Citrus Sinensis ID: 028387


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210
MALVSVLVKQLLQPFMGISEIYNPPLSTFLLLLIPLLTLVQLLKITRRSSNHLNLPPSPPKLPILGNLHQLLGTLPHRSLKALSERYGPLMFVYFGNSPTLVVSSAELAGEMFKTHDIVISNRPKTTPANILIYECQDISFSDYGEYWRQVRKICILQLLSVRRVQSFQHVRNDEVSSLITKIRLSCLHKGDFKTRNCQTSLSSGKVESF
cHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHcccEEEEcccccEEEEccHHHHHHHHHHcccccccccccccccHHccccccEEEccccHHHHHHHHHHHHHHccHHHHHHcHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcc
ccHHHHHHHHcccHHccccHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEcccEcHHHcccccHHHHHHHHHHHHccEEEEEEcccEEEEEccHHHHHHHHHccccEEcccccHHHHHHHEcccccEEEccccHHHHHHHHHHHHHHHcHHHHHccHHHHHHHHHHHHHHHHHHHcccccEcHHHHHHHHHHHHHHcc
MALVSVLVKQLLqpfmgiseiynpplSTFLLLLIPLLTLVQLLKITrrssnhlnlppsppklpilgnLHQLLGTLPHRSLKALSERYGPLMFVYFGNSPTLVVSSAELAGEmfkthdivisnrpkttpaniliyecqdisfsdyGEYWRQVRKICILQLLSVRRVQSFQHVRNDEVSSLITKIRLSclhkgdfktrncqtslssgkvesf
MALVSVLVKQLLQPFMGISEIYNPPLSTFLLLLIPLLTLVQLLKITRRSSNHLNLPPSPPKLPILGNLHQLLGTLPHRSLKALSERYGPLMFVYFGNSPTLVVSSAELAGEMFKthdivisnrpkttpaNILIYECQDISFSDYGEYWRQVRKICILQLLSVRRVQsfqhvrndevsslITKIRLsclhkgdfktrncqtslssgkvesf
MALVSVLVKQLLQPFMGISEIYNpplstflllliplltlvqllKITRRssnhlnlppsppklpilgnLHQLLGTLPHRSLKALSERYGPLMFVYFGNSPTLVVSSAELAGEMFKTHDIVISNRPKTTPANILIYECQDISFSDYGEYWRQVRKICILQLLSVRRVQSFQHVRNDEVSSLITKIRLSCLHKGDFKTRNCQTSLSSGKVESF
**LVSVLVKQLLQPFMGISEIYNPPLSTFLLLLIPLLTLVQLLKITRR*************LPILGNLHQLLGTLPHRSLKALSERYGPLMFVYFGNSPTLVVSSAELAGEMFKTHDIVISNRPKTTPANILIYECQDISFSDYGEYWRQVRKICILQLLSVRRVQSFQHVRNDEVSSLITKIRLSCLHKGDFKT***************
********KQLLQPFMGISEIYNPPLSTFLLLLIPLLTLVQL******************KLPILGNLHQLLGTLPHRSLKALSERYGPLMFVYFGNSPTLVVSSAELAGEMFKTHDIVISNRPKTTPANILIYECQDISFSDYGEYWRQVRKICILQLLSVRRVQSFQHVRNDEVSSLITK***********KTRNCQTSLSSGKVESF
MALVSVLVKQLLQPFMGISEIYNPPLSTFLLLLIPLLTLVQLLKITRRSSNHLNLPPSPPKLPILGNLHQLLGTLPHRSLKALSERYGPLMFVYFGNSPTLVVSSAELAGEMFKTHDIVISNRPKTTPANILIYECQDISFSDYGEYWRQVRKICILQLLSVRRVQSFQHVRNDEVSSLITKIRLSCLHKGDFKTRN*************
*ALVSVLVKQLLQPFMGISEIYNPPLSTFLLLLIPLLTLVQLLKITRRSSNHLNLPPSPPKLPILGNLHQLLGTLPHRSLKALSERYGPLMFVYFGNSPTLVVSSAELAGEMFKTHDIVISNRPKTTPANILIYECQDISFSDYGEYWRQVRKICILQLLSVRRVQSFQHVRNDEVSSLITKIRLSCLHKGDFKTRNCQTSLSSGKVESF
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSoooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALVSVLVKQLLQPFMGISEIYNPPLSTFLLLLIPLLTLVQLLKITRRSSNHLNLPPSPPKLPILGNLHQLLGTLPHRSLKALSERYGPLMFVYFGNSPTLVVSSAELAGEMFKTHDIVISNRPKTTPANILIYECQDISFSDYGEYWRQVRKICILQLLSVRRVQSFQHVRNDEVSSLITKIRLSCLHKGDFKTRNCQTSLSSGKVESF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query210 2.2.26 [Sep-21-2011]
P24465 502 Cytochrome P450 71A1 OS=P N/A no 0.742 0.310 0.531 2e-38
P37119 365 Cytochrome P450 71A3 (Fra N/A no 0.719 0.413 0.5 4e-38
C0SJS4 476 Psoralen synthase (Fragme N/A no 0.852 0.376 0.450 6e-38
Q6QNI4 494 Psoralen synthase OS=Ammi N/A no 0.880 0.374 0.441 1e-37
P37118 505 Cytochrome P450 71A2 OS=S N/A no 0.738 0.306 0.481 1e-37
P37117 507 Cytochrome P450 71A4 OS=S N/A no 0.671 0.278 0.507 1e-37
C0SJS2 473 Psoralen synthase (Fragme N/A no 0.728 0.323 0.5 2e-37
Q9T0K0 490 Cytochrome P450 71A19 OS= yes no 0.652 0.279 0.492 6e-37
O81974 504 Cytochrome P450 71D8 OS=G no no 0.766 0.319 0.478 1e-36
O81970 499 Cytochrome P450 71A9 OS=G no no 0.619 0.260 0.606 1e-36
>sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 Back     alignment and function desciption
 Score =  158 bits (400), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 117/158 (74%), Gaps = 2/158 (1%)

Query: 30  LLLLIPLLTLVQLLKITRRSSNHLNLPPSPPKLPILGNLHQLLGTLPHRSLKALSERYGP 89
           LL L   LT   LLK+  +     NLPPSPP LPI+GNLHQL G LPHRSL++L+   GP
Sbjct: 7   LLFLAIALTFF-LLKLNEKREKKPNLPPSPPNLPIIGNLHQL-GNLPHRSLRSLANELGP 64

Query: 90  LMFVYFGNSPTLVVSSAELAGEMFKTHDIVISNRPKTTPANILIYECQDISFSDYGEYWR 149
           L+ ++ G+ PTL+VS+AE+A E+ KTHD++ ++RP TT A  + Y+C D++FS YGEYWR
Sbjct: 65  LILLHLGHIPTLIVSTAEIAEEILKTHDLIFASRPSTTAARRIFYDCTDVAFSPYGEYWR 124

Query: 150 QVRKICILQLLSVRRVQSFQHVRNDEVSSLITKIRLSC 187
           QVRKIC+L+LLS++RV S++ +R +EV  ++ +I  SC
Sbjct: 125 QVRKICVLELLSIKRVNSYRSIREEEVGLMMERISQSC 162




Involved in the metabolism of compounds associated with the development of flavor in the ripening fruit process, possibly by acting as trans-cinnamic acid 4-hydrolase.
Persea americana (taxid: 3435)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|P37119|C71A3_SOLME Cytochrome P450 71A3 (Fragment) OS=Solanum melongena GN=CYP71A3 PE=2 SV=1 Back     alignment and function description
>sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 Back     alignment and function description
>sp|Q6QNI4|C71AJ_AMMMJ Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 Back     alignment and function description
>sp|P37118|C71A2_SOLME Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 Back     alignment and function description
>sp|P37117|C71A4_SOLME Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 Back     alignment and function description
>sp|C0SJS2|C71AJ_PASSA Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 Back     alignment and function description
>sp|Q9T0K0|C71AJ_ARATH Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 Back     alignment and function description
>sp|O81974|C71D8_SOYBN Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 Back     alignment and function description
>sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query210
356516619 519 PREDICTED: cytochrome P450 71A1-like [Gl 0.833 0.337 0.508 5e-48
224135973 494 predicted protein [Populus trichocarpa] 0.652 0.277 0.625 4e-47
224139376 486 cytochrome P450 [Populus trichocarpa] gi 0.671 0.290 0.594 9e-46
224139378 486 cytochrome P450 [Populus trichocarpa] gi 0.671 0.290 0.594 2e-45
449532791205 PREDICTED: cytochrome P450 71A2-like [Cu 0.619 0.634 0.618 4e-45
356513646 478 PREDICTED: LOW QUALITY PROTEIN: cytochro 0.747 0.328 0.577 1e-44
224121846 516 cytochrome P450 [Populus trichocarpa] gi 0.766 0.312 0.518 1e-44
449469731 507 PREDICTED: cytochrome P450 71A1-like [Cu 0.752 0.311 0.524 4e-44
449469735 507 PREDICTED: cytochrome P450 71A1-like [Cu 0.628 0.260 0.609 6e-44
449487825 528 PREDICTED: cytochrome P450 71A1-like [Cu 0.619 0.246 0.610 1e-43
>gi|356516619|ref|XP_003526991.1| PREDICTED: cytochrome P450 71A1-like [Glycine max] Back     alignment and taxonomy information
 Score =  196 bits (498), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 95/187 (50%), Positives = 131/187 (70%), Gaps = 12/187 (6%)

Query: 1   MALVSVLVKQLLQPFMGISEIYNPPLSTFLLLLIPLLTLVQLLKITRRSSNHLNLPPSPP 60
           MA +S ++KQL          Y P  + +L      ++L+ +LK+TRR  N  N PPSPP
Sbjct: 1   MAFLSSVLKQL---------AYEPSSTHYLTAFFCFVSLLLMLKLTRR--NKSNFPPSPP 49

Query: 61  KLPILGNLHQLLGTLPHRSLKALSERYGPLMFVYFGNSPTLVVSSAELAGEMFKTHDIVI 120
           KLPI+GNLHQL GTLPHRS +ALS +YGPLM +  G +PTLVVSSA++A E+ KTHD+V 
Sbjct: 50  KLPIIGNLHQL-GTLPHRSFQALSRKYGPLMMLQLGQTPTLVVSSADVAREIIKTHDVVF 108

Query: 121 SNRPKTTPANILIYECQDISFSDYGEYWRQVRKICILQLLSVRRVQSFQHVRNDEVSSLI 180
           SNRP+ T A I +Y C+D+ F+ YGE WRQ +K C+++LLS R+V+SF+ +R + VS L+
Sbjct: 109 SNRPQPTAAKIFLYNCKDVGFAPYGEEWRQTKKTCVVELLSQRKVRSFRSIREEVVSELV 168

Query: 181 TKIRLSC 187
             +R +C
Sbjct: 169 EAVREAC 175




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224135973|ref|XP_002322207.1| predicted protein [Populus trichocarpa] gi|222869203|gb|EEF06334.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224139376|ref|XP_002323082.1| cytochrome P450 [Populus trichocarpa] gi|222867712|gb|EEF04843.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224139378|ref|XP_002323083.1| cytochrome P450 [Populus trichocarpa] gi|222867713|gb|EEF04844.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449532791|ref|XP_004173362.1| PREDICTED: cytochrome P450 71A2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356513646|ref|XP_003525522.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 71A1-like [Glycine max] Back     alignment and taxonomy information
>gi|224121846|ref|XP_002318687.1| cytochrome P450 [Populus trichocarpa] gi|222859360|gb|EEE96907.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449469731|ref|XP_004152572.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449469735|ref|XP_004152574.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449487825|ref|XP_004157819.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query210
TAIR|locus:504955639 489 CYP71A26 ""cytochrome P450, fa 0.561 0.241 0.521 8.7e-29
TAIR|locus:504955642 490 CYP71A21 ""cytochrome P450, fa 0.561 0.240 0.504 2.6e-28
UNIPROTKB|Q6QNI4 494 CYP71AJ1 "Psoralen synthase" [ 0.676 0.287 0.453 2.3e-27
TAIR|locus:2142075 497 CYP71A20 ""cytochrome P450, fa 0.561 0.237 0.483 2.4e-27
TAIR|locus:504955640 490 CYP71A22 ""cytochrome P450, fa 0.561 0.240 0.487 6.2e-27
TAIR|locus:2149383 497 CYP71A14 ""cytochrome P450, fa 0.547 0.231 0.465 6.8e-27
TAIR|locus:504955637 490 CYP71A25 ""cytochrome P450, fa 0.561 0.240 0.478 1e-26
TAIR|locus:2142055 490 CYP71A19 ""cytochrome P450, fa 0.542 0.232 0.478 1.4e-26
UNIPROTKB|Q947B7 493 Q947B7 "(+)-menthofuran syntha 0.552 0.235 0.465 1.1e-25
TAIR|locus:2149373 496 CYP71A15 ""cytochrome P450, fa 0.547 0.231 0.456 1.2e-25
TAIR|locus:504955639 CYP71A26 ""cytochrome P450, family 71, subfamily A, polypeptide 26"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 322 (118.4 bits), Expect = 8.7e-29, P = 8.7e-29
 Identities = 62/119 (52%), Positives = 87/119 (73%)

Query:    68 LHQLLGTLPHRSLKALSERYGPLMFVYFGNSPTLVVSSAELAGEMFKTHDIVISNRPKTT 127
             LHQL G  PHRSL +LS RYGPLM ++FG  P LVVSSAELA ++ KTHD V ++RP++ 
Sbjct:    44 LHQL-GRHPHRSLCSLSHRYGPLMLLHFGRVPVLVVSSAELARDVLKTHDRVFASRPRSK 102

Query:   128 PANILIYECQDISFSDYGEYWRQVRKICILQLLSVRRVQSFQHVRNDEVSSLITKIRLS 186
                 L+Y+  D++ + YGEYWRQ++ +C+L L S + V+SF+ VR +E+S ++ KIR S
Sbjct:   103 IFEKLLYDKHDVASAPYGEYWRQMKSVCVLHLFSNKMVRSFREVREEEISLMMEKIRKS 161




GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:504955642 CYP71A21 ""cytochrome P450, family 71, subfamily A, polypeptide 21"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6QNI4 CYP71AJ1 "Psoralen synthase" [Ammi majus (taxid:48026)] Back     alignment and assigned GO terms
TAIR|locus:2142075 CYP71A20 ""cytochrome P450, family 71, subfamily A, polypeptide 20"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955640 CYP71A22 ""cytochrome P450, family 71, subfamily A, polypeptide 22"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149383 CYP71A14 ""cytochrome P450, family 71, subfamily A, polypeptide 14"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955637 CYP71A25 ""cytochrome P450, family 71, subfamily A, polypeptide 25"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142055 CYP71A19 ""cytochrome P450, family 71, subfamily A, polypeptide 19"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q947B7 Q947B7 "(+)-menthofuran synthase" [Mentha x piperita (taxid:34256)] Back     alignment and assigned GO terms
TAIR|locus:2149373 CYP71A15 ""cytochrome P450, family 71, subfamily A, polypeptide 15"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_XV000600
hypothetical protein (494 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.00121060
cytochrome P450 (114 aa)
       0.432

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query210
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 1e-36
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 2e-33
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 5e-33
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 8e-28
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 3e-27
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 1e-24
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 8e-23
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 1e-17
PLN00168 519 PLN00168, PLN00168, Cytochrome P450; Provisional 6e-16
pfam00067 461 pfam00067, p450, Cytochrome P450 6e-16
PLN03018 534 PLN03018, PLN03018, homomethionine N-hydroxylase 9e-14
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 9e-14
PLN02971 543 PLN02971, PLN02971, tryptophan N-hydroxylase 2e-09
PRK14799 545 PRK14799, thrS, threonyl-tRNA synthetase; Provisio 5e-04
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
 Score =  133 bits (336), Expect = 1e-36
 Identities = 59/158 (37%), Positives = 93/158 (58%), Gaps = 3/158 (1%)

Query: 26  LSTFLLLLIPLLTLVQLLKITRRSSNHLNLPPSPPKLPILGNLHQLLGTLPHRSLKALSE 85
           LS    +LI  + + + L  + R S  L LPP PP+ PI+GNL QL G LPHR L +L +
Sbjct: 6   LSLLFSVLIFNVLIWRWLNASMRKS--LRLPPGPPRWPIVGNLLQL-GPLPHRDLASLCK 62

Query: 86  RYGPLMFVYFGNSPTLVVSSAELAGEMFKTHDIVISNRPKTTPANILIYECQDISFSDYG 145
           +YGPL+++  G+   +     EL  E+    D V ++RP+T  A  L Y C D++ +  G
Sbjct: 63  KYGPLVYLRLGSVDAITTDDPELIREILLRQDDVFASRPRTLAAVHLAYGCGDVALAPLG 122

Query: 146 EYWRQVRKICILQLLSVRRVQSFQHVRNDEVSSLITKI 183
            +W+++R+IC+  LL+ +R++SF   R +E   LI  +
Sbjct: 123 PHWKRMRRICMEHLLTTKRLESFAKHRAEEARHLIQDV 160


Length = 514

>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|184826 PRK14799, thrS, threonyl-tRNA synthetase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 210
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.95
PLN02687 517 flavonoid 3'-monooxygenase 99.94
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.93
PLN03234 499 cytochrome P450 83B1; Provisional 99.93
PTZ00404 482 cytochrome P450; Provisional 99.93
PLN03112 514 cytochrome P450 family protein; Provisional 99.93
PLN02971 543 tryptophan N-hydroxylase 99.93
PLN00168 519 Cytochrome P450; Provisional 99.92
PLN02394 503 trans-cinnamate 4-monooxygenase 99.92
PLN02966 502 cytochrome P450 83A1 99.92
PLN02183 516 ferulate 5-hydroxylase 99.92
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.91
PLN02290 516 cytokinin trans-hydroxylase 99.91
PLN02196 463 abscisic acid 8'-hydroxylase 99.9
PLN02655 466 ent-kaurene oxidase 99.89
PLN02500 490 cytochrome P450 90B1 99.89
PLN02774 463 brassinosteroid-6-oxidase 99.87
PLN03018 534 homomethionine N-hydroxylase 99.87
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.85
PLN02302 490 ent-kaurenoic acid oxidase 99.85
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.83
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.82
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.82
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.82
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.81
PLN02738 633 carotene beta-ring hydroxylase 99.78
PLN02936 489 epsilon-ring hydroxylase 99.78
PLN02648 480 allene oxide synthase 99.77
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.7
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.6
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 99.42
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 98.91
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
Probab=99.95  E-value=4.9e-27  Score=190.65  Aligned_cols=152  Identities=38%  Similarity=0.683  Sum_probs=131.8

Q ss_pred             CCCCCCCCCCCCccccccccCCCChhHHHHHHHHhhCCcEEEEecCccEEEEcCHHHHHHHHhhCCCCCCCCCC-ChhHH
Q 028387           52 HLNLPPSPPKLPILGNLHQLLGTLPHRSLKALSERYGPLMFVYFGNSPTLVVSSAELAGEMFKTHDIVISNRPK-TTPAN  130 (210)
Q Consensus        52 ~~~~~pgp~~~p~lG~~~~~~~~~~~~~~~~~~~~yG~i~~~~~~~~~~v~i~dp~~~~~il~~~~~~~~~~~~-~~~~~  130 (210)
                      +.+.||||+++|++||++++....++..+.+|.++|||++.+|+|..|+|+++|+++++|++++++..|.+||. .....
T Consensus        24 ~~~lPPGP~~lPiIGnl~~l~~~~~h~~~~~ls~~yGpi~tl~lG~~~~Vviss~~~akE~l~~~d~~fa~Rp~~~~~~~  103 (489)
T KOG0156|consen   24 RRNLPPGPPPLPIIGNLHQLGSLPPHRSFRKLSKKYGPVFTLRLGSVPVVVISSYEAAKEVLVKQDLEFADRPDPTATLK  103 (489)
T ss_pred             CCCCCcCCCCCCccccHHHcCCCchhHHHHHHHHHhCCeEEEEecCceEEEECCHHHHHHHHHhCCccccCCCCchhhHH
Confidence            38889999999999999999444599999999999999999999999999999999999999999999999997 23446


Q ss_pred             HhhhcCcceeecCCChhHHHHhHHHHHhhcChhHHhhhHHHHHHHHHHHHHHHHhhcCCCCCccchhhhhhhcc
Q 028387          131 ILIYECQDISFSDYGEYWRQVRKICILQLLSVRRVQSFQHVRNDEVSSLITKIRLSCLHKGDFKTRNCQTSLSS  204 (210)
Q Consensus       131 ~~~~~~~~~~~~~~g~~wk~~Rk~~~~~~f~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~v~~~~~~~~~~~  204 (210)
                      .+..++.|++++.+|+.||.+||+.....|+.+.+++..+.-.++++.+++.+.+ ...+..+|+...+...+.
T Consensus       104 ~~~~~~~~i~~a~yG~~Wr~~Rr~~~~~L~~~~~~~~~~~~R~~E~~~l~~~l~~-~~~~~~vdl~~~l~~~~~  176 (489)
T KOG0156|consen  104 YLSYGGKGIVFAPYGDYWREMRRFALTELRSFGRGKSFMEIREEEVDELVKKLSK-SKKGEPVDLSELLDLLVG  176 (489)
T ss_pred             HhcCCCCceEeCCCcHHHHHHHHHHHHHhcChhhhhhhHHHHHHHHHHHHHHHHh-cCCCceeeHHHHHHHHHH
Confidence            6666688999998899999999999888999999999988779999999999988 322267888776665543



>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query210
3ruk_A 494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 6e-06
2hi4_A 495 Crystal Structure Of Human Microsomal P450 1a2 In C 4e-04
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure

Iteration: 1

Score = 47.4 bits (111), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 8/94 (8%) Query: 71 LLGTLP--------HRSLKALSERYGPLMFVYFGNSPTLVVSSAELAGEMFKTHDIVISN 122 L+G+LP H + L ++YGP+ V G T++V +LA E+ S Sbjct: 18 LVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSG 77 Query: 123 RPKTTPANILIYECQDISFSDYGEYWRQVRKICI 156 RP+ +I + I+F+D G +W+ R++ + Sbjct: 78 RPQMATLDIASNNRKGIAFADSGAHWQLHRRLAM 111
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query210
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 9e-42
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 1e-41
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 2e-34
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 3e-34
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 5e-27
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 7e-25
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 2e-24
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 5e-24
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 7e-24
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 1e-22
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 4e-22
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 2e-21
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 3e-21
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 5e-21
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 2e-20
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 2e-20
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 5e-20
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 8e-17
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 5e-16
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 1e-12
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 1e-12
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 4e-10
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 2e-09
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 5e-09
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 2e-04
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
 Score =  146 bits (370), Expect = 9e-42
 Identities = 24/151 (15%), Positives = 46/151 (30%), Gaps = 4/151 (2%)

Query: 46  TRRSSNHLNLPPSPPKLPILGNLHQLLG---TLPHRSLKALSERYGPLMFVYFGNSPTLV 102
           + RS    N  PSP     L   H          H       ++YGP+     GN  ++ 
Sbjct: 1   STRSPRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVY 60

Query: 103 VSSAELAGEMFKTHDIVISNRP-KTTPANILIYECQDISFSDYGEYWRQVRKICILQLLS 161
           V   E    +FK+              A    Y+            W++ R     ++++
Sbjct: 61  VIDPEDVALLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMA 120

Query: 162 VRRVQSFQHVRNDEVSSLITKIRLSCLHKGD 192
               ++F  + +      ++ +       G 
Sbjct: 121 PEATKNFLPLLDAVSRDFVSVLHRRIKKAGS 151


>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query210
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.92
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.91
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.91
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.9
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.9
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.9
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.89
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.88
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.88
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.87
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.87
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.86
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.86
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.85
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.85
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.84
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.84
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.83
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.83
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.8
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.8
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.8
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.79
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.74
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.73
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.73
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.72
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.71
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.71
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.71
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.7
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.65
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.64
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 99.63
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.63
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.62
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.6
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.58
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.58
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.57
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.56
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.56
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.56
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 99.55
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.53
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.52
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.52
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.52
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 99.52
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.5
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.5
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 99.49
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.49
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.48
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 99.47
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.44
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.44
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.43
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 99.43
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.43
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 99.4
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.4
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 99.39
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.37
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.35
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.33
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.32
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.32
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.3
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.24
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 99.19
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 99.15
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.13
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.1
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 98.99
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 98.68
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 97.45
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 80.24
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
Probab=99.92  E-value=1.9e-25  Score=182.17  Aligned_cols=154  Identities=16%  Similarity=0.215  Sum_probs=126.7

Q ss_pred             hCCCCCCCCCCCCCCCccccccccCCCChhHHHHHHHHhhCCcEEEEecCccEEEEcCHHHHHHHHhhC-CCCCCCCCCC
Q 028387           48 RSSNHLNLPPSPPKLPILGNLHQLLGTLPHRSLKALSERYGPLMFVYFGNSPTLVVSSAELAGEMFKTH-DIVISNRPKT  126 (210)
Q Consensus        48 ~~~~~~~~~pgp~~~p~lG~~~~~~~~~~~~~~~~~~~~yG~i~~~~~~~~~~v~i~dp~~~~~il~~~-~~~~~~~~~~  126 (210)
                      ..+++.+.+|||+++|++||++.+ ..+++.++.+|+++|||++++++|+.+.++++||+++++++.++ ...|.+++..
T Consensus         8 ~~~~k~~~~PGP~~~PliGn~~~~-~~~~~~~~~~~~~~yG~i~~~~~g~~~~vvv~dp~~i~~il~~~~~~~f~~r~~~   86 (485)
T 3nxu_A            8 HGLFKKLGIPGPTPLPFLGNILSY-HKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPF   86 (485)
T ss_dssp             TTHHHHHTCCCCCCBTTTBTGGGG-GGCHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHHTTTTTTTCCCCCCC
T ss_pred             chHHhhCCCCCCCCcCeecCcHHh-hcChHHHHHHHHHHcCCeEEEEeCCCCEEEECCHHHHHHHHhccchhhccCCccc
Confidence            344455679999999999999998 67889999999999999999999999999999999999999887 5567666543


Q ss_pred             hhHHHhhhcCcceeecCCChhHHHHhHHHHHhhcChhHHhhhHHHHHHHHHHHHHHHHhhcCCCCCccchhhhhhhcccc
Q 028387          127 TPANILIYECQDISFSDYGEYWRQVRKICILQLLSVRRVQSFQHVRNDEVSSLITKIRLSCLHKGDFKTRNCQTSLSSGK  206 (210)
Q Consensus       127 ~~~~~~~~~~~~~~~~~~g~~wk~~Rk~~~~~~f~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~v~~~~~~~~~~~~t  206 (210)
                      ....   ..+.++ +..+|+.|+++||++ +++|+.++++.+.+.+.++++.+++.+.+..++++.+|+.+.+..++.++
T Consensus        87 ~~~~---~~~~~l-~~~~g~~w~~~R~~~-~~~fs~~~l~~~~~~i~~~~~~l~~~l~~~~~~g~~~d~~~~~~~~~~dv  161 (485)
T 3nxu_A           87 GPVG---FMKSAI-SIAEDEEWKRLRSLL-SPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDV  161 (485)
T ss_dssp             SCCG---GGGGST-TTCCHHHHHHHHHHH-GGGGCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCEEHHHHHHHHHHHH
T ss_pred             cccc---ccccCc-cccCCcHHHHHHhhc-ChhcCHHHHHHHHHHHHHHHHHHHHHHHHHhccCCcCcHHHHHHHHHHHH
Confidence            2222   124444 455699999999999 79999999999999999999999999987655566788888777776654


Q ss_pred             c
Q 028387          207 V  207 (210)
Q Consensus       207 ~  207 (210)
                      +
T Consensus       162 i  162 (485)
T 3nxu_A          162 I  162 (485)
T ss_dssp             H
T ss_pred             H
Confidence            4



>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 210
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 2e-30
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 2e-27
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 4e-27
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 5e-25
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 3e-22
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 2e-20
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 5e-17
d1n97a_ 385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 3e-14
d1odoa_ 401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 1e-12
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2c9
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  114 bits (284), Expect = 2e-30
 Identities = 38/141 (26%), Positives = 63/141 (44%), Gaps = 3/141 (2%)

Query: 55  LPPSPPKLPILGNLHQLLGTLPHRSLKALSERYGPLMFVYFGNSPTLVVSSAELAGEMFK 114
           LPP P  LP++GN+ Q+      +SL  LS+ YGP+  +YFG  P +V+   E   E   
Sbjct: 4   LPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALI 63

Query: 115 THDIVISNRPKTTPANILIYECQDISFSDYGEYWRQVRKICILQLLSVRRVQ-SFQHVRN 173
                 S R     A         I FS  G+ W+++R+  ++ L +    + S +    
Sbjct: 64  DLGEEFSGRGIFPLAERANRG-FGIVFS-NGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQ 121

Query: 174 DEVSSLITKIRLSCLHKGDFK 194
           +E   L+ ++R +     D  
Sbjct: 122 EEARCLVEELRKTKASPCDPT 142


>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query210
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.9
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.9
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.84
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.83
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.81
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.79
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.69
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.69
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.57
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.38
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.38
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.36
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.35
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.16
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.13
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 98.98
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 98.93
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 98.87
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 98.79
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 98.48
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 98.4
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 83.33
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 82.21
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 81.93
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 81.74
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 80.53
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome P450 bm-3
species: Bacillus megaterium [TaxId: 1404]
Probab=99.90  E-value=3.6e-24  Score=171.36  Aligned_cols=149  Identities=16%  Similarity=0.153  Sum_probs=120.7

Q ss_pred             CCCCCCCCCCccccccccCCCChhHHHHHHHHhhCCcEEEEecCccEEEEcCHHHHHHHHhhCCCCCCCCCCChhHHHhh
Q 028387           54 NLPPSPPKLPILGNLHQLLGTLPHRSLKALSERYGPLMFVYFGNSPTLVVSSAELAGEMFKTHDIVISNRPKTTPANILI  133 (210)
Q Consensus        54 ~~~pgp~~~p~lG~~~~~~~~~~~~~~~~~~~~yG~i~~~~~~~~~~v~i~dp~~~~~il~~~~~~~~~~~~~~~~~~~~  133 (210)
                      +.+|||.++|++||++.+...++++.+.+|+++|||||++++++.++++++||+++++++.++...+..+........  
T Consensus         1 r~iPGP~~~p~lG~l~~l~~~~~~~~~~~~~~kyG~if~~~~~~~~~vvl~~~~~i~~v~~~~~~~~~~~~~~~~~~~--   78 (453)
T d2ij2a1           1 KEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRD--   78 (453)
T ss_dssp             CCCCCCCCCGGGTTGGGGCSSCHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHTCTTTEEECCCHHHHHHHH--
T ss_pred             CCCccCCCcchhhCHHHhCCCCHHHHHHHHHHHhCCEEEEEeCCceEEEECCHHHHHHHHhcCCcccccccHhHHHHH--
Confidence            468999999999999998677899999999999999999999999999999999999999776654543322111111  


Q ss_pred             hcCcceeec-CCChhHHHHhHHHHHhhcChhHHhhhHHHHHHHHHHHHHHHHhhcCCCCCccchhhhhhhcccc
Q 028387          134 YECQDISFS-DYGEYWRQVRKICILQLLSVRRVQSFQHVRNDEVSSLITKIRLSCLHKGDFKTRNCQTSLSSGK  206 (210)
Q Consensus       134 ~~~~~~~~~-~~g~~wk~~Rk~~~~~~f~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~v~~~~~~~~~~~~t  206 (210)
                      ..|+|++++ .+|+.|+++||++ .+.|+.++++.+.+.+.++++++++.|++.. +++.+|+.+.+..++.+.
T Consensus        79 ~~g~~~~~~~~~g~~wk~~Rk~l-~~~fs~~~l~~~~~~i~~~~~~li~~l~~~~-~~~~idl~~~~~~~~~~~  150 (453)
T d2ij2a1          79 FAGDGLFTSWTHEKNWKKAHNIL-LPSFSQQAMKGYHAMMVDIAVQLVQKWERLN-ADEHIEVPEDMTRLTLDT  150 (453)
T ss_dssp             HHTTSGGGSCTTSHHHHHHHHHH-GGGGSTTTHHHHHHHHHHHHHHHHHHHHTCC-TTCCEEHHHHHHHHHHHH
T ss_pred             hcCCcEEecCCChHHHHHHHHHH-HHHhhhhhhhhhhhhHHHHHHHHHHHhhhcC-CCCccchHHHHHHHhhhc
Confidence            225666543 4699999999999 7999999999999999999999999998643 456788877776665544



>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure