Citrus Sinensis ID: 028525


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MGPMKKMKRKKMNFRMVILSLIVKRTRIKALVKDKRNAMESFGTYVESMAGDASNKKFLKTALRGVRSIICPSEGFISNAGSLKGVQHVILLSQLSVYRGSGGIQALMKGNARKLAEQDESMLMASGIPYTIIRTGVLQNTPGGKQGFQFEEGCAANGSLSKEDAAFICVEALESIPQTGLIFEVVNGEEKVSDWKKCFSRLMEKTGK
cccccccccccccHHHHHHHHHHccccEEEEEEccccccHHcccccEEEEEccccHHHHHHHHccccEEEEccccccccccccccccEEEEEEEEcccccccccHHHHcHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccEEEcccccccccccHHHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHHHHHHHHcc
cccHHHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHccccEEEEEEccccHHHHHHHHccccEEEEcccccHHHHHHHccccEEEEEEEccccccccccHHcccHHHHHHHHHHHHHHHHccccEEEEEcccccccccccEEEEEEccccccccccHHHHHHHHHHHHHcccccccEEEEEccccccccHHHHHHHHHHHccc
mgpmkkmkrkkMNFRMVILSLIVKRTRIKALVKDKRNAMESFGTYVESMAGDASNKKFLKTALRGVRsiicpsegfisnagslkgVQHVILLSQLSvyrgsggiqALMKGNARKLAEQDESMLmasgipytiirtgvlqntpggkqgfqfeegcaangslskEDAAFICVEALesipqtgliFEVVNGEEKVSDWKKCFSRLMEKTGK
mgpmkkmkrkkmnfRMVILSLIVKRTRIKALVKDKRNAMESFGTYvesmagdasnKKFLKTALRGVRSIICPSEGFISNAGSLKGVQHVILLSQLSVYRGSGGIQALMKGNARKLAEQDESMLMASGIPYTIIRTGVLQNTPGGKQGFQFEEGCAANGSLSKEDAAFICVEALESIPQTGLIFEvvngeekvsdWKKCFSRLMEKTGK
MGPmkkmkrkkmNFRMVILSLIVKRTRIKALVKDKRNAMESFGTYVESMAGDASNKKFLKTALRGVRSIICPSEGFISNAGSLKGVQHVILLSQLSVYRGSGGIQALMKGNARKLAEQDESMLMASGIPYTIIRTGVLQNTPGGKQGFQFEEGCAANGSLSKEDAAFICVEALESIPQTGLIFEVVNGEEKVSDWKKCFSRLMEKTGK
************NFRMVILSLIVKRTRIKALVKDKRNAMESFGTYVESMAGDASNKKFLKTALRGVRSIICPSEGFISNAGSLKGVQHVILLSQLSVYRGSGGIQALMKGN**********MLMASGIPYTIIRTGVLQNTPGGKQGFQFEEGCAANGSLSKEDAAFICVEALESIPQTGLIFEVVNGEEKVSDWKKCFS********
**************RMVILSLIVKRTRIKALVKDKRNAMESFGTYVESMAGDASNKKFLKTALRGVRSIICPSEGFISNAGSLKGVQHVILLSQLSVYRGSGGIQALMKGNARKLAEQDESMLMASGIPYTIIRTGVLQNTPGGKQGFQFEEGCAANGSLSKEDAAFICVEALESIPQTGLIFEVVNGEEKVSDWKKCFS*LME****
*********KKMNFRMVILSLIVKRTRIKALVKDKRNAMESFGTYVESMAGDASNKKFLKTALRGVRSIICPSEGFISNAGSLKGVQHVILLSQLSVYRGSGGIQALMKGNARKLAEQDESMLMASGIPYTIIRTGVLQNTPGGKQGFQFEEGCAANGSLSKEDAAFICVEALESIPQTGLIFEVVNGEEKVSDWKKCFSRLMEKTGK
*GP*KKMKRKKMNFRMVILSLIVKRTRIKALVKDKRNAMESFGTYVESMAGDASNKKFLKTALRGVRSIICPSEGFISNAGSLKGVQHVILLSQLSVYRGSGGIQALMKGNARKLAEQDESMLMASGIPYTIIRTGVLQNTPGGKQGFQFEEGCAANGSLSKEDAAFICVEALESIPQTGLIFEVVNGEEKVSDWKKCFSRLMEKT**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGPMKKMKRKKMNFRMVILSLIVKRTRIKALVKDKRNAMESFGTYVESMAGDASNKKFLKTALRGVRSIICPSEGFISNAGSLKGVQHVILLSQLSVYRGSGGIQALMKGNARKLAEQDESMLMASGIPYTIIRTGVLQNTPGGKQGFQFEEGCAANGSLSKEDAAFICVEALESIPQTGLIFEVVNGEEKVSDWKKCFSRLMEKTGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
224073720306 predicted protein [Populus trichocarpa] 0.923 0.627 0.781 7e-84
255560651302 conserved hypothetical protein [Ricinus 0.918 0.632 0.785 9e-84
225442154303 PREDICTED: uncharacterized protein LOC10 0.932 0.640 0.757 1e-82
356561047 312 PREDICTED: uncharacterized protein LOC10 0.932 0.621 0.711 3e-80
356522384 316 PREDICTED: uncharacterized protein LOC10 0.932 0.613 0.711 2e-79
37991868 310 expressed protein [Oryza sativa Japonica 0.889 0.596 0.679 2e-68
218193028308 hypothetical protein OsI_12007 [Oryza sa 0.889 0.600 0.679 2e-68
297842009 311 hypothetical protein ARALYDRAFT_476397 [ 0.918 0.614 0.628 6e-66
326490477299 predicted protein [Hordeum vulgare subsp 0.918 0.638 0.630 3e-65
242035497 312 hypothetical protein SORBIDRAFT_01g03274 0.918 0.612 0.630 4e-65
>gi|224073720|ref|XP_002304142.1| predicted protein [Populus trichocarpa] gi|222841574|gb|EEE79121.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  315 bits (807), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 171/192 (89%)

Query: 15  RMVILSLIVKRTRIKALVKDKRNAMESFGTYVESMAGDASNKKFLKTALRGVRSIICPSE 74
           +M+ILSLIVK+ R+KALVKDKR AME+FGTYVESMAGDAS+K FLK ALRGVR+IICP+E
Sbjct: 110 QMIILSLIVKKARVKALVKDKRTAMEAFGTYVESMAGDASSKPFLKKALRGVRAIICPNE 169

Query: 75  GFISNAGSLKGVQHVILLSQLSVYRGSGGIQALMKGNARKLAEQDESMLMASGIPYTIIR 134
           GF+SN G L+GV+HVILLSQLSVYRGSGGIQALMK NARKLAE+DES L+ASGIPYTIIR
Sbjct: 170 GFLSNGGDLQGVKHVILLSQLSVYRGSGGIQALMKNNARKLAEKDESTLVASGIPYTIIR 229

Query: 135 TGVLQNTPGGKQGFQFEEGCAANGSLSKEDAAFICVEALESIPQTGLIFEVVNGEEKVSD 194
            G+LQ+TPGG QGF FE+G A  GSLSKEDAAFICVEAL+ +PQ G  FE VNGEEKVSD
Sbjct: 230 VGMLQDTPGGTQGFSFEKGSAEKGSLSKEDAAFICVEALDVVPQIGFTFEAVNGEEKVSD 289

Query: 195 WKKCFSRLMEKT 206
           WK+  +RLMEK+
Sbjct: 290 WKERLTRLMEKS 301




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255560651|ref|XP_002521339.1| conserved hypothetical protein [Ricinus communis] gi|223539417|gb|EEF41007.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|225442154|ref|XP_002274144.1| PREDICTED: uncharacterized protein LOC100246327 [Vitis vinifera] gi|297743019|emb|CBI35886.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356561047|ref|XP_003548797.1| PREDICTED: uncharacterized protein LOC100806043 [Glycine max] Back     alignment and taxonomy information
>gi|356522384|ref|XP_003529826.1| PREDICTED: uncharacterized protein LOC100801216 [Glycine max] Back     alignment and taxonomy information
>gi|37991868|gb|AAR06314.1| expressed protein [Oryza sativa Japonica Group] gi|108708765|gb|ABF96560.1| expressed protein [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|218193028|gb|EEC75455.1| hypothetical protein OsI_12007 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|297842009|ref|XP_002888886.1| hypothetical protein ARALYDRAFT_476397 [Arabidopsis lyrata subsp. lyrata] gi|297334727|gb|EFH65145.1| hypothetical protein ARALYDRAFT_476397 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|326490477|dbj|BAJ84902.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|242035497|ref|XP_002465143.1| hypothetical protein SORBIDRAFT_01g032740 [Sorghum bicolor] gi|241918997|gb|EER92141.1| hypothetical protein SORBIDRAFT_01g032740 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
TAIR|locus:2030270312 AT1G72640 [Arabidopsis thalian 0.918 0.612 0.628 5.5e-61
TAIR|locus:2015651598 HCF173 "high chlorophyll fluor 0.408 0.142 0.360 1.6e-05
TAIR|locus:2185228253 AT5G02240 [Arabidopsis thalian 0.610 0.501 0.259 0.00025
TAIR|locus:2030270 AT1G72640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 624 (224.7 bits), Expect = 5.5e-61, P = 5.5e-61
 Identities = 120/191 (62%), Positives = 151/191 (79%)

Query:    15 RMVILSLIVKRTRIKALVKDKRNAMESFGTYVESMAGDASNKKFLKTALRGVRSIICPSE 74
             +M+IL LIVK TR+KALVKDKR A+E+FG+YVE   GDAS+++FLK A +GV ++I P+E
Sbjct:   117 QMIILQLIVKGTRVKALVKDKRKALEAFGSYVELTTGDASDERFLKKAFKGVGAVISPTE 176

Query:    75 GFISNAGSLKGVQHVILLSQLSVYRGSGGIQALMKGNARKLAEQDESMLMASGIPYTIIR 134
             GF+S   S +GV+H +LLSQLSVY  SGGIQA+M   A+KLAEQDE+  ++S +PYTIIR
Sbjct:   177 GFLSIVKSFRGVKHAVLLSQLSVYESSGGIQAMMNSKAKKLAEQDENAAISSNVPYTIIR 236

Query:   135 TGVLQNTPGGKQGFQFEEGCAANGSLSKEDAAFICVEALESIPQTGLIFEVVNGEEKVSD 194
             TG L+N+PGG QGF F  G AA GS+SKEDAA ICVEAL  IP TGLIFEV NGEE VSD
Sbjct:   237 TGKLENSPGGSQGFNFSAGAAAKGSISKEDAARICVEALSVIPPTGLIFEVTNGEEVVSD 296

Query:   195 WKKCFSRLMEK 205
             W+    ++M++
Sbjct:   297 WEGQLMKVMQR 307




GO:0000166 "nucleotide binding" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
TAIR|locus:2015651 HCF173 "high chlorophyll fluorescence phenotype 173" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2185228 AT5G02240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
cd05243203 cd05243, SDR_a5, atypical (a) SDRs, subgroup 5 8e-15
pfam13460182 pfam13460, NAD_binding_10, NADH(P)-binding 1e-13
cd05251242 cd05251, NmrA_like_SDR_a, NmrA (a transcriptional 1e-05
cd05269272 cd05269, TMR_SDR_a, triphenylmethane reductase (TM 3e-05
COG0702275 COG0702, COG0702, Predicted nucleoside-diphosphate 2e-04
PLN00141251 PLN00141, PLN00141, Tic62-NAD(P)-related group II 0.003
cd05226176 cd05226, SDR_e_a, Extended (e) and atypical (a) SD 0.004
cd05231259 cd05231, NmrA_TMR_like_1_SDR_a, NmrA (a transcript 0.004
>gnl|CDD|187554 cd05243, SDR_a5, atypical (a) SDRs, subgroup 5 Back     alignment and domain information
 Score = 69.6 bits (171), Expect = 8e-15
 Identities = 48/183 (26%), Positives = 85/183 (46%), Gaps = 24/183 (13%)

Query: 27  RIKALVKDKRNAMESFGTYVESMAGDASNKKFLKTALRGVRSIIC-----PSEG----FI 77
           +++ALV+D   A +      E + GD ++ + L  AL G+ ++I         G     +
Sbjct: 25  QVRALVRDPSQAEKLEAAGAEVVVGDLTDAESLAAALEGIDAVISAAGSGGKGGPRTEAV 84

Query: 78  SNAGSLK--------GVQHVILLSQLSVYRGSGGIQALMKG-NARKLAEQDESMLMASGI 128
              G++         GV+  +L+S +   + S  ++AL    +A++ AE     L ASG+
Sbjct: 85  DYDGNINLIDAAKKAGVKRFVLVSSIGADKPSHPLEALGPYLDAKRKAED---YLRASGL 141

Query: 129 PYTIIR-TGVLQNTPGGKQGFQFEEGCAANGSLSKEDAAFICVEALESIPQT-GLIFEVV 186
            YTI+R  G+  +  G  +     +G   +G +S+ D A +  EAL   P   G  FE+ 
Sbjct: 142 DYTIVRPGGLTDDPAGTGRVVLGGDGTRLDGPISRADVAEVLAEAL-DTPAAIGKTFELG 200

Query: 187 NGE 189
            G+
Sbjct: 201 GGD 203


This subgroup contains atypical SDRs, some of which are identified as putative NAD(P)-dependent epimerases, one as a putative NAD-dependent epimerase/dehydratase. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine-rich NAD(P)-binding motif that is very similar to the extended SDRs, GXXGXXG, and binds NADP. Generally, this subgroup has poor conservation of the active site tetrad; however, individual sequences do contain matches to the YXXXK active site motif, the upstream Ser, and there is a highly conserved Asp in place of the usual active site Asn throughout the subgroup. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Length = 203

>gnl|CDD|222146 pfam13460, NAD_binding_10, NADH(P)-binding Back     alignment and domain information
>gnl|CDD|187561 cd05251, NmrA_like_SDR_a, NmrA (a transcriptional regulator) and HSCARG (an NADPH sensor) like proteins, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187578 cd05269, TMR_SDR_a, triphenylmethane reductase (TMR)-like proteins, NMRa-like, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|223774 COG0702, COG0702, Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|215072 PLN00141, PLN00141, Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>gnl|CDD|187537 cd05226, SDR_e_a, Extended (e) and atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187542 cd05231, NmrA_TMR_like_1_SDR_a, NmrA (a transcriptional regulator) and triphenylmethane reductase (TMR) like proteins, subgroup 1, atypical (a) SDRs Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 208
CHL00194317 ycf39 Ycf39; Provisional 99.96
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 99.94
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 99.94
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 99.93
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 99.93
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 99.93
PLN00016378 RNA-binding protein; Provisional 99.92
PLN02427386 UDP-apiose/xylose synthase 99.92
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 99.92
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.91
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.91
PLN02695370 GDP-D-mannose-3',5'-epimerase 99.9
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 99.9
PLN02214342 cinnamoyl-CoA reductase 99.9
PLN03209 576 translocon at the inner envelope of chloroplast su 99.89
PRK11908347 NAD-dependent epimerase/dehydratase family protein 99.88
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.88
PLN02572442 UDP-sulfoquinovose synthase 99.87
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 99.87
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.87
COG2910211 Putative NADH-flavin reductase [General function p 99.87
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 99.86
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.86
PLN00198338 anthocyanidin reductase; Provisional 99.86
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 99.86
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 99.86
PLN02650351 dihydroflavonol-4-reductase 99.86
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.86
PLN02166436 dTDP-glucose 4,6-dehydratase 99.85
PRK05865 854 hypothetical protein; Provisional 99.85
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.85
PLN02583297 cinnamoyl-CoA reductase 99.85
PRK07201 657 short chain dehydrogenase; Provisional 99.84
PLN02260 668 probable rhamnose biosynthetic enzyme 99.84
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.84
PLN02686367 cinnamoyl-CoA reductase 99.84
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.84
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.83
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 99.83
PLN02896353 cinnamyl-alcohol dehydrogenase 99.83
PLN02206442 UDP-glucuronate decarboxylase 99.83
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 99.83
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.81
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 99.81
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 99.81
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.8
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.8
PLN02653340 GDP-mannose 4,6-dehydratase 99.8
PLN02240352 UDP-glucose 4-epimerase 99.8
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 99.8
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 99.8
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 99.8
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 99.79
KOG2865391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 99.78
TIGR01746367 Thioester-redct thioester reductase domain. It has 99.78
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 99.77
PLN02996 491 fatty acyl-CoA reductase 99.77
PRK12320 699 hypothetical protein; Provisional 99.72
KOG1203411 consensus Predicted dehydrogenase [Carbohydrate tr 99.72
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 99.72
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.72
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 99.71
KOG1430361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 99.71
KOG1371343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 99.69
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.68
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.68
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.67
PRK06482276 short chain dehydrogenase; Provisional 99.67
PRK05875276 short chain dehydrogenase; Provisional 99.67
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.65
PRK12828239 short chain dehydrogenase; Provisional 99.65
PRK08263275 short chain dehydrogenase; Provisional 99.65
PRK06180277 short chain dehydrogenase; Provisional 99.63
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.63
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.62
PRK07454241 short chain dehydrogenase; Provisional 99.61
PRK06182273 short chain dehydrogenase; Validated 99.61
PRK07326237 short chain dehydrogenase; Provisional 99.6
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.6
PRK12829264 short chain dehydrogenase; Provisional 99.6
PRK06138252 short chain dehydrogenase; Provisional 99.59
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 99.59
PRK06914280 short chain dehydrogenase; Provisional 99.59
PRK09291257 short chain dehydrogenase; Provisional 99.59
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 99.58
PRK07825273 short chain dehydrogenase; Provisional 99.58
PRK08219227 short chain dehydrogenase; Provisional 99.58
PRK07775274 short chain dehydrogenase; Provisional 99.58
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.58
PRK05993277 short chain dehydrogenase; Provisional 99.58
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 99.57
PRK12939250 short chain dehydrogenase; Provisional 99.57
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.57
COG0300265 DltE Short-chain dehydrogenases of various substra 99.56
PRK07074257 short chain dehydrogenase; Provisional 99.56
PRK10538248 malonic semialdehyde reductase; Provisional 99.56
PRK09186256 flagellin modification protein A; Provisional 99.56
PRK06179270 short chain dehydrogenase; Provisional 99.56
PRK07060245 short chain dehydrogenase; Provisional 99.55
PRK12746254 short chain dehydrogenase; Provisional 99.55
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.55
PRK05876275 short chain dehydrogenase; Provisional 99.55
PRK07904253 short chain dehydrogenase; Provisional 99.54
PRK07806248 short chain dehydrogenase; Provisional 99.54
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.54
PRK12827249 short chain dehydrogenase; Provisional 99.53
KOG0747331 consensus Putative NAD+-dependent epimerases [Carb 99.52
PRK05650270 short chain dehydrogenase; Provisional 99.52
PLN02503 605 fatty acyl-CoA reductase 2 99.52
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.51
PRK07067257 sorbitol dehydrogenase; Provisional 99.51
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.51
PLN02778298 3,5-epimerase/4-reductase 99.5
PRK07102243 short chain dehydrogenase; Provisional 99.5
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.5
PRK07774250 short chain dehydrogenase; Provisional 99.5
PRK06841255 short chain dehydrogenase; Provisional 99.5
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.49
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.49
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 99.49
PRK06181263 short chain dehydrogenase; Provisional 99.49
PRK07577234 short chain dehydrogenase; Provisional 99.49
PRK08017256 oxidoreductase; Provisional 99.49
PRK08264238 short chain dehydrogenase; Validated 99.49
KOG4039238 consensus Serine/threonine kinase TIP30/CC3 [Signa 99.48
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.48
PRK07109334 short chain dehydrogenase; Provisional 99.48
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.48
PRK08267260 short chain dehydrogenase; Provisional 99.48
PRK07063260 short chain dehydrogenase; Provisional 99.47
PRK07024257 short chain dehydrogenase; Provisional 99.47
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.46
PRK08628258 short chain dehydrogenase; Provisional 99.46
PRK08265261 short chain dehydrogenase; Provisional 99.46
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.45
PRK06124256 gluconate 5-dehydrogenase; Provisional 99.45
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.45
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.45
PRK06128300 oxidoreductase; Provisional 99.45
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.44
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.44
PRK08324681 short chain dehydrogenase; Validated 99.44
PRK07041230 short chain dehydrogenase; Provisional 99.44
PRK08339263 short chain dehydrogenase; Provisional 99.43
PRK09135249 pteridine reductase; Provisional 99.42
PRK07890258 short chain dehydrogenase; Provisional 99.41
PRK06139330 short chain dehydrogenase; Provisional 99.41
PRK05866293 short chain dehydrogenase; Provisional 99.41
KOG4288283 consensus Predicted oxidoreductase [General functi 99.41
PRK08589272 short chain dehydrogenase; Validated 99.41
PRK06523260 short chain dehydrogenase; Provisional 99.41
PRK07478254 short chain dehydrogenase; Provisional 99.4
PRK06101240 short chain dehydrogenase; Provisional 99.4
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.4
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.4
PRK06701290 short chain dehydrogenase; Provisional 99.39
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.39
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.39
PRK05693274 short chain dehydrogenase; Provisional 99.39
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.39
PRK08251248 short chain dehydrogenase; Provisional 99.39
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 99.38
PRK06194287 hypothetical protein; Provisional 99.38
PRK12937245 short chain dehydrogenase; Provisional 99.38
PRK08277278 D-mannonate oxidoreductase; Provisional 99.38
PRK08643256 acetoin reductase; Validated 99.38
PRK06114254 short chain dehydrogenase; Provisional 99.38
KOG1431315 consensus GDP-L-fucose synthetase [Carbohydrate tr 99.37
PRK12743256 oxidoreductase; Provisional 99.37
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.37
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.37
PRK06172253 short chain dehydrogenase; Provisional 99.37
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.37
PRK09072263 short chain dehydrogenase; Provisional 99.37
PRK09242257 tropinone reductase; Provisional 99.36
COG3320 382 Putative dehydrogenase domain of multifunctional n 99.36
PRK06398258 aldose dehydrogenase; Validated 99.36
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.36
PRK09134258 short chain dehydrogenase; Provisional 99.36
PRK12742237 oxidoreductase; Provisional 99.35
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.35
PLN02253280 xanthoxin dehydrogenase 99.35
PRK07814263 short chain dehydrogenase; Provisional 99.35
PRK06949258 short chain dehydrogenase; Provisional 99.34
PRK07856252 short chain dehydrogenase; Provisional 99.34
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.34
PRK07576264 short chain dehydrogenase; Provisional 99.34
PRK07985294 oxidoreductase; Provisional 99.33
PRK06198260 short chain dehydrogenase; Provisional 99.33
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.33
PRK08278273 short chain dehydrogenase; Provisional 99.33
PRK06947248 glucose-1-dehydrogenase; Provisional 99.33
PRK07069251 short chain dehydrogenase; Validated 99.33
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.32
PRK07062265 short chain dehydrogenase; Provisional 99.32
PRK07035252 short chain dehydrogenase; Provisional 99.32
PRK05867253 short chain dehydrogenase; Provisional 99.31
TIGR02415254 23BDH acetoin reductases. One member of this famil 99.3
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.3
PRK08226263 short chain dehydrogenase; Provisional 99.3
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.29
PRK06924251 short chain dehydrogenase; Provisional 99.29
PRK07201657 short chain dehydrogenase; Provisional 99.29
PRK06057255 short chain dehydrogenase; Provisional 99.29
PRK05717255 oxidoreductase; Validated 99.29
PRK06123248 short chain dehydrogenase; Provisional 99.29
PRK06500249 short chain dehydrogenase; Provisional 99.29
PRK07023243 short chain dehydrogenase; Provisional 99.28
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.28
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.28
PRK06483236 dihydromonapterin reductase; Provisional 99.27
PRK07832272 short chain dehydrogenase; Provisional 99.27
PRK05855582 short chain dehydrogenase; Validated 99.27
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.27
PRK08340259 glucose-1-dehydrogenase; Provisional 99.26
PRK06196315 oxidoreductase; Provisional 99.25
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.25
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.25
PRK08936261 glucose-1-dehydrogenase; Provisional 99.24
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.23
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.23
PRK06125259 short chain dehydrogenase; Provisional 99.22
PRK07677252 short chain dehydrogenase; Provisional 99.21
PRK07831262 short chain dehydrogenase; Provisional 99.19
PRK05872296 short chain dehydrogenase; Provisional 99.19
PRK08703239 short chain dehydrogenase; Provisional 99.19
PRK06484520 short chain dehydrogenase; Validated 99.18
PLN02260668 probable rhamnose biosynthetic enzyme 99.18
PRK06953222 short chain dehydrogenase; Provisional 99.17
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.16
PRK07791286 short chain dehydrogenase; Provisional 99.16
PRK12744257 short chain dehydrogenase; Provisional 99.15
PRK12747252 short chain dehydrogenase; Provisional 99.15
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.13
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 99.13
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.12
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 99.12
PRK05884223 short chain dehydrogenase; Provisional 99.09
PRK06940275 short chain dehydrogenase; Provisional 99.09
PRK07578199 short chain dehydrogenase; Provisional 99.09
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 99.08
PRK06197306 short chain dehydrogenase; Provisional 99.06
PLN02780320 ketoreductase/ oxidoreductase 99.05
PRK06484 520 short chain dehydrogenase; Validated 99.04
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 99.04
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.03
PRK05599246 hypothetical protein; Provisional 99.03
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 99.01
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.0
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 99.0
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 98.99
PRK08177225 short chain dehydrogenase; Provisional 98.97
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 98.97
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 98.97
PRK12367245 short chain dehydrogenase; Provisional 98.97
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 98.96
PRK09009235 C factor cell-cell signaling protein; Provisional 98.96
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 98.95
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 98.93
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 98.93
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 98.9
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 98.9
smart00822180 PKS_KR This enzymatic domain is part of bacterial 98.89
PRK08303305 short chain dehydrogenase; Provisional 98.88
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 98.85
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 98.84
PRK07424406 bifunctional sterol desaturase/short chain dehydro 98.82
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 98.82
PRK08862227 short chain dehydrogenase; Provisional 98.78
PRK05854313 short chain dehydrogenase; Provisional 98.78
PLN00015308 protochlorophyllide reductase 98.75
KOG1221 467 consensus Acyl-CoA reductase [Lipid transport and 98.75
KOG1372376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 98.67
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 98.64
KOG1210331 consensus Predicted 3-ketosphinganine reductase [S 98.61
PRK08309177 short chain dehydrogenase; Provisional 98.58
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 98.52
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 98.46
KOG0725270 consensus Reductases with broad range of substrate 98.43
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 98.43
KOG1611249 consensus Predicted short chain-type dehydrogenase 98.41
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 98.38
KOG1610322 consensus Corticosteroid 11-beta-dehydrogenase and 98.36
KOG1207245 consensus Diacetyl reductase/L-xylulose reductase 98.29
COG0569225 TrkA K+ transport systems, NAD-binding component [ 98.29
PLN02730303 enoyl-[acyl-carrier-protein] reductase 98.27
KOG3019315 consensus Predicted nucleoside-diphosphate sugar e 98.25
KOG1209289 consensus 1-Acyl dihydroxyacetone phosphate reduct 98.19
KOG1208314 consensus Dehydrogenases with different specificit 98.18
KOG2774366 consensus NAD dependent epimerase [General functio 98.11
KOG4169261 consensus 15-hydroxyprostaglandin dehydrogenase an 98.1
KOG1014312 consensus 17 beta-hydroxysteroid dehydrogenase typ 98.09
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 98.09
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 98.05
PRK06732229 phosphopantothenate--cysteine ligase; Validated 98.01
COG1028251 FabG Dehydrogenases with different specificities ( 97.99
PRK09620229 hypothetical protein; Provisional 97.92
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.9
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 97.87
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 97.78
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 97.7
PTZ00325321 malate dehydrogenase; Provisional 97.67
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 97.66
PRK09496 453 trkA potassium transporter peripheral membrane com 97.63
PRK06720169 hypothetical protein; Provisional 97.56
PRK10669558 putative cation:proton antiport protein; Provision 97.55
PRK04148134 hypothetical protein; Provisional 97.49
PRK09496453 trkA potassium transporter peripheral membrane com 97.34
KOG2733 423 consensus Uncharacterized membrane protein [Functi 97.3
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 97.29
PRK03659601 glutathione-regulated potassium-efflux system prot 97.27
PRK14874 334 aspartate-semialdehyde dehydrogenase; Provisional 97.27
PLN02968 381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 97.22
COG2085211 Predicted dinucleotide-binding enzymes [General fu 97.22
PRK03562621 glutathione-regulated potassium-efflux system prot 97.05
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 97.05
TIGR01724 341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 97.03
cd01336 325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 96.94
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 96.89
PRK12548289 shikimate 5-dehydrogenase; Provisional 96.88
PLN00106323 malate dehydrogenase 96.85
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 96.83
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 96.79
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.79
TIGR01296 339 asd_B aspartate-semialdehyde dehydrogenase (peptid 96.75
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 96.7
COG3268 382 Uncharacterized conserved protein [Function unknow 96.7
PRK05086312 malate dehydrogenase; Provisional 96.66
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 96.63
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 96.54
KOG1199260 consensus Short-chain alcohol dehydrogenase/3-hydr 96.54
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 96.52
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 96.52
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 96.48
PRK10537393 voltage-gated potassium channel; Provisional 96.45
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 96.4
KOG1478 341 consensus 3-keto sterol reductase [Lipid transport 96.39
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 96.38
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 96.28
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 96.2
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 96.16
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 96.16
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 96.14
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 96.11
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 96.08
PRK00436 343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 96.04
PRK08306296 dipicolinate synthase subunit A; Reviewed 96.03
COG0026 375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 96.01
KOG0409327 consensus Predicted dehydrogenase [General functio 95.99
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 95.98
PRK05671 336 aspartate-semialdehyde dehydrogenase; Reviewed 95.98
PRK06019 372 phosphoribosylaminoimidazole carboxylase ATPase su 95.92
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 95.9
PRK08664 349 aspartate-semialdehyde dehydrogenase; Reviewed 95.89
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.86
PLN02383 344 aspartate semialdehyde dehydrogenase 95.76
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 95.76
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 95.69
PRK14982340 acyl-ACP reductase; Provisional 95.68
PLN02688266 pyrroline-5-carboxylate reductase 95.67
PRK06719157 precorrin-2 dehydrogenase; Validated 95.67
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.66
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 95.65
TIGR01850 346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 95.64
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 95.62
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 95.61
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 95.61
PRK07417279 arogenate dehydrogenase; Reviewed 95.6
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 95.59
PRK06718202 precorrin-2 dehydrogenase; Reviewed 95.53
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.52
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 95.51
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 95.49
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 95.47
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 95.46
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 95.45
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 95.4
PRK06545 359 prephenate dehydrogenase; Validated 95.38
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.25
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 95.21
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 95.15
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 95.12
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 95.11
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 95.07
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 95.03
PRK13940414 glutamyl-tRNA reductase; Provisional 94.99
TIGR01161 352 purK phosphoribosylaminoimidazole carboxylase, Pur 94.94
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 94.94
COG1255129 Uncharacterized protein conserved in archaea [Func 94.9
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 94.89
TIGR01142 380 purT phosphoribosylglycinamide formyltransferase 2 94.83
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 94.82
PRK13403 335 ketol-acid reductoisomerase; Provisional 94.79
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 94.77
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 94.67
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 94.67
PRK12921305 2-dehydropantoate 2-reductase; Provisional 94.61
PLN02928347 oxidoreductase family protein 94.59
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 94.53
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.52
PRK13656 398 trans-2-enoyl-CoA reductase; Provisional 94.52
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.47
PRK15059292 tartronate semialdehyde reductase; Provisional 94.46
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 94.46
COG0240 329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 94.45
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 94.45
PRK00048257 dihydrodipicolinate reductase; Provisional 94.45
PRK12480330 D-lactate dehydrogenase; Provisional 94.38
PRK07574385 formate dehydrogenase; Provisional 94.31
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 94.29
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 94.27
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 94.25
PLN02858 1378 fructose-bisphosphate aldolase 94.19
PRK08655 437 prephenate dehydrogenase; Provisional 94.18
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 94.16
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 94.11
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 94.1
PLN02858 1378 fructose-bisphosphate aldolase 94.1
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.09
PRK09288 395 purT phosphoribosylglycinamide formyltransferase 2 94.05
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 94.03
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 93.96
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 93.95
cd01483143 E1_enzyme_family Superfamily of activating enzymes 93.94
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 93.93
PRK07502307 cyclohexadienyl dehydrogenase; Validated 93.83
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 93.82
PRK13243333 glyoxylate reductase; Reviewed 93.81
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 93.75
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 93.66
PRK08057248 cobalt-precorrin-6x reductase; Reviewed 93.66
PLN00203519 glutamyl-tRNA reductase 93.61
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 93.58
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 93.52
PTZ00075476 Adenosylhomocysteinase; Provisional 93.5
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 93.47
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 93.45
KOG0172 445 consensus Lysine-ketoglutarate reductase/saccharop 93.4
PLN02256304 arogenate dehydrogenase 93.37
PLN02353 473 probable UDP-glucose 6-dehydrogenase 93.37
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 93.32
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 93.31
PRK05600370 thiamine biosynthesis protein ThiF; Validated 93.2
COG0027 394 PurT Formate-dependent phosphoribosylglycinamide f 93.13
PLN02494477 adenosylhomocysteinase 92.98
PLN03139386 formate dehydrogenase; Provisional 92.97
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 92.93
PRK05479 330 ketol-acid reductoisomerase; Provisional 92.89
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.86
PRK13302271 putative L-aspartate dehydrogenase; Provisional 92.85
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.85
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 92.78
PRK12549284 shikimate 5-dehydrogenase; Reviewed 92.75
PRK13982475 bifunctional SbtC-like/phosphopantothenoylcysteine 92.71
PRK07680273 late competence protein ComER; Validated 92.7
PRK08328231 hypothetical protein; Provisional 92.66
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 92.65
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 92.6
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.59
PLN02948 577 phosphoribosylaminoimidazole carboxylase 92.57
PRK06598 369 aspartate-semialdehyde dehydrogenase; Reviewed 92.57
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 92.54
cd00704 323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 92.44
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 92.35
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 92.3
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.23
PRK12557 342 H(2)-dependent methylenetetrahydromethanopterin de 92.23
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 92.2
PRK07340304 ornithine cyclodeaminase; Validated 92.18
TIGR01758 324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 92.14
TIGR00978 341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 92.14
PRK06436303 glycerate dehydrogenase; Provisional 92.06
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 91.95
TIGR03693 637 ocin_ThiF_like putative thiazole-containing bacter 91.92
TIGR01019286 sucCoAalpha succinyl-CoA synthetase, alpha subunit 91.91
PRK08507275 prephenate dehydrogenase; Validated 91.86
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 91.82
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 91.78
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 91.76
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 91.69
PRK08223287 hypothetical protein; Validated 91.67
PRK15116268 sulfur acceptor protein CsdL; Provisional 91.64
PRK08818 370 prephenate dehydrogenase; Provisional 91.59
PF03686127 UPF0146: Uncharacterised protein family (UPF0146); 91.48
PRK07877 722 hypothetical protein; Provisional 91.34
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 91.33
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 91.22
PRK06141314 ornithine cyclodeaminase; Validated 91.14
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.14
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.08
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 91.07
PRK11863 313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 91.07
PRK06444197 prephenate dehydrogenase; Provisional 90.95
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 90.94
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 90.92
PLN02712 667 arogenate dehydrogenase 90.87
PRK08618325 ornithine cyclodeaminase; Validated 90.86
COG0002 349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 90.6
TIGR01851 310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 90.59
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 90.39
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
Probab=99.96  E-value=8.4e-28  Score=191.04  Aligned_cols=193  Identities=23%  Similarity=0.228  Sum_probs=148.3

Q ss_pred             ccccCccHHHHHHHHHhCCCcEEEEEcCchhhhhhcCCceEEEEcCCCCHHHHHHHhcCCCEEEEcCCC-----------
Q 028525            7 MKRKKMNFRMVILSLIVKRTRIKALVKDKRNAMESFGTYVESMAGDASNKKFLKTALRGVRSIICPSEG-----------   75 (208)
Q Consensus         7 ~~~~G~iG~~l~~~Ll~~g~~V~~~~R~~~~~~~~~~~~v~~v~~Dl~d~~~l~~~~~~~d~vi~~~~~-----------   75 (208)
                      -++||++|++|+++|+++||+|++++|+.++.......+++++.+|++|++++.++++++|+||++.+.           
T Consensus         6 tGatG~iG~~lv~~Ll~~g~~V~~l~R~~~~~~~l~~~~v~~v~~Dl~d~~~l~~al~g~d~Vi~~~~~~~~~~~~~~~~   85 (317)
T CHL00194          6 IGATGTLGRQIVRQALDEGYQVRCLVRNLRKASFLKEWGAELVYGDLSLPETLPPSFKGVTAIIDASTSRPSDLYNAKQI   85 (317)
T ss_pred             ECCCcHHHHHHHHHHHHCCCeEEEEEcChHHhhhHhhcCCEEEECCCCCHHHHHHHHCCCCEEEECCCCCCCCccchhhh
Confidence            467999999999999999999999999977654333357999999999999999999999999987210           


Q ss_pred             ------chhhhhhhcCCCeEEEeceeeeccCCCCcccccchhHHHhHHHHHHHHHhcCCCEEEEeccccccCCCC-----
Q 028525           76 ------FISNAGSLKGVQHVILLSQLSVYRGSGGIQALMKGNARKLAEQDESMLMASGIPYTIIRTGVLQNTPGG-----  144 (208)
Q Consensus        76 ------~~~~a~~~~gv~~~v~~Ss~~~~~~~~~~~~~~~~~~~~~~~~~e~~l~~~~~~~tivRp~~~~~~~~~-----  144 (208)
                            .+.++++++|++|||++||.++...  +..++..     .+.++|+++++++++||++||+.++.....     
T Consensus        86 ~~~~~~~l~~aa~~~gvkr~I~~Ss~~~~~~--~~~~~~~-----~K~~~e~~l~~~~l~~tilRp~~~~~~~~~~~~~~  158 (317)
T CHL00194         86 DWDGKLALIEAAKAAKIKRFIFFSILNAEQY--PYIPLMK-----LKSDIEQKLKKSGIPYTIFRLAGFFQGLISQYAIP  158 (317)
T ss_pred             hHHHHHHHHHHHHHcCCCEEEEecccccccc--CCChHHH-----HHHHHHHHHHHcCCCeEEEeecHHhhhhhhhhhhh
Confidence                  1346788899999999999764321  1122221     223578899999999999999987653210     


Q ss_pred             ---ccceeeecCCcCCCcccHHHHHHHHHHHhhCCCCCCcEEEEeeCC-cchhhHHHHHHHHhhhc
Q 028525          145 ---KQGFQFEEGCAANGSLSKEDAAFICVEALESIPQTGLIFEVVNGE-EKVSDWKKCFSRLMEKT  206 (208)
Q Consensus       145 ---~~~~~~~~~~~~~~~v~~~Dva~~~~~~l~~~~~~~~~~~i~~~~-~~~~e~~~~~~~~~~~~  206 (208)
                         .....+..+.....+++++|+|++++.+++++...+++||++++. .+++|+++.+.+++|++
T Consensus       159 ~~~~~~~~~~~~~~~~~~i~v~Dva~~~~~~l~~~~~~~~~~ni~g~~~~s~~el~~~~~~~~g~~  224 (317)
T CHL00194        159 ILEKQPIWITNESTPISYIDTQDAAKFCLKSLSLPETKNKTFPLVGPKSWNSSEIISLCEQLSGQK  224 (317)
T ss_pred             hccCCceEecCCCCccCccCHHHHHHHHHHHhcCccccCcEEEecCCCccCHHHHHHHHHHHhCCC
Confidence               111222223344677899999999999998877789999999765 49999999999999875



>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4288 consensus Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>KOG3019 consensus Predicted nucleoside-diphosphate sugar epimerase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG2774 consensus NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>KOG2733 consensus Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>KOG1478 consensus 3-keto sterol reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>COG1255 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08057 cobalt-precorrin-6x reductase; Reviewed Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>KOG0172 consensus Lysine-ketoglutarate reductase/saccharopine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein Back     alignment and domain information
>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PF03686 UPF0146: Uncharacterised protein family (UPF0146); InterPro: IPR005353 The function of this family of proteins is unknown Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
1xq6_A253 X-ray Structure Of Gene Product From Arabidopsis Th 8e-05
>pdb|1XQ6|A Chain A, X-ray Structure Of Gene Product From Arabidopsis Thaliana At5g02240 Length = 253 Back     alignment and structure

Iteration: 1

Score = 43.5 bits (101), Expect = 8e-05, Method: Compositional matrix adjust. Identities = 35/135 (25%), Positives = 60/135 (44%), Gaps = 8/135 (5%) Query: 79 NAGSLKGVQHVILLSQLSVYRGSGGIQALMKGNARKLAEQDESMLMASGIPYTIIRTGVL 138 +A + GV+H++++ + + L GN + E L SG PYTIIR G L Sbjct: 118 DAAKVAGVKHIVVVGSMGGTNPDHPLNKLGNGNILVWKRKAEQYLADSGTPYTIIRAGGL 177 Query: 139 QNTPGGKQ----GFQFEEGCAANGSLSKEDAAFICVEALESIPQTGLIFEVVNGEEKVS- 193 + GG + G E ++ + D A +C++AL F++ + E S Sbjct: 178 LDKEGGVRELLVGKDDELLQTDTKTVPRADVAEVCIQALLFEEAKNKAFDLGSKPEGTST 237 Query: 194 ---DWKKCFSRLMEK 205 D+K FS++ + Sbjct: 238 PTKDFKALFSQVTSR 252

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
1xq6_A253 Unknown protein; structural genomics, protein stru 2e-16
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 4e-15
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 3e-14
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 5e-14
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 8e-12
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 2e-11
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 1e-08
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 2e-07
2wm3_A299 NMRA-like family domain containing protein 1; unkn 2e-07
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 2e-07
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 1e-04
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 5e-04
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Length = 253 Back     alignment and structure
 Score = 74.5 bits (183), Expect = 2e-16
 Identities = 46/228 (20%), Positives = 82/228 (35%), Gaps = 53/228 (23%)

Query: 27  RIKALVKDKRNAMESFGTYVESMAGDASNKKFLKTALRGVRSIIC-------PSEGFISN 79
             K LV+  +   E  G   +   GD ++   +  A +G+ +++           GF   
Sbjct: 32  VAKGLVRSAQGK-EKIGGEADVFIGDITDADSINPAFQGIDALVILTSAVPKMKPGFDPT 90

Query: 80  AGSLK----------------------------GVQHVILLSQLSVYRGSGGIQALMKGN 111
            G                               GV+H++++  +        +  L  GN
Sbjct: 91  KGGRPEFIFEDGQYPEQVDWIGQKNQIDAAKVAGVKHIVVVGSMGGTNPDHPLNKLGNGN 150

Query: 112 ---ARKLAEQDESMLMASGIPYTIIRTGVLQNTPGGKQGFQFEEG----CAANGSLSKED 164
               ++ AEQ    L  SG PYTIIR G L +  GG +     +          ++ + D
Sbjct: 151 ILVWKRKAEQ---YLADSGTPYTIIRAGGLLDKEGGVRELLVGKDDELLQTDTKTVPRAD 207

Query: 165 AAFICVEALESIPQTGLIFEVVNGEE----KVSDWKKCFSRLMEKTGK 208
            A +C++AL         F++ +  E       D+K  FS++   T +
Sbjct: 208 VAEVCIQALLFEEAKNKAFDLGSKPEGTSTPTKDFKALFSQV---TSR 252


>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Length = 236 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Length = 206 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Length = 236 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Length = 219 Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 3r14_A* Length = 221 Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Length = 289 Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Length = 286 Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Length = 299 Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Length = 287 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Length = 307 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Length = 308 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.95
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.95
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 99.95
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.94
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 99.94
3slg_A372 PBGP3 protein; structural genomics, seattle struct 99.94
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.94
1xq6_A253 Unknown protein; structural genomics, protein stru 99.94
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.94
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.94
3ius_A286 Uncharacterized conserved protein; APC63810, silic 99.94
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.94
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 99.94
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.94
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 99.93
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.93
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 99.93
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.93
2wm3_A299 NMRA-like family domain containing protein 1; unkn 99.93
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.93
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.93
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.92
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.92
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.92
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 99.92
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.92
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.92
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.92
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.92
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.92
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 99.92
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.92
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 99.91
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.91
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.91
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.91
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 99.91
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.91
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.91
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 99.9
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.9
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.9
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 99.9
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.9
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.9
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.9
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.9
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.9
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.9
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.9
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 99.89
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.89
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.89
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 99.89
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.89
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.89
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 99.89
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.88
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.88
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.88
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.88
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.88
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.88
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.87
4f6c_A427 AUSA reductase domain protein; thioester reductase 99.87
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.87
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.86
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.86
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.86
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.86
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.86
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.86
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.86
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.86
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.86
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.86
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 99.86
4f6l_B508 AUSA reductase domain protein; thioester reductase 99.86
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 99.86
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.85
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.85
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.85
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 99.85
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 99.84
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.84
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.84
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.83
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.82
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.82
1spx_A278 Short-chain reductase family member (5L265); paral 99.78
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.77
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.76
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.74
1nff_A260 Putative oxidoreductase RV2002; directed evolution 99.73
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.72
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.72
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.71
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.71
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.71
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.7
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.7
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.7
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.7
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.7
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.69
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.69
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 99.68
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.68
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.68
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.68
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.68
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.68
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 99.68
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.68
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.68
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.67
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.67
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.67
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.67
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.67
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.67
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.66
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.66
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.66
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.66
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 99.66
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.66
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.66
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.66
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.66
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.66
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.66
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 99.66
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.66
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.66
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.65
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.65
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.65
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.65
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 99.65
1xhl_A297 Short-chain dehydrogenase/reductase family member 99.65
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.65
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.65
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.64
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.64
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.64
3cxt_A291 Dehydrogenase with different specificities; rossma 99.64
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.64
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.64
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 99.64
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.64
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.64
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 99.64
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.64
3imf_A257 Short chain dehydrogenase; structural genomics, in 99.64
1xkq_A280 Short-chain reductase family member (5D234); parra 99.64
4dqx_A277 Probable oxidoreductase protein; structural genomi 99.64
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 99.63
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.63
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 99.63
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.63
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.63
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.63
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.63
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.63
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.63
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.62
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 99.62
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.62
3tox_A280 Short chain dehydrogenase; structural genomics, PS 99.61
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.61
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 99.61
3qlj_A322 Short chain dehydrogenase; structural genomics, se 99.61
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.61
3tjr_A301 Short chain dehydrogenase; structural genomics, se 99.61
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.61
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.61
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.61
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 99.61
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.61
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.61
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.61
3rih_A293 Short chain dehydrogenase or reductase; structural 99.6
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 99.6
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.6
4eso_A255 Putative oxidoreductase; NADP, structural genomics 99.6
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.59
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.59
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.59
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.59
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.59
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 99.59
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 99.59
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.59
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 99.58
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.58
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.58
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.58
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.58
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 99.58
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.58
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.58
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.58
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.58
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.58
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.58
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.57
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.57
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.57
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.57
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.57
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.57
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.57
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.57
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.56
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.56
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.56
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.56
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 99.55
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.55
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.55
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.55
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.55
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.54
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.54
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.54
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.53
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.53
3tsc_A277 Putative oxidoreductase; structural genomics, seat 99.53
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.52
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.52
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.52
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.52
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 99.52
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.52
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.52
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.51
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.51
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 99.51
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 99.51
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 99.51
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 99.51
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 99.5
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.5
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.5
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.5
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.5
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.5
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.49
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.49
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 99.49
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.49
3e03_A274 Short chain dehydrogenase; structural genomics, PS 99.49
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.48
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.48
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.47
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 99.47
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 99.47
4e4y_A244 Short chain dehydrogenase family protein; structur 99.47
3edm_A259 Short chain dehydrogenase; structural genomics, ox 99.47
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 99.46
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.46
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.46
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.46
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.46
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.46
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 99.45
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.45
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.45
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.45
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.44
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.44
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 99.44
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.43
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.43
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.42
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 99.42
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.42
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 99.42
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 99.41
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.39
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 99.39
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.38
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 99.38
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.32
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.32
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 99.3
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 99.29
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.28
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 99.28
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 99.27
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 99.26
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.24
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 99.21
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.16
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 99.15
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.14
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 99.06
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 99.06
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 98.95
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 98.82
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 98.79
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 98.75
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 98.73
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 98.68
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 98.68
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 98.66
1id1_A153 Putative potassium channel protein; RCK domain, E. 98.64
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 98.54
1lss_A140 TRK system potassium uptake protein TRKA homolog; 98.51
3slk_A795 Polyketide synthase extender module 2; rossmann fo 98.51
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.49
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 98.48
3c85_A183 Putative glutathione-regulated potassium-efflux S 98.45
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 98.32
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 98.31
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 98.29
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 98.27
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 98.23
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 98.22
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 98.22
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 98.19
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 98.17
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 98.13
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 98.1
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 98.02
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 97.96
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 97.93
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 97.91
1lnq_A336 MTHK channels, potassium channel related protein; 97.79
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.71
4g65_A 461 TRK system potassium uptake protein TRKA; structur 97.66
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 97.65
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 97.64
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 97.64
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 97.43
1b8p_A 329 Protein (malate dehydrogenase); oxidoreductase; 1. 97.32
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 97.14
2nqt_A 352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 97.12
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 97.1
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 97.09
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 96.97
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 96.9
4gx0_A565 TRKA domain protein; membrane protein, ION channel 96.88
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 96.86
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 96.85
3l6d_A306 Putative oxidoreductase; structural genomics, prot 96.84
4g65_A461 TRK system potassium uptake protein TRKA; structur 96.8
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 96.78
3qha_A296 Putative oxidoreductase; seattle structural genomi 96.76
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 96.76
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 96.75
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 96.73
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 96.71
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 96.71
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 96.68
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 96.64
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 96.59
3k5i_A 403 Phosphoribosyl-aminoimidazole carboxylase; purine 96.58
2hjs_A 340 USG-1 protein homolog; aspartate-semialdehyde dehy 96.56
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 96.54
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 96.52
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 96.49
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 96.49
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 96.45
2rir_A300 Dipicolinate synthase, A chain; structural genomic 96.45
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 96.44
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 96.41
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 96.39
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 96.35
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 96.34
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 96.3
2r00_A 336 Aspartate-semialdehyde dehydrogenase; conformation 96.28
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 96.28
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 96.27
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 96.26
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 96.23
1xyg_A 359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 96.21
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 96.2
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 96.19
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 96.18
1vpd_A299 Tartronate semialdehyde reductase; structural geno 96.17
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 96.14
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 96.13
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 96.13
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 95.99
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 95.98
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 95.98
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 95.93
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 95.92
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 95.89
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 95.8
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 95.79
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 95.76
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 95.76
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 95.74
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 95.74
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 95.74
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 95.71
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 95.71
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 95.71
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 95.68
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 95.65
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 95.63
1ys4_A 354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 95.61
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 95.61
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 95.59
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 95.59
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 95.56
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 95.56
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 95.54
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 95.51
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 95.5
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 95.48
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 95.47
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 95.47
1yb4_A295 Tartronic semialdehyde reductase; structural genom 95.47
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 95.45
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 95.36
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 95.34
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 95.33
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 95.33
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 95.31
4ezb_A317 Uncharacterized conserved protein; structural geno 95.31
1p9o_A313 Phosphopantothenoylcysteine synthetase; ligase; 2. 95.27
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 95.25
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 95.22
2ep5_A 350 350AA long hypothetical aspartate-semialdehyde deh 95.2
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 95.19
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 95.16
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 95.16
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 95.16
3ax6_A 380 Phosphoribosylaminoimidazole carboxylase, ATPase; 95.13
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 95.12
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 95.12
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 94.12
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 95.11
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 95.1
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 95.09
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 95.04
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 95.02
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 94.99
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 94.97
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 94.96
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 94.95
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 94.92
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 94.9
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 94.89
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 94.88
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 94.87
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 94.87
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 94.86
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 94.8
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 94.78
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 94.76
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 94.76
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 94.7
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 94.69
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 94.69
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 94.69
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 94.66
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 94.65
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 94.62
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 94.6
1kjq_A 391 GART 2, phosphoribosylglycinamide formyltransferas 94.59
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 94.57
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 94.55
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 94.54
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 94.52
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 94.52
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 94.51
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 94.5
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 94.46
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 94.43
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 94.41
5mdh_A 333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 94.39
3pwk_A 366 Aspartate-semialdehyde dehydrogenase; NADP binding 94.35
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 94.27
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 94.25
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 94.24
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 94.23
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 94.23
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 94.21
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 94.2
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 94.16
4dpk_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 94.07
4dpl_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 94.07
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 94.06
3uw3_A 377 Aspartate-semialdehyde dehydrogenase; structural g 94.05
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 94.03
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 94.01
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 93.91
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 93.9
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 93.89
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 93.86
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 93.79
1t4b_A 367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 93.77
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 93.65
3hsk_A 381 Aspartate-semialdehyde dehydrogenase; candida albi 93.65
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 93.64
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
Probab=99.95  E-value=2.2e-27  Score=177.98  Aligned_cols=181  Identities=18%  Similarity=0.159  Sum_probs=143.6

Q ss_pred             ccccCccHHHHHHHHHhCCCcEEEEEcCchhhhhhcCCceEEEEcCCCC-HHHHHHHhcCCCEEEEcCCC----------
Q 028525            7 MKRKKMNFRMVILSLIVKRTRIKALVKDKRNAMESFGTYVESMAGDASN-KKFLKTALRGVRSIICPSEG----------   75 (208)
Q Consensus         7 ~~~~G~iG~~l~~~Ll~~g~~V~~~~R~~~~~~~~~~~~v~~v~~Dl~d-~~~l~~~~~~~d~vi~~~~~----------   75 (208)
                      -++||+||++++++|+++||+|++++|++++....  .+++++.+|++| ++++.++++++|+||++++.          
T Consensus         6 tGatG~iG~~l~~~L~~~g~~V~~~~R~~~~~~~~--~~~~~~~~D~~d~~~~~~~~~~~~d~vi~~ag~~~~~~~~~n~   83 (219)
T 3dqp_A            6 VGSTGRVGKSLLKSLSTTDYQIYAGARKVEQVPQY--NNVKAVHFDVDWTPEEMAKQLHGMDAIINVSGSGGKSLLKVDL   83 (219)
T ss_dssp             ESTTSHHHHHHHHHHTTSSCEEEEEESSGGGSCCC--TTEEEEECCTTSCHHHHHTTTTTCSEEEECCCCTTSSCCCCCC
T ss_pred             ECCCCHHHHHHHHHHHHCCCEEEEEECCccchhhc--CCceEEEecccCCHHHHHHHHcCCCEEEECCcCCCCCcEeEeH
Confidence            36799999999999999999999999998775433  579999999999 99999999999999987321          


Q ss_pred             ----chhhhhhhcCCCeEEEeceeeeccCCCC-------cccccchhHHHhHHHHHHHH-HhcCCCEEEEeccccccCCC
Q 028525           76 ----FISNAGSLKGVQHVILLSQLSVYRGSGG-------IQALMKGNARKLAEQDESML-MASGIPYTIIRTGVLQNTPG  143 (208)
Q Consensus        76 ----~~~~a~~~~gv~~~v~~Ss~~~~~~~~~-------~~~~~~~~~~~~~~~~e~~l-~~~~~~~tivRp~~~~~~~~  143 (208)
                          .+.+++++.++++||++||.+++.+...       ..+|..  .   +..+|+++ +..+++|+++||+++++...
T Consensus        84 ~~~~~l~~a~~~~~~~~iv~~SS~~~~~~~~~~e~~~~~~~~Y~~--s---K~~~e~~~~~~~~i~~~ilrp~~v~g~~~  158 (219)
T 3dqp_A           84 YGAVKLMQAAEKAEVKRFILLSTIFSLQPEKWIGAGFDALKDYYI--A---KHFADLYLTKETNLDYTIIQPGALTEEEA  158 (219)
T ss_dssp             HHHHHHHHHHHHTTCCEEEEECCTTTTCGGGCCSHHHHHTHHHHH--H---HHHHHHHHHHSCCCEEEEEEECSEECSCC
T ss_pred             HHHHHHHHHHHHhCCCEEEEECcccccCCCcccccccccccHHHH--H---HHHHHHHHHhccCCcEEEEeCceEecCCC
Confidence                1456788889999999999877653211       112221  1   22567888 67899999999999987654


Q ss_pred             CccceeeecCCcCCCcccHHHHHHHHHHHhhCCCCCCcEEEEeeCCcchhhHHH
Q 028525          144 GKQGFQFEEGCAANGSLSKEDAAFICVEALESIPQTGLIFEVVNGEEKVSDWKK  197 (208)
Q Consensus       144 ~~~~~~~~~~~~~~~~v~~~Dva~~~~~~l~~~~~~~~~~~i~~~~~~~~e~~~  197 (208)
                      .+. +.+  +.....+++++|+|++++.+++++...++.|++++++.+++|+.+
T Consensus       159 ~~~-~~~--~~~~~~~i~~~Dva~~i~~~l~~~~~~g~~~~i~~g~~~~~e~~~  209 (219)
T 3dqp_A          159 TGL-IDI--NDEVSASNTIGDVADTIKELVMTDHSIGKVISMHNGKTAIKEALE  209 (219)
T ss_dssp             CSE-EEE--SSSCCCCEEHHHHHHHHHHHHTCGGGTTEEEEEEECSEEHHHHHH
T ss_pred             CCc-ccc--CCCcCCcccHHHHHHHHHHHHhCccccCcEEEeCCCCccHHHHHH
Confidence            432 323  355678899999999999999988877999999988888887765



>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1 Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 208
d1hdoa_205 c.2.1.2 (A:) Biliverdin IX beta reductase {Human ( 3e-05
d2q46a1252 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 ( 6e-05
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Biliverdin IX beta reductase
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 41.2 bits (95), Expect = 3e-05
 Identities = 21/176 (11%), Positives = 46/176 (26%), Gaps = 16/176 (9%)

Query: 15  RMVILSLIVKRTRIKALVKDKRNAMESFGTYVESMAGDASNKKFLKTALRGVRSIIC--- 71
              +   +     +  LV+D              + GD      +   + G  ++I    
Sbjct: 17  LTTLAQAVQAGYEVTVLVRDSSRLPSEGPRPAHVVVGDVLQAADVDKTVAGQDAVIVLLG 76

Query: 72  ---PSEGFISN---------AGSLKGVQHVILLSQLSVYRGSGGIQALMKGNARKLAEQD 119
                               A    GV  V+  +   +      +   ++          
Sbjct: 77  TRNDLSPTTVMSEGARNIVAAMKAHGVDKVVACTSAFLLWDPTKVPPRLQAVTDDHIRM- 135

Query: 120 ESMLMASGIPYTIIRTGVLQNTPGGKQGFQFEEGCAANGSLSKEDAAFICVEALES 175
             +L  SG+ Y  +    + + P         +G   +  +SK D     +  L +
Sbjct: 136 HKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTT 191


>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 252 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.98
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.93
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 99.91
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.91
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 99.91
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 99.89
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 99.89
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.88
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.88
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 99.87
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 99.87
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 99.87
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.86
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.85
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.85
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.84
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 99.84
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.84
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.82
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.82
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.82
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.81
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.79
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 99.78
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.78
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 99.75
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 99.72
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.64
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 99.61
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.58
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 99.51
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 99.5
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.48
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 99.48
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.48
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.46
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.44
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.44
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 99.42
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.41
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 99.4
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.4
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.4
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.4
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 99.4
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 99.39
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.39
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.39
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.38
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.38
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 99.37
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.36
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.35
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.35
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 99.35
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 99.34
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 99.34
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.34
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 99.31
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 99.31
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.31
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.31
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.31
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.27
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.27
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 99.26
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.25
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 99.23
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.22
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.22
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.21
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.17
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.16
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.15
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.14
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.14
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.13
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.12
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.1
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.01
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 98.98
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 98.97
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 98.94
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 98.87
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 98.87
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 98.85
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 98.83
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 98.82
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 98.8
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 98.79
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 98.74
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 98.73
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 98.65
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 98.6
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 98.57
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.36
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 98.31
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 97.92
d1id1a_153 Rck domain from putative potassium channel Kch {Es 97.78
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.77
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 97.64
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 97.54
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 97.51
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.36
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 97.29
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.28
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 97.25
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 97.24
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 97.17
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 97.02
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 97.02
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 96.9
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 96.81
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.73
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 96.51
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 96.48
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.46
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.46
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 96.41
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 96.21
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.12
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 96.0
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 95.94
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 95.88
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 95.87
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 95.81
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 95.79
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.75
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 95.7
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 95.52
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 95.49
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 95.49
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 95.49
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.27
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 95.19
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 95.17
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 95.05
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 94.65
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 94.53
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 94.49
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.47
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 94.45
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 94.4
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 93.92
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.84
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 93.62
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 93.46
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.36
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 93.29
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 93.14
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 92.88
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 92.77
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 92.77
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 92.66
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 92.61
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 92.5
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 92.48
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 92.43
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 92.43
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 92.35
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 92.09
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 92.06
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 91.82
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 91.67
d1xk7a1 402 Crotonobetainyl-CoA:carnitine CoA-transferase, Cai 91.57
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 91.44
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 91.03
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 90.92
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 90.73
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 90.68
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 90.37
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 90.36
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 90.19
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 90.16
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 90.03
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 90.03
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 89.86
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 89.72
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 89.71
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 89.69
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 89.67
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 89.5
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 89.34
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 89.14
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 88.93
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 88.73
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 88.04
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 87.97
d1p9oa_290 Phosphopantothenoylcysteine synthetase {Human (Hom 87.87
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 87.71
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 87.43
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 87.13
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 87.1
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 86.86
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 86.81
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 86.71
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 86.1
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 86.08
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 85.48
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 85.22
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 85.11
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 85.03
d1x74a1 359 2-methylacyl-CoA racemase Mcr {Mycobacterium tuber 84.62
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 83.84
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 83.76
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 83.56
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 83.48
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 83.17
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 83.15
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 83.07
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 83.06
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 82.97
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 82.86
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 82.7
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 82.23
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 82.13
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 81.94
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 81.52
d2vjma1 427 Formyl-CoA transferase {Oxalobacter formigenes [Ta 81.3
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 81.22
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 80.64
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 80.37
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Biliverdin IX beta reductase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.98  E-value=2.2e-31  Score=196.31  Aligned_cols=178  Identities=13%  Similarity=0.086  Sum_probs=143.6

Q ss_pred             cccCccHHHHHHHHHhCCCcEEEEEcCchhhhhhcCCceEEEEcCCCCHHHHHHHhcCCCEEEEcCCC------------
Q 028525            8 KRKKMNFRMVILSLIVKRTRIKALVKDKRNAMESFGTYVESMAGDASNKKFLKTALRGVRSIICPSEG------------   75 (208)
Q Consensus         8 ~~~G~iG~~l~~~Ll~~g~~V~~~~R~~~~~~~~~~~~v~~v~~Dl~d~~~l~~~~~~~d~vi~~~~~------------   75 (208)
                      ++||+||++++++|+++||+|++++|++++.......+++++.+|++|++++.++++++|+||++.+.            
T Consensus        10 GatG~iG~~v~~~Ll~~g~~V~~~~R~~~~~~~~~~~~~~~~~gD~~d~~~l~~al~~~d~vi~~~g~~~~~~~~~~~~~   89 (205)
T d1hdoa_          10 GATGQTGLTTLAQAVQAGYEVTVLVRDSSRLPSEGPRPAHVVVGDVLQAADVDKTVAGQDAVIVLLGTRNDLSPTTVMSE   89 (205)
T ss_dssp             STTSHHHHHHHHHHHHTTCEEEEEESCGGGSCSSSCCCSEEEESCTTSHHHHHHHHTTCSEEEECCCCTTCCSCCCHHHH
T ss_pred             CCCCHHHHHHHHHHHHCcCEEEEEEcChhhcccccccccccccccccchhhHHHHhcCCCEEEEEeccCCchhhhhhhHH
Confidence            57999999999999999999999999999876666678999999999999999999999999987321            


Q ss_pred             ---chhhhhhhcCCCeEEEeceeeeccCCCCcccccchhHHHhHHHHHHHHHhcCCCEEEEeccccccCCCCccceeeec
Q 028525           76 ---FISNAGSLKGVQHVILLSQLSVYRGSGGIQALMKGNARKLAEQDESMLMASGIPYTIIRTGVLQNTPGGKQGFQFEE  152 (208)
Q Consensus        76 ---~~~~a~~~~gv~~~v~~Ss~~~~~~~~~~~~~~~~~~~~~~~~~e~~l~~~~~~~tivRp~~~~~~~~~~~~~~~~~  152 (208)
                         .+.+++++++++|||++||.+++.......+... .....+..+|+++++++++||+|||+.+.+.+..+.......
T Consensus        90 ~~~~l~~aa~~~~v~r~i~~ss~~~~~~~~~~~~~~~-~~~~~~~~~e~~l~~~~~~~tiirp~~~~~~~~~~~~~~~~~  168 (205)
T d1hdoa_          90 GARNIVAAMKAHGVDKVVACTSAFLLWDPTKVPPRLQ-AVTDDHIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLD  168 (205)
T ss_dssp             HHHHHHHHHHHHTCCEEEEECCGGGTSCTTCSCGGGH-HHHHHHHHHHHHHHHTCSEEEEECCSEEECCCCCSCCEEESS
T ss_pred             HHHHHHHHHHhcCCCeEEEEeeeeccCCCcccccccc-ccchHHHHHHHHHHhcCCceEEEecceecCCCCcccEEEeeC
Confidence               1456788899999999999887754332222221 122233357899999999999999999998777665444444


Q ss_pred             CCcCCCcccHHHHHHHHHHHhhCCCCCCcEEEEe
Q 028525          153 GCAANGSLSKEDAAFICVEALESIPQTGLIFEVV  186 (208)
Q Consensus       153 ~~~~~~~v~~~Dva~~~~~~l~~~~~~~~~~~i~  186 (208)
                      +.....+++++|+|++++.++++++..|+.+.+.
T Consensus       169 ~~~~~~~i~~~DvA~~~~~~l~~~~~~g~~~~~s  202 (205)
T d1hdoa_         169 GRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPS  202 (205)
T ss_dssp             SCSSCSEEEHHHHHHHHHHTTSCSTTTTCEEEEE
T ss_pred             CCCCCCcCCHHHHHHHHHHHhCCCCCCCEEEecC
Confidence            5556788999999999999999999889988876



>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xk7a1 c.123.1.1 (A:4-405) Crotonobetainyl-CoA:carnitine CoA-transferase, CaiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p9oa_ c.72.3.1 (A:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1x74a1 c.123.1.1 (A:2-360) 2-methylacyl-CoA racemase Mcr {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2vjma1 c.123.1.1 (A:2-428) Formyl-CoA transferase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure