapiens) [TaxId: 9606	87.0
d1t3ba1		150	Disulfide bond isomerase, DsbC, C-terminal domain	83.48
d1k0da2		92	Yeast prion protein ure2p, nitrogen regulation fra	83.15
d1eeja1		156	Disulfide bond isomerase, DsbC, C-terminal domain	83.14
d1hyua4		96	Alkyl hydroperoxide reductase subunit F (AhpF), N-	82.79
d1axda2		80	Class phi GST {Maize (Zea mays), type I [TaxId: 45	82.51
d1fova_		82	Glutaredoxin (Grx, thioltransferase) {Escherichia	82.36
d1abaa_		87	Glutaredoxin (Grx, thioltransferase) {Bacteriophag	81.62
d1nm3a1		74	C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus	81.57
d1thxa_		108	Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]}	81.45
d1a8la2		107	Protein disulfide isomerase, PDI {Archaeon Pyrococ	81.37
d1r5aa2		85	Class delta GST {Mosquito (Anopheles dirus b), iso	81.23
d1nhoa_		85	MTH807, thioredoxin/glutaredoxin-like protein {Arc	81.22
d1wika_		109	Thioredoxin-like protein 2 {Mouse (Mus musculus) [	81.07
d1h75a_		76	Glutaredoxin-like NRDH-redoxin {Escherichia coli [	80.72

>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione S-transferase (GST), N-terminal domain
domain: Glutaredoxin 2
species: Escherichia coli [TaxId: 562]

Probab=93.19  E-value=0.21  Score=32.70  Aligned_cols=70  Identities=14%  Similarity=0.185  Sum_probs=46.4

Q ss_pred             EEEEcCCCcccHHHHHHHHhhcCCCcEEEEeCCCccchhHHHhcCCCHHHhhccE-EEEECCCeEEEcHHHHHHHHHhC
Q 028306           72 VVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRF-LFVEGPGLYHQASTAALKVLSHL  149 (210)
Q Consensus        72 ~V~YDG~CplC~~~v~~L~~~d~~~~i~f~~iqs~~~~~~L~~~gi~~e~~~~~l-~vv~~~G~~y~GsdAvl~il~~L  149 (210)
                      .+|+-..||+|.+....|...+..-.+  ..+.....+.+++..+      ...+ ++++++|++...|.+++.-+..+
T Consensus         2 kLY~~~~cP~~~rvr~~l~~kgi~~e~--~~~~~~~~~~~~~~~p------~~~VP~L~~~dg~~i~eS~~I~~yLd~~   72 (75)
T d1g7oa2           2 KLYIYDHCPYCLKARMIFGLKNIPVEL--HVLLNDDAETPTRMVG------QKQVPILQKDDSRYMPESMDIVHYVDKL   72 (75)
T ss_dssp             EEEECTTCHHHHHHHHHHHHHTCCCEE--EECCTTTTHHHHHHHS------SSCCCEEEETTTEEEECHHHHHHHHHHH
T ss_pred             EEEccCCCCchHHHHHHHHHhCCCccc--ccccccchHHHHHhCC------CCceEEEEEcCCCEEecHHHHHHHHHHh
Confidence            578888999999988888877764444  4443333333333322      1334 34567899999999999876654

PyMOL of d1g7oa2

>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]}	Back information, alignment and structure

>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]}	Back information, alignment and structure

>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]}	Back information, alignment and structure

>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]}	Back information, alignment and structure

>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]}	Back information, alignment and structure

>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]}	Back information, alignment and structure

>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]}	Back information, alignment and structure