Citrus Sinensis ID: 028432
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 209 | ||||||
| 224056847 | 180 | predicted protein [Populus trichocarpa] | 0.846 | 0.983 | 0.824 | 1e-80 | |
| 296089975 | 210 | unnamed protein product [Vitis vinifera] | 1.0 | 0.995 | 0.680 | 2e-76 | |
| 225462015 | 197 | PREDICTED: probable peptidyl-prolyl cis- | 0.928 | 0.984 | 0.701 | 4e-75 | |
| 449520092 | 214 | PREDICTED: peptidyl-prolyl cis-trans iso | 0.851 | 0.831 | 0.747 | 4e-72 | |
| 18416773 | 207 | FKBP-like peptidyl-prolyl cis-trans isom | 0.985 | 0.995 | 0.657 | 3e-71 | |
| 297799350 | 203 | immunophilin [Arabidopsis lyrata subsp. | 0.918 | 0.945 | 0.683 | 8e-69 | |
| 255542350 | 166 | fkbp-type peptidyl-prolyl cis-trans isom | 0.784 | 0.987 | 0.765 | 1e-68 | |
| 351726896 | 227 | uncharacterized protein LOC100500635 [Gl | 0.913 | 0.841 | 0.640 | 9e-66 | |
| 357460235 | 268 | FK506-binding protein [Medicago truncatu | 0.976 | 0.761 | 0.619 | 6e-65 | |
| 357460237 | 264 | FK506-binding protein [Medicago truncatu | 0.956 | 0.757 | 0.614 | 1e-62 |
| >gi|224056847|ref|XP_002299053.1| predicted protein [Populus trichocarpa] gi|222846311|gb|EEE83858.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 305 bits (780), Expect = 1e-80, Method: Compositional matrix adjust.
Identities = 146/177 (82%), Positives = 162/177 (91%)
Query: 33 NLFAKFSSLTVKRLPRRTLLQFIGFSSMVLHVNPDFDAPMPDMKEPEAIRTLKLASGVRI 92
+L KFSSL +KRL RR +L+F GF++++L +NP APMP+MKEPE IRTLKLASGVR
Sbjct: 4 DLHCKFSSLEIKRLSRRMVLKFCGFNTLLLSINPVLAAPMPEMKEPEVIRTLKLASGVRF 63
Query: 93 QEIIEGEGPEASEGDIVQLNYVCRRSNGYFVHSTVDQFSGESAPVILPLDENKIIKGLKE 152
QEIIEGEGPEA EGD V++NYVCRRSNGYFVHSTVDQFSGES+PVILPLDEN+IIKGLKE
Sbjct: 64 QEIIEGEGPEAQEGDTVEVNYVCRRSNGYFVHSTVDQFSGESSPVILPLDENQIIKGLKE 123
Query: 153 VLVGMKVGGKRRALIPPSVGYINENLKPIPDEFGPRRSLLSHANEPLIFEVQLLKVL 209
VL+GMKVGGKRRALIPPSVGY+NENLKPIPDEFGPRRSL SHANEPLIFEVQLLKVL
Sbjct: 124 VLIGMKVGGKRRALIPPSVGYVNENLKPIPDEFGPRRSLFSHANEPLIFEVQLLKVL 180
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|296089975|emb|CBI39794.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225462015|ref|XP_002267826.1| PREDICTED: probable peptidyl-prolyl cis-trans isomerase C27F1.06c-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449520092|ref|XP_004167068.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP16-1, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|18416773|ref|NP_567750.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Arabidopsis thaliana] gi|75306033|sp|Q944B0.1|FK161_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP16-1, chloroplastic; Short=PPIase FKBP16-1; AltName: Full=FK506-binding protein 16-1; Short=AtFKBP16-1; AltName: Full=Immunophilin FKBP16-1; AltName: Full=Rotamase; Flags: Precursor gi|16612240|gb|AAL27493.1|AF439821_1 AT4g26550/M3E9_20 [Arabidopsis thaliana] gi|21928091|gb|AAM78074.1| AT4g26550/M3E9_20 [Arabidopsis thaliana] gi|26450730|dbj|BAC42474.1| unknown protein [Arabidopsis thaliana] gi|332659818|gb|AEE85218.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297799350|ref|XP_002867559.1| immunophilin [Arabidopsis lyrata subsp. lyrata] gi|297313395|gb|EFH43818.1| immunophilin [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|255542350|ref|XP_002512238.1| fkbp-type peptidyl-prolyl cis-trans isomerase 2, chloroplast, putative [Ricinus communis] gi|223548199|gb|EEF49690.1| fkbp-type peptidyl-prolyl cis-trans isomerase 2, chloroplast, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|351726896|ref|NP_001237142.1| uncharacterized protein LOC100500635 [Glycine max] gi|255630813|gb|ACU15768.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357460235|ref|XP_003600399.1| FK506-binding protein [Medicago truncatula] gi|355489447|gb|AES70650.1| FK506-binding protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357460237|ref|XP_003600400.1| FK506-binding protein [Medicago truncatula] gi|355489448|gb|AES70651.1| FK506-binding protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 209 | ||||||
| TAIR|locus:505006521 | 207 | AT4G26555 "AT4G26555" [Arabido | 0.976 | 0.985 | 0.666 | 7.2e-68 | |
| UNIPROTKB|Q6H725 | 211 | P0026H03.28 "Peptidyl-prolyl c | 0.928 | 0.919 | 0.572 | 1.2e-51 | |
| UNIPROTKB|A8I6B6 | 236 | FKB16-1 "Peptidyl-prolyl cis-t | 0.669 | 0.593 | 0.469 | 1.6e-29 | |
| TAIR|locus:2134035 | 229 | AT4G19830 "AT4G19830" [Arabido | 0.732 | 0.668 | 0.325 | 3e-14 | |
| UNIPROTKB|Q6H6D3 | 213 | P0669G09.14 "Peptidyl-prolyl c | 0.535 | 0.525 | 0.327 | 2.4e-12 | |
| UNIPROTKB|Q7XUX5 | 525 | OSJNBa0027P08.21 "Peptidyl-pro | 0.545 | 0.217 | 0.362 | 1.1e-09 | |
| UNIPROTKB|Q6ZIT9 | 261 | OJ1211_G06.16 "Peptidyl-prolyl | 0.583 | 0.467 | 0.323 | 7.3e-09 | |
| UNIPROTKB|Q74AS7 | 156 | GSU2274 "Peptidyl-prolyl cis-t | 0.397 | 0.532 | 0.356 | 7.6e-09 | |
| TIGR_CMR|GSU_2274 | 156 | GSU_2274 "FKBP-type peptidyl-p | 0.397 | 0.532 | 0.356 | 7.6e-09 | |
| UNIPROTKB|P73037 | 201 | ytfC "Peptidyl-prolyl cis-tran | 0.464 | 0.482 | 0.336 | 1.4e-08 |
| TAIR|locus:505006521 AT4G26555 "AT4G26555" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 689 (247.6 bits), Expect = 7.2e-68, P = 7.2e-68
Identities = 138/207 (66%), Positives = 163/207 (78%)
Query: 4 LAIQASLLFPCASKSSSIKGGRPNGGVSQNLFAKFSSLTVKRLPRRTLLQFIGFSSMVLH 63
+A++ SL P S ++ G+ VS+ FSS++ +PRR +Q GF S++
Sbjct: 3 MAMEISL--PFVGSSMALSAGKSRNSVSRISRVGFSSVSAVHVPRRMFMQLSGFGSVLTL 60
Query: 64 VN-PDFDAPMPDMKEPEAIRTLKLASGVRIQEIIEGEGPEASEGDIVQLNYVCRRSNGYF 122
++ P AP+P MKEPE IRTLKL SGVR QEIIEGEG EA EGD+V+LNYVCRR+NGYF
Sbjct: 61 LDFPSLAAPVPQMKEPEVIRTLKLPSGVRYQEIIEGEGREAHEGDLVELNYVCRRANGYF 120
Query: 123 VHSTVDQFSGESAPVILPLDENKIIKGLKEVLVGMKVGGKRRALIPPSVGYINENLKPIP 182
VHSTVDQFSGES+PV L LDEN +I+GLKEVLVGMK GGKRRALIPPSVGYINE LKPIP
Sbjct: 121 VHSTVDQFSGESSPVKLILDENDVIEGLKEVLVGMKAGGKRRALIPPSVGYINETLKPIP 180
Query: 183 DEFGPRRSLLSHANEPLIFEVQLLKVL 209
+EFGPRRSLLSHANEPL+FE+QLLKVL
Sbjct: 181 EEFGPRRSLLSHANEPLVFEIQLLKVL 207
|
|
| UNIPROTKB|Q6H725 P0026H03.28 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8I6B6 FKB16-1 "Peptidyl-prolyl cis-trans isomerase" [Chlamydomonas reinhardtii (taxid:3055)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2134035 AT4G19830 "AT4G19830" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6H6D3 P0669G09.14 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7XUX5 OSJNBa0027P08.21 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6ZIT9 OJ1211_G06.16 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q74AS7 GSU2274 "Peptidyl-prolyl cis-trans isomerase" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_2274 GSU_2274 "FKBP-type peptidyl-prolyl cis-trans isomerase" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P73037 ytfC "Peptidyl-prolyl cis-trans isomerase" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| grail3.0051013901 | hypothetical protein (181 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| estExt_Genewise1_v1.C_LG_V2929 | • | • | 0.507 | ||||||||
| gw1.X.2120.1 | • | 0.484 | |||||||||
| eugene3.00060293 | • | 0.473 | |||||||||
| fgenesh4_pg.C_scaffold_7330000001 | • | 0.470 | |||||||||
| eugene3.00080515 | • | 0.468 | |||||||||
| eugene3.40480001 | • | 0.446 | |||||||||
| estExt_Genewise1_v1.C_LG_II4018 | • | 0.428 | |||||||||
| estExt_Genewise1_v1.C_LG_VII1249 | • | 0.411 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 209 | |||
| pfam00254 | 94 | pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t | 2e-18 | |
| COG0545 | 205 | COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans | 4e-18 | |
| PRK10902 | 269 | PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- | 2e-05 | |
| PRK11570 | 206 | PRK11570, PRK11570, peptidyl-prolyl cis-trans isom | 1e-04 | |
| COG1047 | 174 | COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans | 2e-04 |
| >gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase | Back alignment and domain information |
|---|
Score = 76.1 bits (188), Expect = 2e-18
Identities = 35/107 (32%), Positives = 49/107 (45%), Gaps = 18/107 (16%)
Query: 102 EASEGDIVQLNYVCRRSNGYFVHSTVDQFSGESAPVILPLDENKIIKGLKEVLVGMKVGG 161
+A +GD V ++Y + +G + D P L ++I G E L+GMKVG
Sbjct: 4 KAKKGDTVTVHYTGKLEDG----TVFDSSKDRGKPFEFTLGSGQVIPGWDEGLLGMKVGE 59
Query: 162 KRRALIPPSVGYINENLKP--IPDEFGPRRSLLSHANEPLIFEVQLL 206
KR+ IPP + Y E L IP N L+FEV+LL
Sbjct: 60 KRKLTIPPELAYGEEGLAGGVIP------------PNATLVFEVELL 94
|
Length = 94 |
| >gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183207 PRK11570, PRK11570, peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 209 | |||
| COG0545 | 205 | FkpA FKBP-type peptidyl-prolyl cis-trans isomerase | 99.97 | |
| KOG0544 | 108 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.97 | |
| KOG0552 | 226 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.95 | |
| KOG0549 | 188 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.95 | |
| PRK11570 | 206 | peptidyl-prolyl cis-trans isomerase; Provisional | 99.94 | |
| TIGR03516 | 177 | ppisom_GldI peptidyl-prolyl isomerase, gliding mot | 99.94 | |
| PRK10902 | 269 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 99.92 | |
| PF00254 | 94 | FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer | 99.88 | |
| PRK15095 | 156 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 99.79 | |
| COG1047 | 174 | SlpA FKBP-type peptidyl-prolyl cis-trans isomerase | 99.74 | |
| PRK10737 | 196 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 99.72 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.67 | |
| TIGR00115 | 408 | tig trigger factor. Trigger factor is a ribosome-a | 99.17 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.15 | |
| PRK01490 | 435 | tig trigger factor; Provisional | 99.11 | |
| COG0544 | 441 | Tig FKBP-type peptidyl-prolyl cis-trans isomerase | 98.92 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 97.93 | |
| KOG0549 | 188 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 97.42 |
| >COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.97 E-value=1.9e-31 Score=214.36 Aligned_cols=109 Identities=38% Similarity=0.655 Sum_probs=103.9
Q ss_pred eeecCCCeEEEEEEcCCCCCCCCCCEEEEEEEEEecCCeEEeccccCCCCCCCCEEEEcCCCcchhHHHHHHcCcccccE
Q 028432 83 TLKLASGVRIQEIIEGEGPEASEGDIVQLNYVCRRSNGYFVHSTVDQFSGESAPVILPLDENKIIKGLKEVLVGMKVGGK 162 (209)
Q Consensus 83 ~~~~~sGl~~~~l~~G~G~~~~~gd~V~v~y~~~~~dG~~~~st~~~~~g~~~p~~f~lG~~~~i~Gl~eaL~gmk~G~~ 162 (209)
..++++|++|++++.|+|+.+..+|.|++||++++.||++|||++++ ++|+.|.+| ++|+||+++|.+|++|++
T Consensus 96 v~~~~sgl~y~~~~~G~G~~~~~~~~V~vhY~G~l~~G~vFDsS~~r----g~p~~f~l~--~vI~Gw~egl~~M~vG~k 169 (205)
T COG0545 96 VKTLPSGLQYKVLKAGDGAAPKKGDTVTVHYTGTLIDGTVFDSSYDR----GQPAEFPLG--GVIPGWDEGLQGMKVGGK 169 (205)
T ss_pred ceECCCCcEEEEEeccCCCCCCCCCEEEEEEEEecCCCCcccccccc----CCCceeecC--CeeehHHHHHhhCCCCce
Confidence 45789999999999999999999999999999999999999999999 899999995 999999999999999999
Q ss_pred EEEEeCCCCCCCCCCCCC-CCCCCCCcccccCCCCCcEEEEEEEEEeC
Q 028432 163 RRALIPPSVGYINENLKP-IPDEFGPRRSLLSHANEPLIFEVQLLKVL 209 (209)
Q Consensus 163 ~~v~vp~~~ayg~~g~~~-iP~~~~~~~~~~i~~~~~l~f~Vell~i~ 209 (209)
|+++||+++|||.++... || ||++|+|+|+|++|+
T Consensus 170 ~~l~IP~~laYG~~g~~g~Ip------------pns~LvFeVeLl~v~ 205 (205)
T COG0545 170 RKLTIPPELAYGERGVPGVIP------------PNSTLVFEVELLDVK 205 (205)
T ss_pred EEEEeCchhccCcCCCCCCCC------------CCCeEEEEEEEEecC
Confidence 999999999999999655 88 999999999999985
|
|
| >KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated | Back alignment and domain information |
|---|
| >PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 | Back alignment and domain information |
|---|
| >PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00115 tig trigger factor | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK01490 tig trigger factor; Provisional | Back alignment and domain information |
|---|
| >COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 209 | ||||
| 2ke0_A | 117 | Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso | 6e-11 | ||
| 4dz3_A | 113 | Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is | 2e-10 | ||
| 2y78_A | 133 | Crystal Structure Of Bpss1823, A Mip-Like Chaperone | 2e-10 | ||
| 3uf8_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 3e-10 | ||
| 4ggq_C | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 5e-10 | ||
| 3vaw_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 5e-10 | ||
| 3uqb_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 7e-10 | ||
| 3uqa_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 1e-09 | ||
| 4dz2_A | 113 | Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is | 2e-08 | ||
| 2pbc_A | 102 | Fk506-Binding Protein 2 Length = 102 | 2e-06 | ||
| 3oe2_A | 219 | 1.6 A Crystal Structure Of Peptidyl-Prolyl Cis-Tran | 1e-05 | ||
| 4dip_A | 125 | Crystal Structure Of Human Peptidyl-Prolyl Cis-Tran | 2e-05 | ||
| 1u79_A | 129 | Crystal Structure Of Atfkbp13 Length = 129 | 5e-05 | ||
| 1yat_A | 113 | Improved Calcineurin Inhibition By Yeast Fkbp12-Dru | 8e-04 |
| >pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 | Back alignment and structure |
|
| >pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 | Back alignment and structure |
| >pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 | Back alignment and structure |
| >pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
| >pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 | Back alignment and structure |
| >pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
| >pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
| >pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
| >pdb|4DZ2|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation R92g From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 | Back alignment and structure |
| >pdb|2PBC|A Chain A, Fk506-Binding Protein 2 Length = 102 | Back alignment and structure |
| >pdb|3OE2|A Chain A, 1.6 A Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase Ppiase From Pseudomonas Syringae Pv. Tomato Str. Dc3000 (Pspto Dc3000) Length = 219 | Back alignment and structure |
| >pdb|4DIP|A Chain A, Crystal Structure Of Human Peptidyl-Prolyl Cis-Trans Isomerase Fkbp14 Length = 125 | Back alignment and structure |
| >pdb|1U79|A Chain A, Crystal Structure Of Atfkbp13 Length = 129 | Back alignment and structure |
| >pdb|1YAT|A Chain A, Improved Calcineurin Inhibition By Yeast Fkbp12-Drug Complexes. Crystallographic And Functional Analysis Length = 113 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 209 | |||
| 3oe2_A | 219 | Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, | 2e-20 | |
| 2y78_A | 133 | Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, | 7e-20 | |
| 4dip_A | 125 | Peptidyl-prolyl CIS-trans isomerase FKBP14; struct | 1e-19 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 4e-19 | |
| 1q6h_A | 224 | FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; | 4e-19 | |
| 1u79_A | 129 | FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T | 1e-18 | |
| 3b7x_A | 134 | FK506-binding protein 6; isomerase, repeat, rotama | 3e-18 | |
| 1fd9_A | 213 | Protein (macrophage infectivity potentiator prote; | 4e-18 | |
| 2f4e_A | 180 | ATFKBP42; FKBP-like, alpha-beta, signaling protein | 9e-18 | |
| 1yat_A | 113 | FK506 binding protein; HET: FK5; 2.50A {Saccharomy | 9e-18 | |
| 3o5e_A | 144 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 2e-17 | |
| 3o5q_A | 128 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 4e-17 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 2e-16 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 9e-13 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 3e-09 | |
| 2lgo_A | 130 | FKBP; infectious disease, isomerase, giardiasis, s | 2e-16 | |
| 1jvw_A | 167 | Macrophage infectivity potentiator; chagas disease | 3e-16 | |
| 2awg_A | 118 | 38 kDa FK-506 binding protein; FKBP-type, ppiase, | 4e-16 | |
| 2ppn_A | 107 | FK506-binding protein 1A; high resolution protein | 5e-16 | |
| 2d9f_A | 135 | FK506-binding protein 8 variant; FKBP, rapamycin, | 1e-15 | |
| 3kz7_A | 119 | FK506-binding protein 3; FKPB ppiase rapamycin, is | 1e-15 | |
| 1r9h_A | 135 | FKB-6, FK506 binding protein family; structural ge | 2e-15 | |
| 2jwx_A | 157 | FKBP38NTD, FK506-binding protein 8 variant; apopto | 4e-15 | |
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 9e-15 | |
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 4e-09 | |
| 2pbc_A | 102 | FK506-binding protein 2; endoplasmic reticulum, is | 1e-14 | |
| 2vn1_A | 129 | 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR | 2e-14 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 7e-14 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 2e-04 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 8e-10 | |
| 4dt4_A | 169 | FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; | 2e-06 | |
| 2kfw_A | 196 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD | 7e-06 | |
| 2k8i_A | 171 | SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, | 1e-05 | |
| 1ix5_A | 151 | FKBP; ppiase, isomerase; NMR {Methanothermococcust | 1e-05 | |
| 2kr7_A | 151 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; | 7e-05 | |
| 3pr9_A | 157 | FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB | 2e-04 | |
| 3prb_A | 231 | FKBP-type peptidyl-prolyl CIS-trans isomerase; cha | 4e-04 | |
| 3cgm_A | 158 | SLYD, peptidyl-prolyl CIS-trans isomerase; chapero | 7e-04 |
| >3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 | Back alignment and structure |
|---|
Score = 84.0 bits (208), Expect = 2e-20
Identities = 31/125 (24%), Positives = 47/125 (37%), Gaps = 22/125 (17%)
Query: 85 KLASGVRIQEIIEGEGPEASEGDIVQLNYVCRRSNGYFVHSTVDQFSGESAPVILPLDEN 144
+LA G+ + E+ G GP+ V++ YV G + S + P L +
Sbjct: 114 ELADGILMTELTPGTGPKPDANGRVEVRYV-----GRLPDGKIFDQSTQ--PQWFRL--D 164
Query: 145 KIIKGLKEVLVGMKVGGKRRALIPPSVGY-INENLKPIPDEFGPRRSLLSHANEPLIFEV 203
+I G L M G K R +IP Y I PL+FE+
Sbjct: 165 SVISGWTSALQNMPTGAKWRLVIPSDQAYGAEGAGDLID------------PFTPLVFEI 212
Query: 204 QLLKV 208
+L+ V
Sbjct: 213 ELIAV 217
|
| >2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 | Back alignment and structure |
|---|
| >4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 | Back alignment and structure |
|---|
| >1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 | Back alignment and structure |
|---|
| >1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 | Back alignment and structure |
|---|
| >3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 | Back alignment and structure |
|---|
| >2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 | Back alignment and structure |
|---|
| >3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 | Back alignment and structure |
|---|
| >3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 | Back alignment and structure |
|---|
| >2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 | Back alignment and structure |
|---|
| >1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 | Back alignment and structure |
|---|
| >2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 | Back alignment and structure |
|---|
| >2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 | Back alignment and structure |
|---|
| >2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 | Back alignment and structure |
|---|
| >1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 | Back alignment and structure |
|---|
| >2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 | Back alignment and structure |
|---|
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 | Back alignment and structure |
|---|
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 | Back alignment and structure |
|---|
| >2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 | Back alignment and structure |
|---|
| >2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 | Back alignment and structure |
|---|
| >4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 | Back alignment and structure |
|---|
| >2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 | Back alignment and structure |
|---|
| >2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 | Back alignment and structure |
|---|
| >1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 | Back alignment and structure |
|---|
| >2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Length = 151 | Back alignment and structure |
|---|
| >3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} PDB: 3pra_A Length = 157 | Back alignment and structure |
|---|
| >3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Length = 231 | Back alignment and structure |
|---|
| >3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Length = 158 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 209 | |||
| 1yat_A | 113 | FK506 binding protein; HET: FK5; 2.50A {Saccharomy | 99.96 | |
| 3kz7_A | 119 | FK506-binding protein 3; FKPB ppiase rapamycin, is | 99.95 | |
| 2y78_A | 133 | Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, | 99.95 | |
| 2ppn_A | 107 | FK506-binding protein 1A; high resolution protein | 99.95 | |
| 3o5q_A | 128 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 99.95 | |
| 3o5e_A | 144 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 99.95 | |
| 4dip_A | 125 | Peptidyl-prolyl CIS-trans isomerase FKBP14; struct | 99.95 | |
| 2lgo_A | 130 | FKBP; infectious disease, isomerase, giardiasis, s | 99.95 | |
| 1jvw_A | 167 | Macrophage infectivity potentiator; chagas disease | 99.95 | |
| 1u79_A | 129 | FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T | 99.95 | |
| 3b7x_A | 134 | FK506-binding protein 6; isomerase, repeat, rotama | 99.94 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 99.94 | |
| 1r9h_A | 135 | FKB-6, FK506 binding protein family; structural ge | 99.94 | |
| 1fd9_A | 213 | Protein (macrophage infectivity potentiator prote; | 99.94 | |
| 2lkn_A | 165 | AH receptor-interacting protein; FKBP-type domain, | 99.94 | |
| 2f4e_A | 180 | ATFKBP42; FKBP-like, alpha-beta, signaling protein | 99.94 | |
| 1q6h_A | 224 | FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; | 99.94 | |
| 2vn1_A | 129 | 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR | 99.94 | |
| 3oe2_A | 219 | Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, | 99.94 | |
| 2jwx_A | 157 | FKBP38NTD, FK506-binding protein 8 variant; apopto | 99.93 | |
| 2awg_A | 118 | 38 kDa FK-506 binding protein; FKBP-type, ppiase, | 99.93 | |
| 2d9f_A | 135 | FK506-binding protein 8 variant; FKBP, rapamycin, | 99.92 | |
| 2pbc_A | 102 | FK506-binding protein 2; endoplasmic reticulum, is | 99.91 | |
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 99.91 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.89 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 99.88 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 99.88 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 99.87 | |
| 4dt4_A | 169 | FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; | 99.83 | |
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 99.82 | |
| 1hxv_A | 113 | Trigger factor; FKBP fold, ppiase, chaperone; NMR | 99.82 | |
| 3pr9_A | 157 | FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB | 99.8 | |
| 2kfw_A | 196 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD | 99.79 | |
| 2k8i_A | 171 | SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, | 99.79 | |
| 2kr7_A | 151 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; | 99.79 | |
| 3prb_A | 231 | FKBP-type peptidyl-prolyl CIS-trans isomerase; cha | 99.77 | |
| 1ix5_A | 151 | FKBP; ppiase, isomerase; NMR {Methanothermococcust | 99.77 | |
| 3cgm_A | 158 | SLYD, peptidyl-prolyl CIS-trans isomerase; chapero | 99.71 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.67 | |
| 1w26_A | 432 | Trigger factor, TF; chaperone, protein folding, ri | 99.54 | |
| 1t11_A | 392 | Trigger factor, TF; helix-turn-helix, four-helix-b | 99.41 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.34 | |
| 3gty_X | 433 | Trigger factor, TF; chaperone-client complex, cell | 98.24 |
| >1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 | Back alignment and structure |
|---|
Probab=99.96 E-value=2.6e-28 Score=181.08 Aligned_cols=109 Identities=32% Similarity=0.533 Sum_probs=102.6
Q ss_pred ecCCCeEEEEEEcCCCCC-CCCCCEEEEEEEEEecCCeEEeccccCCCCCCCCEEEEcCCCcchhHHHHHHcCcccccEE
Q 028432 85 KLASGVRIQEIIEGEGPE-ASEGDIVQLNYVCRRSNGYFVHSTVDQFSGESAPVILPLDENKIIKGLKEVLVGMKVGGKR 163 (209)
Q Consensus 85 ~~~sGl~~~~l~~G~G~~-~~~gd~V~v~y~~~~~dG~~~~st~~~~~g~~~p~~f~lG~~~~i~Gl~eaL~gmk~G~~~ 163 (209)
.+++|++|+++++|+|.. ++.||.|++||++++.||++|++++++ ++|+.|.+|.+++++||+++|.+|++|+++
T Consensus 3 ~~~~g~~~~~~~~G~g~~~~~~gd~V~v~y~~~~~dG~~~d~s~~~----~~p~~f~lG~~~~i~g~e~~l~gm~~Ge~~ 78 (113)
T 1yat_A 3 VIEGNVKIDRISPGDGATFPKTGDLVTIHYTGTLENGQKFDSSVDR----GSPFQCNIGVGQVIKGWDVGIPKLSVGEKA 78 (113)
T ss_dssp ECGGGCEEEEEECCCSSCCCCTTCEEEEEEEEEETTSCEEEESTTT----TCCEEEETTSSSSCHHHHHHGGGCCTTCEE
T ss_pred CCCCCeEEEEEECCCCcccCCCCCEEEEEEEEEECCCCEEEecCCC----CCcEEEEeCCCCccHHHHHHHhCCCCCCEE
Confidence 468999999999999998 999999999999998899999999875 689999999999999999999999999999
Q ss_pred EEEeCCCCCCCCCCCCC-CCCCCCCcccccCCCCCcEEEEEEEEEeC
Q 028432 164 RALIPPSVGYINENLKP-IPDEFGPRRSLLSHANEPLIFEVQLLKVL 209 (209)
Q Consensus 164 ~v~vp~~~ayg~~g~~~-iP~~~~~~~~~~i~~~~~l~f~Vell~i~ 209 (209)
++.||++++||+.+..+ || +|++|+|+|+|++|+
T Consensus 79 ~v~ip~~~ayG~~~~~~~Ip------------~~~~l~f~vel~~ik 113 (113)
T 1yat_A 79 RLTIPGPYAYGPRGFPGLIP------------PNSTLVFDVELLKVN 113 (113)
T ss_dssp EEEECGGGTTTTTCBTTTBC------------TTCCEEEEEEEEEEC
T ss_pred EEEECHHHCcCCCCCCCCcC------------CCCeEEEEEEEEEeC
Confidence 99999999999988654 77 999999999999986
|
| >3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* | Back alignment and structure |
|---|
| >2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* | Back alignment and structure |
|---|
| >2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... | Back alignment and structure |
|---|
| >3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A | Back alignment and structure |
|---|
| >3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A | Back alignment and structure |
|---|
| >4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} | Back alignment and structure |
|---|
| >1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A | Back alignment and structure |
|---|
| >3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* | Back alignment and structure |
|---|
| >1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* | Back alignment and structure |
|---|
| >2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A | Back alignment and structure |
|---|
| >2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A | Back alignment and structure |
|---|
| >3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 | Back alignment and structure |
|---|
| >2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A | Back alignment and structure |
|---|
| >2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A | Back alignment and structure |
|---|
| >4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} | Back alignment and structure |
|---|
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A | Back alignment and structure |
|---|
| >1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A | Back alignment and structure |
|---|
| >2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A | Back alignment and structure |
|---|
| >1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 | Back alignment and structure |
|---|
| >1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 209 | ||||
| d1u79a_ | 125 | d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha | 3e-14 | |
| d1yata_ | 113 | d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas | 4e-14 | |
| d1q6ha_ | 210 | d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 5e-14 | |
| d1q1ca1 | 120 | d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu | 2e-13 | |
| d1kt1a2 | 111 | d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo | 5e-13 | |
| d1kt1a3 | 115 | d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M | 3e-12 | |
| d1r9ha_ | 118 | d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd | 3e-12 | |
| d1pbka_ | 116 | d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: | 1e-11 | |
| d1fd9a_ | 204 | d.26.1.1 (A:) Macrophage infectivity potentiator p | 1e-11 | |
| d1q1ca2 | 117 | d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H | 2e-11 | |
| d2ppna1 | 107 | d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) | 4e-11 | |
| d1hxva_ | 85 | d.26.1.1 (A:) Trigger factor PPIase domain {Mycopl | 9e-09 | |
| d1jvwa_ | 160 | d.26.1.1 (A:) Macrophage infectivity potentiator p | 2e-07 | |
| d1ix5a_ | 151 | d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu | 0.002 |
| >d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: FKBP-like superfamily: FKBP-like family: FKBP immunophilin/proline isomerase domain: FKBP13 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 64.5 bits (156), Expect = 3e-14
Identities = 29/130 (22%), Positives = 50/130 (38%), Gaps = 16/130 (12%)
Query: 85 KLASGVRIQEIIEGEGPEASEGDIVQLNYVCRRSNGYFVHSTVD-----QFSGESAPVIL 139
SG+ + + G GPEA +G +++ +YV + NG S+ + F VI
Sbjct: 5 VSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVGEVIK 64
Query: 140 PLDENKIIKGLKEVLVGMKVGGKRRALIPPSVGYINENLKPIPDEFG-PRRSLLSHANEP 198
D+ + + M GGKR IPP + Y + P
Sbjct: 65 GWDQG---ILGSDGIPPMLTGGKRTLRIPPELAYGDRGAGCKGGSCLIP-------PASV 114
Query: 199 LIFEVQLLKV 208
L+F+++ +
Sbjct: 115 LLFDIEYIGK 124
|
| >d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 | Back information, alignment and structure |
|---|
| >d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 | Back information, alignment and structure |
|---|
| >d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 | Back information, alignment and structure |
|---|
| >d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 | Back information, alignment and structure |
|---|
| >d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 | Back information, alignment and structure |
|---|
| >d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 | Back information, alignment and structure |
|---|
| >d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 | Back information, alignment and structure |
|---|
| >d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 | Back information, alignment and structure |
|---|
| >d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 209 | |||
| d2ppna1 | 107 | FK-506 binding protein (FKBP12), an immunophilin { | 99.96 | |
| d1q1ca1 | 120 | FKBP52, N-terminal domains {Human (Homo sapiens) [ | 99.96 | |
| d1q6ha_ | 210 | Peptidyl-prolyl cis-trans isomerase FkpA {Escheric | 99.96 | |
| d1yata_ | 113 | Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc | 99.96 | |
| d1r9ha_ | 118 | FKB-6, N-terminal domain {Caenorhabditis elegans [ | 99.96 | |
| d1kt1a2 | 111 | FKBP51, N-terminal domains {Monkey (Saimiri bolivi | 99.96 | |
| d1fd9a_ | 204 | Macrophage infectivity potentiator protein (MIP) { | 99.96 | |
| d1u79a_ | 125 | FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: | 99.96 | |
| d1pbka_ | 116 | FKBP25 {Human (Homo sapiens) [TaxId: 9606]} | 99.95 | |
| d1jvwa_ | 160 | Macrophage infectivity potentiator protein (MIP) { | 99.94 | |
| d1kt1a3 | 115 | FKBP51, N-terminal domains {Monkey (Saimiri bolivi | 99.91 | |
| d1q1ca2 | 117 | FKBP52, N-terminal domains {Human (Homo sapiens) [ | 99.89 | |
| d1ix5a_ | 151 | Archaeal FKBP {Archaeon Methanococcus thermolithot | 99.77 | |
| d1hxva_ | 85 | Trigger factor PPIase domain {Mycoplasma genitaliu | 99.71 | |
| d1l1pa_ | 106 | Trigger factor PPIase domain {Escherichia coli [Ta | 99.33 | |
| d1t11a3 | 113 | Trigger factor PPIase domain {Vibrio cholerae [Tax | 99.24 | |
| d2f23a2 | 79 | GreA transcript cleavage factor, C-terminal domain | 84.95 |
| >d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: FKBP-like superfamily: FKBP-like family: FKBP immunophilin/proline isomerase domain: FK-506 binding protein (FKBP12), an immunophilin species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96 E-value=8.3e-30 Score=186.12 Aligned_cols=105 Identities=28% Similarity=0.506 Sum_probs=99.8
Q ss_pred CeEEEEEEcCCCCC-CCCCCEEEEEEEEEecCCeEEeccccCCCCCCCCEEEEcCCCcchhHHHHHHcCcccccEEEEEe
Q 028432 89 GVRIQEIIEGEGPE-ASEGDIVQLNYVCRRSNGYFVHSTVDQFSGESAPVILPLDENKIIKGLKEVLVGMKVGGKRRALI 167 (209)
Q Consensus 89 Gl~~~~l~~G~G~~-~~~gd~V~v~y~~~~~dG~~~~st~~~~~g~~~p~~f~lG~~~~i~Gl~eaL~gmk~G~~~~v~v 167 (209)
|++|+++++|+|.. |+.||.|++||++++.||++|++++++ ++|+.|.+|.+++++||+++|.+|++|++++++|
T Consensus 1 Gv~~~~l~~G~G~~~p~~gd~V~v~y~g~l~dG~~~d~s~~~----~~p~~~~~g~~~~i~G~~~~l~~M~~Ge~~~~~i 76 (107)
T d2ppna1 1 GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDR----NKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTI 76 (107)
T ss_dssp CEEEEEEECCCSSCCCCTTCEEEEEEEEEETTSCEEEEHHHH----TSCEEEETTSCCSCHHHHHHHTTCCTTCEEEEEE
T ss_pred CcEEEEEECcCCccCCCCCCEEEEEEEEEecCCeEEEeeecc----ceeeeEeeCcchhheeehhhhcCccCCCEEEEEE
Confidence 79999999999986 799999999999999999999999987 7899999999999999999999999999999999
Q ss_pred CCCCCCCCCCCCC-CCCCCCCcccccCCCCCcEEEEEEEEEeC
Q 028432 168 PPSVGYINENLKP-IPDEFGPRRSLLSHANEPLIFEVQLLKVL 209 (209)
Q Consensus 168 p~~~ayg~~g~~~-iP~~~~~~~~~~i~~~~~l~f~Vell~i~ 209 (209)
||+++||..+..+ || ||++|+|+|+|++|+
T Consensus 77 p~~laYG~~g~~~~IP------------p~s~lif~ieL~~vk 107 (107)
T d2ppna1 77 SPDYAYGATGHPGIIP------------PHATLVFDVELLKLE 107 (107)
T ss_dssp CGGGTTTTTCBTTTBC------------TTCCEEEEEEEEEEC
T ss_pred CHHHhCCCCCCCCCCC------------cCCeEEEEEEEEEEC
Confidence 9999999998754 78 999999999999996
|
| >d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} | Back information, alignment and structure |
|---|
| >d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} | Back information, alignment and structure |
|---|
| >d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2f23a2 d.26.1.2 (A:78-156) GreA transcript cleavage factor, C-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|