Citrus Sinensis ID: 028376


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210
MTEEVVTISNSTKHRIESLSKADEETCPICQEKLGNQKMVFQCGHFTCCKCFFAMTEQRLIHDNKVKNEWVMCPTCRQRTDIGNIAYADDRQDKSCNSDMPHGVQDCEKGEESFTVQGSYGTKIEAVTRRILWIKSTDPKAKILVFSSWNDVLDVLEHAFIANNITCIKMKGENHKLPSANLQHRNALQKELTRHMPSSQSQSLFKCYYS
ccHHHHcccHHHHHHHHHccccccccccccccccccccEEccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHcccccEEEEEcccccccccEEEcc
cccEEEEEccHHHHccccccccccccccEEcccccccEEEEccccHHHHHHHHHHHHHHHHccccccccccEcccEccEcccccEEEEccccccccccccccHccccccHHcccEEcccccHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHccccccEEEEEcccccccccccEEEEcc
MTEEVVTISNSTKHRIESlskadeetcpicqeklgnqkmvfqcghftcckcffaMTEQRLIhdnkvknewvmcptcrqrtdigniayaddrqdkscnsdmphgvqdcekgeesftvqgsygtkIEAVTRRILWIkstdpkakILVFSSWNDVLDVLEHAFIANNITCIkmkgenhklpsanlQHRNALQKELtrhmpssqsqslfkcyys
mteevvtisnstkhrieslskadeETCPICQEKLGNQKMVFQCGHFTCCKCFFAMTEQRLIHDNKVKNEWVMCPTCRQRTDIGNIAYADDRQDKSCNSDMPHGVQDCEKGEESftvqgsygtkieaVTRRILWIKSTDPKAKILVFSSWNDVLDVLEHAFIANNITCIKMKGENHKLPSANLQHRNALQKELtrhmpssqsqslfkcyys
MTEEVVTISNSTKHRIESLSKADEETCPICQEKLGNQKMVFQCGHFTCCKCFFAMTEQRLIHDNKVKNEWVMCPTCRQRTDIGNIAYADDRQDKSCNSDMPHGVQDCEKGEESFTVQGSYGTKIEAVTRRILWIKSTDPKAKILVFSSWNDVLDVLEHAFIANNITCIKMKGENHKLPSANLQHRNALQKELTRHMPSSQSQSLFKCYYS
**************************CPICQEKLGNQKMVFQCGHFTCCKCFFAMTEQRLIHDNKVKNEWVMCPTCRQRTDIGNIAYA*************************FTVQGSYGTKIEAVTRRILWIKSTDPKAKILVFSSWNDVLDVLEHAFIANNITCIKMK***************************************
****V*********************CPICQEKLGNQKMVFQCGHFTCCKCFFAMTEQR************MCPTCRQRTDIGNIA*****************************VQGSYGTKIEAVTRRILWIKSTDPKAKILVFSSWNDVLDVLEHAFIANNITCIKMKGE*************ALQKELTRHMPSSQSQSLFKCYY*
**********************DEETCPICQEKLGNQKMVFQCGHFTCCKCFFAMTEQRLIHDNKVKNEWVMCPTCRQRTDIGNIAYADDRQDKSCNSDMPHGVQDCEKGEESFTVQGSYGTKIEAVTRRILWIKSTDPKAKILVFSSWNDVLDVLEHAFIANNITCIKMKGENHKLPSANLQHRNALQKE*******************
MTEEVVTISNSTKHR********EETCPICQEKLGNQKMVFQCGHFTCCKCFFAMTEQRLIHDNKVKNEWVMCPTCRQRTDIGNIAYADDRQ*****SDMPHGVQDCEKGEESFTVQGSYGTKIEAVTRRILWIKSTDPKAKILVFSSWNDVLDVLEHAFIANNITCIKMKGENHKLPSANLQHRNALQKELTRHMPSSQSQSLFKCYYS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTEEVVTISNSTKHRIESLSKADEETCPICQEKLGNQKMVFQCGHFTCCKCFFAMTEQRLIHDNKVKNEWVMCPTCRQRTDIGNIAYADDRQDKSCNSDMPHGVQDCEKGEESFTVQGSYGTKIEAVTRRILWIKSTDPKAKILVFSSWNDVLDVLEHAFIANNITCIKMKGENHKLPSANLQHRNALQKELTRHMPSSQSQSLFKCYYS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query210 2.2.26 [Sep-21-2011]
Q149N81683 E3 ubiquitin-protein liga yes no 0.690 0.086 0.327 2e-19
Q7TPQ31674 E3 ubiquitin-protein liga yes no 0.690 0.086 0.320 9e-19
Q9UTL9 1375 Uncharacterized ATP-depen yes no 0.852 0.130 0.258 3e-12
Q4IJ841154 DNA repair protein RAD5 O yes no 0.742 0.135 0.262 2e-05
P0CQ671198 DNA repair protein RAD5 O N/A no 0.709 0.124 0.263 4e-05
P0CQ661198 DNA repair protein RAD5 O no no 0.809 0.141 0.260 7e-05
Q7S1P91222 DNA repair protein rad-5 N/A no 0.761 0.130 0.234 0.0006
>sp|Q149N8|SHPRH_HUMAN E3 ubiquitin-protein ligase SHPRH OS=Homo sapiens GN=SHPRH PE=1 SV=2 Back     alignment and function desciption
 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 83/162 (51%), Gaps = 17/162 (10%)

Query: 4    EVVTISNSTKHRIESLSKADEETCPICQEKLGNQKMVFQCGHFTCCKCFFAMTEQRLIHD 63
            +++ ++N  K + ++    + E CPIC  +LG Q  V  CGH  C +C   + EQ  +  
Sbjct: 1409 QLLYLTNLEKSQDKTSGGVNPEPCPICARQLGKQWAVLTCGHCFCNECISIIIEQYSVGS 1468

Query: 64   NKVKNEWVMCPTCRQRTDIGNIAYADDRQDKSCNSDMPHGVQDCEKGEESFTVQGSYGTK 123
            ++     + C  CRQ T    I+Y    +  +   D+P              V+GS+ TK
Sbjct: 1469 HRSS---IKCAICRQTTSHKEISYVFTSEKANQEEDIP--------------VKGSHSTK 1511

Query: 124  IEAVTRRILWIKSTDPKAKILVFSSWNDVLDVLEHAFIANNI 165
            +EAV R ++ I+  DP AK LVFS+W DVLD++  A   NN+
Sbjct: 1512 VEAVVRTLMKIQLRDPGAKALVFSTWQDVLDIISKALTDNNM 1553




E3 ubiquitin-protein ligase involved in DNA repair. Upon genotoxic stress, accepts ubiquitin from the UBE2N-UBE2V2 E2 complex and transfers it to 'Lys-164' of PCNA which had been monoubiquitinated by UBE2A/B-RAD18, promoting the formation of non-canonical poly-ubiquitin chains linked through 'Lys-63'.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q7TPQ3|SHPRH_MOUSE E3 ubiquitin-protein ligase SHPRH OS=Mus musculus GN=Shprh PE=1 SV=1 Back     alignment and function description
>sp|Q9UTL9|YIV5_SCHPO Uncharacterized ATP-dependent helicase C144.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.05 PE=3 SV=1 Back     alignment and function description
>sp|Q4IJ84|RAD5_GIBZE DNA repair protein RAD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAD5 PE=3 SV=1 Back     alignment and function description
>sp|P0CQ67|RAD5_CRYNB DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAD5 PE=3 SV=1 Back     alignment and function description
>sp|P0CQ66|RAD5_CRYNJ DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAD5 PE=3 SV=1 Back     alignment and function description
>sp|Q7S1P9|RAD5_NEUCR DNA repair protein rad-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rad-5 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query210
224127896169 SW2/SNF2 family-like protein [Populus tr 0.795 0.988 0.708 2e-65
255559737 1588 snf2 histone linker phd ring helicase, p 0.876 0.115 0.654 1e-64
359486454 1704 PREDICTED: E3 ubiquitin-protein ligase S 0.819 0.100 0.649 7e-63
297736470 1717 unnamed protein product [Vitis vinifera] 0.819 0.100 0.649 8e-63
147860973 2416 hypothetical protein VITISV_013126 [Viti 0.819 0.071 0.649 1e-62
356500801 1600 PREDICTED: E3 ubiquitin-protein ligase S 0.809 0.106 0.668 2e-61
449499151 1520 PREDICTED: LOW QUALITY PROTEIN: E3 ubiqu 0.804 0.111 0.645 1e-59
449441236 1520 PREDICTED: E3 ubiquitin-protein ligase S 0.804 0.111 0.645 1e-59
297827713 1635 SNF2 domain-containing protein [Arabidop 0.761 0.097 0.639 2e-55
240254615 1664 RING-finger, DEAD-like helicase, PHD and 0.761 0.096 0.639 3e-55
>gi|224127896|ref|XP_002329204.1| SW2/SNF2 family-like protein [Populus trichocarpa] gi|222870985|gb|EEF08116.1| SW2/SNF2 family-like protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  254 bits (649), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 119/168 (70%), Positives = 136/168 (80%), Gaps = 1/168 (0%)

Query: 5   VVTISNSTKHRIESLSKADEETCPICQEKLGNQKMVFQCGHFTCCKCFFAMTEQRLIHDN 64
           +  +  +T+   E L K DEE CPICQEKL NQKMVF CGH TCCKCFFAMTE+++ HDN
Sbjct: 1   MAAVPMTTEKISEYLPKDDEEACPICQEKLNNQKMVFPCGHVTCCKCFFAMTERKM-HDN 59

Query: 65  KVKNEWVMCPTCRQRTDIGNIAYADDRQDKSCNSDMPHGVQDCEKGEESFTVQGSYGTKI 124
           + + +WVMCPTCRQ TD GNIAYADDR+DKSC+S M   +Q CEK E S  VQGSYGTK+
Sbjct: 60  RFQRKWVMCPTCRQHTDFGNIAYADDRRDKSCSSAMLDAIQGCEKTEASLAVQGSYGTKV 119

Query: 125 EAVTRRILWIKSTDPKAKILVFSSWNDVLDVLEHAFIANNITCIKMKG 172
           EAVTRRILWIKS+DPKAK+LVFSSWNDVLDVLEHA  AN IT I+MKG
Sbjct: 120 EAVTRRILWIKSSDPKAKVLVFSSWNDVLDVLEHALNANEITYIRMKG 167




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255559737|ref|XP_002520888.1| snf2 histone linker phd ring helicase, putative [Ricinus communis] gi|223540019|gb|EEF41597.1| snf2 histone linker phd ring helicase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359486454|ref|XP_003633446.1| PREDICTED: E3 ubiquitin-protein ligase SHPRH-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297736470|emb|CBI25341.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147860973|emb|CAN82939.1| hypothetical protein VITISV_013126 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356500801|ref|XP_003519219.1| PREDICTED: E3 ubiquitin-protein ligase SHPRH-like [Glycine max] Back     alignment and taxonomy information
>gi|449499151|ref|XP_004160739.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase SHPRH-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449441236|ref|XP_004138388.1| PREDICTED: E3 ubiquitin-protein ligase SHPRH-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297827713|ref|XP_002881739.1| SNF2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297327578|gb|EFH57998.1| SNF2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|240254615|ref|NP_181609.4| RING-finger, DEAD-like helicase, PHD and SNF2 domain-containing protein [Arabidopsis thaliana] gi|330254782|gb|AEC09876.1| RING-finger, DEAD-like helicase, PHD and SNF2 domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query210
TAIR|locus:2064786 1664 AT2G40770 [Arabidopsis thalian 0.890 0.112 0.587 1.2e-52
POMBASE|SPAC144.05 1375 SPAC144.05 "ATP-dependent DNA 0.861 0.131 0.264 1.6e-12
UNIPROTKB|E1C5L61682 SHPRH "Uncharacterized protein 0.533 0.066 0.335 5.9e-10
UNIPROTKB|E1C6151682 SHPRH "Uncharacterized protein 0.533 0.066 0.335 5.9e-10
UNIPROTKB|E2R8G01685 SHPRH "Uncharacterized protein 0.5 0.062 0.347 9.6e-10
UNIPROTKB|F1S7361688 SHPRH "Uncharacterized protein 0.5 0.062 0.347 9.6e-10
UNIPROTKB|E1BLB11688 SHPRH "Uncharacterized protein 0.5 0.062 0.347 9.6e-10
MGI|MGI:19175811674 Shprh "SNF2 histone linker PHD 0.5 0.062 0.330 1.6e-09
RGD|13103421701 Shprh "SNF2 histone linker PHD 0.5 0.061 0.330 1.6e-09
UNIPROTKB|Q149N81683 SHPRH "E3 ubiquitin-protein li 0.5 0.062 0.338 4e-09
TAIR|locus:2064786 AT2G40770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 559 (201.8 bits), Expect = 1.2e-52, P = 1.2e-52
 Identities = 117/199 (58%), Positives = 141/199 (70%)

Query:     4 EVVTISNSTKHRIESLSKADEETCPICQEKLGNQKMVFQCGHFTCCKCFFAMTEQRLIHD 63
             E V  S+  +   E+L K DE  CPIC E L NQKMVFQCGH TCC CFFAMTE++ + +
Sbjct:  1322 ETVDASDPAEQESENLLKRDE-ACPICHEILRNQKMVFQCGHSTCCNCFFAMTERKSVQE 1380

Query:    64 NKVKNEWVMCPTCRQRTDIGNIAYADDRQDKSCNSDMPHGVQDCEKGEESFTVQGSYGTK 123
                K  WVMCP CRQ TD+ NIAYADDR++ S +SD     QD +  E S  VQGSYGTK
Sbjct:  1381 TLQK--WVMCPICRQHTDVRNIAYADDRRNSS-SSD-----QDHKDSEASLVVQGSYGTK 1432

Query:   124 IEAVTRRILWIKSTDPKAKILVFSSWNDVLDVLEHAFIANNITCIKMKGENHKLPSANLQ 183
             IEAVTRRILWIKS+DP+ K+LVFSSWNDVLDVLEHAF AN+ITCI+MKG   K  +A  +
Sbjct:  1433 IEAVTRRILWIKSSDPQTKVLVFSSWNDVLDVLEHAFAANSITCIRMKG-GRKSQTAISK 1491

Query:   184 HRNALQKELTRHMPSSQSQ 202
              + + +KE T+   S Q +
Sbjct:  1492 FKGS-EKE-TQKTNSHQKE 1508




GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
POMBASE|SPAC144.05 SPAC144.05 "ATP-dependent DNA helicase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|E1C5L6 SHPRH "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C615 SHPRH "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2R8G0 SHPRH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1S736 SHPRH "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BLB1 SHPRH "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1917581 Shprh "SNF2 histone linker PHD RING helicase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310342 Shprh "SNF2 histone linker PHD RING helicase, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q149N8 SHPRH "E3 ubiquitin-protein ligase SHPRH" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
CHR953
SW2/SNF2 family-like protein (169 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query210
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-05
cd0016245 cd00162, RING, RING-finger (Really Interesting New 4e-05
smart0018440 smart00184, RING, Ring finger 0.002
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
 Score = 40.2 bits (94), Expect = 2e-05
 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 11/56 (19%)

Query: 23 DEETCPICQEKLGNQKMVFQCGHFTCCKCFFAMTEQRLIHDNKVKNEWVMCPTCRQ 78
          +E  CPIC + L +  ++  CGH  C +C       R +           CP CR 
Sbjct: 1  EELECPICLDLLRDPVVLTPCGHVFCRECI-----LRYLKKKS------KCPICRT 45


Length = 45

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 210
KOG1002791 consensus Nucleotide excision repair protein RAD16 99.93
KOG1001674 consensus Helicase-like transcription factor HLTF/ 99.6
KOG0389 941 consensus SNF2 family DNA-dependent ATPase [Chroma 99.43
KOG0298 1394 consensus DEAD box-containing helicase-like transc 99.24
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.2
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.12
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.07
PHA02929238 N1R/p28-like protein; Provisional 99.07
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 99.06
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 99.02
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.01
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.01
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.01
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.98
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 98.96
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.92
PHA02926242 zinc finger-like protein; Provisional 98.91
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.89
PF1463444 zf-RING_5: zinc-RING finger domain 98.85
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.83
KOG0387 923 consensus Transcription-coupled repair protein CSB 98.83
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.79
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.7
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 98.7
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 98.67
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.62
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.61
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.52
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.52
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.51
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.51
KOG4439901 consensus RNA polymerase II transcription terminat 98.5
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.5
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.49
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.45
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.45
KOG0392 1549 consensus SNF2 family DNA-dependent ATPase domain- 98.44
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.42
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.39
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.35
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 98.34
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.26
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 98.22
KOG0390 776 consensus DNA repair protein, SNF2 family [Replica 98.18
KOG0383696 consensus Predicted helicase [General function pre 98.17
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 98.14
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 98.06
PRK04914 956 ATP-dependent helicase HepA; Validated 98.03
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.98
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.95
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.91
KOG1000 689 consensus Chromatin remodeling protein HARP/SMARCA 97.9
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.88
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 97.85
KOG1015 1567 consensus Transcription regulator XNP/ATRX, DEAD-b 97.85
PRK13766 773 Hef nuclease; Provisional 97.85
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 97.74
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.73
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 97.73
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 97.68
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.65
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 97.57
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 97.54
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.53
COG5152259 Uncharacterized conserved protein, contains RING a 97.49
KOG2660 331 consensus Locus-specific chromosome binding protei 97.39
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.35
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.35
KOG3039303 consensus Uncharacterized conserved protein [Funct 97.35
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 97.35
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.28
PF04641260 Rtf2: Rtf2 RING-finger 97.23
KOG4739233 consensus Uncharacterized protein involved in syna 97.17
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.12
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.12
KOG0331 519 consensus ATP-dependent RNA helicase [RNA processi 97.11
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 97.11
KOG149384 consensus Anaphase-promoting complex (APC), subuni 97.1
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 96.96
KOG0297 391 consensus TNF receptor-associated factor [Signal t 96.95
COG5175 480 MOT2 Transcriptional repressor [Transcription] 96.92
KOG0825 1134 consensus PHD Zn-finger protein [General function 96.9
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 96.89
PTZ00110 545 helicase; Provisional 96.81
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 96.81
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 96.77
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 96.77
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 96.73
COG52191525 Uncharacterized conserved protein, contains RING Z 96.73
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 96.7
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 96.63
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 96.57
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 96.57
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 96.55
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 96.5
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 96.24
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.24
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 96.2
COG5222427 Uncharacterized conserved protein, contains RING Z 96.17
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 96.16
PF10272358 Tmpp129: Putative transmembrane protein precursor; 96.16
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 96.1
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 96.09
PRK05298 652 excinuclease ABC subunit B; Provisional 96.03
KOG1941518 consensus Acetylcholine receptor-associated protei 96.03
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 96.03
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 95.98
KOG4445368 consensus Uncharacterized conserved protein, conta 95.95
KOG0334 997 consensus RNA helicase [RNA processing and modific 95.87
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 95.85
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 95.77
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 95.77
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 95.73
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 95.67
PHA02558501 uvsW UvsW helicase; Provisional 95.6
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 95.56
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 95.54
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 95.52
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 95.5
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 95.45
KOG3002299 consensus Zn finger protein [General function pred 95.24
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 95.21
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 95.18
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 95.16
KOG0330 476 consensus ATP-dependent RNA helicase [RNA processi 95.01
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 94.98
PTZ00424401 helicase 45; Provisional 94.84
PHA03096284 p28-like protein; Provisional 94.76
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 94.67
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 94.64
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 94.6
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 94.49
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 94.35
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 94.25
KOG0340 442 consensus ATP-dependent RNA helicase [RNA processi 94.19
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 94.17
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 94.15
smart0049082 HELICc helicase superfamily c-terminal domain. 93.98
PRK12904 830 preprotein translocase subunit SecA; Reviewed 93.95
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 93.89
KOG0339 731 consensus ATP-dependent RNA helicase [RNA processi 93.87
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 93.8
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 93.68
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 93.58
PRK13107 908 preprotein translocase subunit SecA; Reviewed 93.56
KOG4367 699 consensus Predicted Zn-finger protein [Function un 93.42
KOG0348 708 consensus ATP-dependent RNA helicase [RNA processi 93.42
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 93.39
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 93.38
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 93.31
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 93.26
KOG0354 746 consensus DEAD-box like helicase [General function 92.93
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 92.87
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 92.86
PRK09200 790 preprotein translocase subunit SecA; Reviewed 92.56
PHA02825162 LAP/PHD finger-like protein; Provisional 92.48
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 92.47
PF11496 297 HDA2-3: Class II histone deacetylase complex subun 92.39
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 92.06
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 92.04
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 91.9
PHA02862156 5L protein; Provisional 91.77
KOG0327397 consensus Translation initiation factor 4F, helica 91.75
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 91.48
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 91.37
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 90.9
KOG3113293 consensus Uncharacterized conserved protein [Funct 90.8
KOG0345 567 consensus ATP-dependent RNA helicase [RNA processi 90.52
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 90.23
KOG0342 543 consensus ATP-dependent RNA helicase pitchoune [RN 90.12
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 89.85
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 89.67
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 89.39
KOG3899381 consensus Uncharacterized conserved protein [Funct 89.12
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 88.89
KOG3039303 consensus Uncharacterized conserved protein [Funct 88.43
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 88.12
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 88.11
KOG1940276 consensus Zn-finger protein [General function pred 88.0
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 87.58
KOG0341 610 consensus DEAD-box protein abstrakt [RNA processin 87.5
COG5109396 Uncharacterized conserved protein, contains RING Z 87.43
KOG1123 776 consensus RNA polymerase II transcription initiati 87.41
PRK10689 1147 transcription-repair coupling factor; Provisional 86.33
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 86.28
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 85.82
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 85.03
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 84.73
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 84.1
KOG0338 691 consensus ATP-dependent RNA helicase [RNA processi 84.05
KOG0343 758 consensus RNA Helicase [RNA processing and modific 83.73
PF0797551 C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al 83.37
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 83.35
PRK13767 876 ATP-dependent helicase; Provisional 82.74
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 82.64
KOG0347 731 consensus RNA helicase [RNA processing and modific 82.57
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 82.2
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 81.98
KOG4284 980 consensus DEAD box protein [Transcription] 81.91
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 81.9
PLN02189 1040 cellulose synthase 80.98
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
Probab=99.93  E-value=1.6e-26  Score=197.71  Aligned_cols=156  Identities=23%  Similarity=0.381  Sum_probs=122.5

Q ss_pred             CccccccccccccCCCeecCCCCcchHhhHHHHHHHhhhccccCCCccccccCCcccccCCCeEEccCccccCCCCCCCC
Q 028376           23 DEETCPICQEKLGNQKMVFQCGHFTCCKCFFAMTEQRLIHDNKVKNEWVMCPTCRQRTDIGNIAYADDRQDKSCNSDMPH  102 (210)
Q Consensus        23 ~~~~C~iC~~~~~~~~~~~~CgH~fC~~C~~~~~~~~~~~~~~~~~~~~~CP~Cr~~~~~~~l~~~~~~~~~~~~~~~~~  102 (210)
                      +..+|.+|.++..+ ++.+.|.|.||.-|+.++++..+.      +....||+|...++.+.-.....       ...+.
T Consensus       535 ~~~~C~lc~d~aed-~i~s~ChH~FCrlCi~eyv~~f~~------~~nvtCP~C~i~LsiDlse~ale-------k~~l~  600 (791)
T KOG1002|consen  535 GEVECGLCHDPAED-YIESSCHHKFCRLCIKEYVESFME------NNNVTCPVCHIGLSIDLSEPALE-------KTDLK  600 (791)
T ss_pred             CceeecccCChhhh-hHhhhhhHHHHHHHHHHHHHhhhc------ccCCCCccccccccccccchhhh-------hcchh
Confidence            45689999999887 599999999999999999876542      44589999999887762111110       00111


Q ss_pred             CCCCcccccCCcee-cCCCCchHHHHHHHHHHHHhcCCCCcEEEEcchHHHHHHHHHHHHhCCceEEEeeCCCCCCcchh
Q 028376          103 GVQDCEKGEESFTV-QGSYGTKIEAVTRRILWIKSTDPKAKILVFSSWNDVLDVLEHAFIANNITCIKMKGENHKLPSAN  181 (210)
Q Consensus       103 ~~~~~~~~~~~~~~-~~~~SsKi~al~~~L~~~~~~~~~~K~iVFSQf~~~L~li~~~L~~~gi~~~~~~G~m~~~~~~~  181 (210)
                      +.+... ....+.+ .+..||||+||++.|..+++.+...|+|||||||+|||+|+..|.+.|+.++.++|+|.      
T Consensus       601 ~Fk~sS-IlnRinm~~~qsSTKIEAL~EEl~~l~~rd~t~KsIVFSQFTSmLDLi~~rL~kaGfscVkL~GsMs------  673 (791)
T KOG1002|consen  601 GFKASS-ILNRINMDDWQSSTKIEALVEELYFLRERDRTAKSIVFSQFTSMLDLIEWRLGKAGFSCVKLVGSMS------  673 (791)
T ss_pred             hhhhHH-HhhhcchhhhcchhHHHHHHHHHHHHHHcccchhhhhHHHHHHHHHHHHHHhhccCceEEEeccCCC------
Confidence            111100 0111221 56889999999999999999999999999999999999999999999999999999977      


Q ss_pred             hHhhhHHHHHHhhcCCCCC
Q 028376          182 LQHRNALQKELTRHMPSSQ  200 (210)
Q Consensus       182 ~~~R~~~l~~F~~~~p~~~  200 (210)
                      +++|.++|+.|.+ ||++.
T Consensus       674 ~~ardatik~F~n-d~~c~  691 (791)
T KOG1002|consen  674 PAARDATIKYFKN-DIDCR  691 (791)
T ss_pred             hHHHHHHHHHhcc-CCCeE
Confidence            9999999999998 88875



>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>PF11496 HDA2-3: Class II histone deacetylase complex subunits 2 and 3; InterPro: IPR021006 This entry contains the class II histone deacetylase complex subunits HDA2 and HDA3 is found in fungi Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>KOG3113 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query210
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 2e-05
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 3e-05
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 8e-05
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 4e-04
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 7e-04
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 7e-04
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
 Score = 41.2 bits (97), Expect = 2e-05
 Identities = 17/67 (25%), Positives = 29/67 (43%), Gaps = 11/67 (16%)

Query: 23 DEETCPICQEKLGNQK---MVFQCGHFTCCKCFFAMTEQRLIHDNKVKNEWVMCPTCRQR 79
          +   CPIC E    ++    +  CGH  C +C      ++L+  +      V CP C + 
Sbjct: 14 EVLECPICMESFTEEQLRPKLLHCGHTICRQCL-----EKLLASSING---VRCPFCSKI 65

Query: 80 TDIGNIA 86
          T I ++ 
Sbjct: 66 TRITSLT 72


>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query210
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.29
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.26
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.25
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.23
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.23
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.23
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.22
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.21
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.21
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.19
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.18
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.18
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.18
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.16
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.16
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.15
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.15
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.15
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.14
2ect_A78 Ring finger protein 126; metal binding protein, st 99.14
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.13
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.13
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.13
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.13
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.13
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.11
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.1
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.09
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.09
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.08
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.06
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.05
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.05
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.04
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.04
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.03
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.03
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.03
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.02
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.01
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.01
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.0
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.98
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.98
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.96
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.96
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.96
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.93
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.91
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.9
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.89
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.89
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.88
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.88
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.87
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.84
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 98.84
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.82
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.82
2ea5_A68 Cell growth regulator with ring finger domain prot 98.8
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.79
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.79
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.77
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.74
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 98.73
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.72
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.72
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.65
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.5
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 98.48
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 98.42
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.42
3hgt_A 328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 98.38
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.33
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.25
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 98.21
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 98.18
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 98.17
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.16
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 98.08
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 98.06
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 97.99
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.94
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 97.93
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 97.92
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 97.78
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 97.77
3eaq_A 212 Heat resistant RNA dependent ATPase; DEAD box RNA 97.76
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 97.71
4gl2_A 699 Interferon-induced helicase C domain-containing P; 97.58
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 96.7
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 97.44
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 97.4
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 97.23
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 97.08
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 97.04
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 96.97
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 96.9
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 96.89
3nw0_A238 Non-structural maintenance of chromosomes element 96.82
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 96.77
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 96.68
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 96.64
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 96.59
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 96.36
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 96.35
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 96.26
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 96.2
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 96.09
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 96.06
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 96.02
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.77
3h1t_A590 Type I site-specific restriction-modification syst 95.28
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 95.09
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 93.73
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 93.0
3jux_A 822 Protein translocase subunit SECA; protein transloc 92.98
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 92.82
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 92.65
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 92.08
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 92.04
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 91.95
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 91.43
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 90.33
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 89.53
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 88.94
2l82_A162 Designed protein OR32; structural genomics, northe 88.85
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 87.59
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 82.71
2jne_A101 Hypothetical protein YFGJ; zinc fingers, two zinc, 82.48
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 82.19
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 81.73
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 80.78
1z60_A59 TFIIH basal transcription factor complex P44 subun 80.39
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 80.18
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.29  E-value=2e-12  Score=83.17  Aligned_cols=53  Identities=23%  Similarity=0.514  Sum_probs=44.3

Q ss_pred             CCccccccccccccCCCeecCCCCcchHhhHHHHHHHhhhccccCCCccccccCCcccccCCCe
Q 028376           22 ADEETCPICQEKLGNQKMVFQCGHFTCCKCFFAMTEQRLIHDNKVKNEWVMCPTCRQRTDIGNI   85 (210)
Q Consensus        22 ~~~~~C~iC~~~~~~~~~~~~CgH~fC~~C~~~~~~~~~~~~~~~~~~~~~CP~Cr~~~~~~~l   85 (210)
                      .+...|+||.+.+.++ +.++|||.||..|+..|+.          .....||.||.++...++
T Consensus        13 ~~~~~C~IC~~~~~~p-~~~~CgH~fC~~Ci~~~~~----------~~~~~CP~Cr~~~~~~~i   65 (66)
T 2ecy_A           13 EDKYKCEKCHLVLCSP-KQTECGHRFCESCMAALLS----------SSSPKCTACQESIVKDKV   65 (66)
T ss_dssp             CCCEECTTTCCEESSC-CCCSSSCCCCHHHHHHHHT----------TSSCCCTTTCCCCCTTTC
T ss_pred             CcCCCCCCCChHhcCe-eECCCCCHHHHHHHHHHHH----------hCcCCCCCCCcCCChhhc
Confidence            3567899999999874 7799999999999999962          345689999999887765



>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2l82_A Designed protein OR32; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, de novo protein; NMR {Artificial gene} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 210
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 2e-04
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 0.001
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 0.003
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Immediate early protein, IEEHV
species: Equine herpesvirus 1 [TaxId: 10326]
 Score = 36.5 bits (84), Expect = 2e-04
 Identities = 16/54 (29%), Positives = 17/54 (31%), Gaps = 11/54 (20%)

Query: 25 ETCPICQEKLGNQKMVFQCGHFTCCKCFFAMTEQRLIHDNKVKNEWVMCPTCRQ 78
          E CPIC E   N  M   C H  C  C      Q              CP C+ 
Sbjct: 6  ERCPICLEDPSNYSMALPCLHAFCYVCITRWIRQN-----------PTCPLCKV 48


>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query210
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.32
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.29
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.29
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.26
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.26
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.25
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.22
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.2
d1z3ix1 346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.2
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.16
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.16
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.15
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.12
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.07
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.93
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.92
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.77
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.57
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 98.38
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 98.25
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 98.18
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 98.12
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 98.08
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 98.0
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 97.97
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 97.95
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 97.93
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 97.86
d1oywa3 200 RecQ helicase domain {Escherichia coli [TaxId: 562 97.8
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 95.53
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 94.47
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 92.55
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 92.07
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 91.37
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 90.01
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 89.09
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 88.35
d1nkta4 219 Translocation ATPase SecA, nucleotide-binding doma 87.73
d2jnea171 Hypothetical protein YfgJ {Escherichia coli [TaxId 87.17
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 86.26
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 80.26
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.36  E-value=2.3e-13  Score=89.24  Aligned_cols=51  Identities=29%  Similarity=0.607  Sum_probs=42.3

Q ss_pred             CccccccccccccCCCeecCCCCcchHhhHHHHHHHhhhccccCCCccccccCCcccccCCC
Q 028376           23 DEETCPICQEKLGNQKMVFQCGHFTCCKCFFAMTEQRLIHDNKVKNEWVMCPTCRQRTDIGN   84 (210)
Q Consensus        23 ~~~~C~iC~~~~~~~~~~~~CgH~fC~~C~~~~~~~~~~~~~~~~~~~~~CP~Cr~~~~~~~   84 (210)
                      +...|+||++.+.+ +++++|||.||.+|+..|+..          +...||+||..+...+
T Consensus        22 ~~~~C~IC~~~~~~-~~~~~CgH~fC~~Ci~~wl~~----------~~~~CP~Cr~~i~~~~   72 (79)
T d1fbva4          22 TFQLCKICAENDKD-VKIEPCGHLMCTSCLTSWQES----------EGQGCPFCRCEIKGTE   72 (79)
T ss_dssp             CTTBCTTTSSSBCC-EECSSSCCEECHHHHHHHHHT----------TCCSCTTTCCCCCCCC
T ss_pred             CCCCCccCCCcCCC-eEEeCCCCeeeHHHHHHHHHH----------CcCcCCCCCcCccCCc
Confidence            34579999999887 589999999999999999742          3457999999987654



>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure