Citrus Sinensis ID: 028527

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MLVKQPNKSSYRESLKALEADIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRKRVEERRKLSDKDLDRNDECGICMENCTKMVTRKHFSLERIPDKYFSHNGLIMNYRNARSQSCLFAVAAYRE
ccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccHHHHHHHHHHHccccccccccccccEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHcc
cHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEcccHHHHHHHHHHHHccccHHHHHHHHcccEEEEEEEEcccccccccHcHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHccccccccccHcHHHHcccEEccccEEEEcccccHHcccccccccHHHHHHHHHcccccccHHHHHHcc
mlvkqpnksSYRESLKALEADIQHANTLAAalprdyggdfvqmrlsyspfapLVLFMIEWMdysctdtvpsyLGLLNILVYKVYvdgmpalssKERKATLREFYAIIYPSLRQLESEFselednskrdqcseissrKRVEERRKLsdkdldrndecgicmenctkmvtrkhfsleripdkyfshnglimnyrnarsQSCLFAVAAYRE
mlvkqpnksSYRESLKALEADIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFselednskrdqcseissrkrveerrklsdkdldrndecgicMENCTKMVTRKHFSLERIPDKYFSHNGLIMNYRNARSQSCLFAVAAYRE
MLVKQPNKSSYRESLKALEADIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRKRVEERRKLSDKDLDRNDECGICMENCTKMVTRKHFSLERIPDKYFSHNGLIMNYRNARSQSCLFAVAAYRE
********************DIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLR******************************************ECGICMENCTKMVTRKHFSLERIPDKYFSHNGLIMNYRNARSQSCLFAVAAY**
**************LKALEADIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSE*******************************RNDECGICMENCTKMVTRKHFSLERIPDKYFSHNGLIMNYRNARSQSCLFAVAAYR*
*************SLKALEADIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLRQLESE********************************LDRNDECGICMENCTKMVTRKHFSLERIPDKYFSHNGLIMNYRNARSQSCLFAVAAYRE
*****PNKSSYRESLKALEADIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRK****RRKLSDKDLDRNDECGICMENCTKMVTRKHFSLERIPDKYFSHNGLIMNYRNARSQSCLFAVAAYR*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVKQPNxxxxxxxxxxxxxxxxxxxxxAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSxxxxxxxxxxxxxxxxxxxxxEISSRKRVEERRKLSDKDLDRNDECGICMENCTKMVTRKHFSLERIPDKYFSHNGLIMNYRNARSQSCLFAVAAYRE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
359473694255 PREDICTED: uncharacterized protein LOC10 0.937 0.764 0.652 9e-72
297738323247 unnamed protein product [Vitis vinifera] 0.889 0.748 0.680 1e-70
255547924253 protein binding protein, putative [Ricin 0.923 0.758 0.684 2e-70
224110810250 predicted protein [Populus trichocarpa] 0.923 0.768 0.658 4e-68
356567396243 PREDICTED: uncharacterized protein LOC10 0.764 0.654 0.616 4e-55
449435031243 PREDICTED: uncharacterized protein LOC10 0.889 0.761 0.554 7e-55
449512974243 PREDICTED: uncharacterized protein LOC10 0.889 0.761 0.549 1e-54
115471529253 Os07g0275300 [Oryza sativa Japonica Grou 0.860 0.707 0.533 4e-47
225425930254 PREDICTED: uncharacterized protein LOC10 0.899 0.736 0.485 1e-46
226505928253 RNA-binding protein [Zea mays] gi|195652 0.860 0.707 0.523 1e-46
>gi|359473694|ref|XP_002272517.2| PREDICTED: uncharacterized protein LOC100245965 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  275 bits (703), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 161/207 (77%), Gaps = 12/207 (5%)

Query: 4   KQPNKSSYRESLKALEADIQHANTLAAALPRDYGG---DFVQMRLSYSPFAPLVLFMIEW 60
           + P+ SS+RES+K LEADIQHAN LAAALPRDYGG   D VQMRLSYSPFAP  LF+IEW
Sbjct: 5   QHPHMSSFRESVKTLEADIQHANNLAAALPRDYGGESGDRVQMRLSYSPFAPFFLFLIEW 64

Query: 61  MDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSE 120
           +DY C DT+PSYLGLL+ILVYKVYVDGMP +SS+ERKATLREFYA+IYPSLRQL  +F E
Sbjct: 65  LDYKCMDTLPSYLGLLHILVYKVYVDGMPTMSSQERKATLREFYAVIYPSLRQLGGQFIE 124

Query: 121 LEDNSKRDQCSEISSRKRVEERRKLSDKDLDRNDECGICMENCTKMVTRKHFSLERIPDK 180
           LED +KR +C+E+ SRKRVE+RRK+SDK++DR+DECGICME CTKMV         +P+ 
Sbjct: 125 LEDTNKRSRCTEVLSRKRVEDRRKVSDKEIDRDDECGICMETCTKMV---------LPNC 175

Query: 181 YFSHNGLIMNYRNARSQSCLFAVAAYR 207
             S      +  N RSQSC F   + +
Sbjct: 176 GHSMCICCFHDWNVRSQSCPFCRGSLK 202

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297738323|emb|CBI27524.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255547924|ref|XP_002515019.1| protein binding protein, putative [Ricinus communis] gi|223546070|gb|EEF47573.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224110810|ref|XP_002315643.1| predicted protein [Populus trichocarpa] gi|222864683|gb|EEF01814.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356567396|ref|XP_003551906.1| PREDICTED: uncharacterized protein LOC100805014 [Glycine max] Back     alignment and taxonomy information
>gi|449435031|ref|XP_004135299.1| PREDICTED: uncharacterized protein LOC101207887 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449512974|ref|XP_004164193.1| PREDICTED: uncharacterized protein LOC101223953 [Cucumis sativus] Back     alignment and taxonomy information
>gi|115471529|ref|NP_001059363.1| Os07g0275300 [Oryza sativa Japonica Group] gi|113610899|dbj|BAF21277.1| Os07g0275300 [Oryza sativa Japonica Group] gi|222636824|gb|EEE66956.1| hypothetical protein OsJ_23829 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|225425930|ref|XP_002272699.1| PREDICTED: uncharacterized protein LOC100240870 [Vitis vinifera] gi|297738321|emb|CBI27522.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|226505928|ref|NP_001152052.1| RNA-binding protein [Zea mays] gi|195652155|gb|ACG45545.1| RNA-binding protein [Zea mays] gi|238014126|gb|ACR38098.1| unknown [Zea mays] gi|414884234|tpg|DAA60248.1| TPA: putative RING zinc finger domain superfamily protein [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
TAIR|locus:2149750242 AIRP2 "ABA Insensitive RING Pr 0.860 0.739 0.454 1.1e-37
TAIR|locus:505006120260 AT1G13195 [Arabidopsis thalian 0.884 0.707 0.444 5.7e-36
TAIR|locus:2024026251 AT1G24440 [Arabidopsis thalian 0.884 0.733 0.442 6.5e-35
TAIR|locus:505006703242 AT5G58787 "AT5G58787" [Arabido 0.735 0.632 0.468 1.7e-34
TAIR|locus:2149750 AIRP2 "ABA Insensitive RING Protein 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 404 (147.3 bits), Expect = 1.1e-37, P = 1.1e-37
 Identities = 89/196 (45%), Positives = 126/196 (64%)

Query:     8 KSSYRESLKALEADIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTD 67
             + S+++SLKALEADIQ ANTLA+  P +Y G +VQMRLSYSP A L LF+++W D  C  
Sbjct:     2 RKSFKDSLKALEADIQFANTLASEYPEEYDGGYVQMRLSYSPAAHLFLFLLQWTD--CH- 58

Query:    68 TVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSELEDNSKR 127
                  LGLL IL+YK YVDG   +S  ERK ++REFY +++PSL QL    +++E+  ++
Sbjct:    59 -FAGALGLLRILIYKAYVDGKTTMSLHERKTSIREFYDVLFPSLLQLHGGITDVEERKQK 117

Query:   128 DQCSEISSRKRVEERRKLSDKDLDRNDECGICMENCTKMVTRKHFSLERIPDKYFSHNGL 187
             + C +   +K   ++ K+S+ DL+R +ECGIC+E   K+V         +P    +H+  
Sbjct:   118 EICDKRYRKKDRTDKGKMSEIDLEREEECGICLEIRNKVV---------LPT--CNHSMC 166

Query:   188 IMNYRN--ARSQSCLF 201
             I  YRN  ARSQSC F
Sbjct:   167 INCYRNWRARSQSCPF 182
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0005829 "cytosol" evidence=IDA
GO:0015996 "chlorophyll catabolic process" evidence=RCA
TAIR|locus:505006120 AT1G13195 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024026 AT1G24440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006703 AT5G58787 "AT5G58787" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 208
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 99.94
PHA02926242 zinc finger-like protein; Provisional 99.52
PHA03096284 p28-like protein; Provisional 98.97
PHA02929238 N1R/p28-like protein; Provisional 98.89
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.73
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.63
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 98.59
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.29
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.11
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.05
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.04
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.03
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.01
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.0
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 97.99
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.97
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.91
PF1463444 zf-RING_5: zinc-RING finger domain 97.9
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.87
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.8
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.75
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 97.65
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.52
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.52
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.51
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.49
smart0050463 Ubox Modified RING finger domain. Modified RING fi 97.42
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.38
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 97.31
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.25
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 96.92
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 96.48
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 96.27
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 96.13
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 96.11
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 96.07
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 95.97
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 95.78
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 95.71
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 94.36
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 94.1
KOG0297 391 consensus TNF receptor-associated factor [Signal t 93.56
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 93.51
KOG1002 791 consensus Nucleotide excision repair protein RAD16 93.48
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 93.22
KOG1941 518 consensus Acetylcholine receptor-associated protei 93.04
COG52191525 Uncharacterized conserved protein, contains RING Z 92.69
COG5236 493 Uncharacterized conserved protein, contains RING Z 92.02
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 91.6
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 91.55
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 91.46
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 91.44
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 91.38
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 90.59
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 90.49
KOG0825 1134 consensus PHD Zn-finger protein [General function 90.14
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 90.09
COG5152259 Uncharacterized conserved protein, contains RING a 88.03
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 87.08
KOG2660 331 consensus Locus-specific chromosome binding protei 86.72
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 86.03
PLN02400 1085 cellulose synthase 85.28
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 84.99
PLN02638 1079 cellulose synthase A (UDP-forming), catalytic subu 84.89
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 84.74
PLN02436 1094 cellulose synthase A 84.64
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 84.43
PLN02189 1040 cellulose synthase 81.59
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 81.38
PLN02915 1044 cellulose synthase A [UDP-forming], catalytic subu 80.83
KOG3002 299 consensus Zn finger protein [General function pred 80.79
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.94  E-value=4.9e-28  Score=220.23  Aligned_cols=177  Identities=20%  Similarity=0.230  Sum_probs=142.2

Q ss_pred             HHhhhhHHHhhhhCCCCCCCceEEEeeccCCc-hhHHHHHHHHhhcCCCCCcccccCceeEEEEEee-eCCCCccchhhh
Q 028527           19 EADIQHANTLAAALPRDYGGDFVQMRLSYSPF-APLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVY-VDGMPALSSKER   96 (208)
Q Consensus        19 eaDIqhAN~lA~~~pr~~~G~~~qmrLsYs~~-a~~flfl~qw~d~~c~~~la~~lgl~~Ilvykvy-~DG~~~~s~~~R   96 (208)
                      +.+++++ |++..+|+++.+.--|||+++++- ..+..++++|+|+.    .|+ .|+..+++|.++ .|+..+++..+|
T Consensus         2 d~~~~~~-tic~~~~~g~c~~g~~cr~~h~~~~~~~~~~~~~~~s~~----~~~-~~~~~~~~~~~~~~~~s~~~s~~~~   75 (344)
T KOG1039|consen    2 DLSLSQE-TICKYYQKGNCKFGDLCRLSHSLPDEEFATLLTPTTSSA----AAS-TGLSQSLIWANAVADASATMSVSSR   75 (344)
T ss_pred             ccccccc-hhhhhcccccccccceeeeeccCchhhcccccccccccc----ccc-cccchhhcccchhhccccccchhcc
Confidence            4678899 999999999999999999999999 99999999999998    666 789999999999 999999999998


Q ss_pred             --hchHHhHHHhhccc---------hHhhhhhhhhhhhh----------hcccchhhhhh-----------hhHHHHhhh
Q 028527           97 --KATLREFYAIIYPS---------LRQLESEFSELEDN----------SKRDQCSEISS-----------RKRVEERRK  144 (208)
Q Consensus        97 --katlrEFY~vI~Ps---------L~qL~~~~~dled~----------kq~~~c~e~~~-----------~kd~e~~~k  144 (208)
                        +..+++|+++.+|+         +-+.+.+..++...          .+...|...++           ..++|   +
T Consensus        76 ~~~~~~~~s~~~~~~s~~~~~~~~~~~~~~~g~~~~~~~~~~~~~c~l~~~~pi~~~~~~~~~~~~~~~~~~~~~e---~  152 (344)
T KOG1039|consen   76 PVLTAIRASSSISEPSSTQENPYSNHGQCRFGNGDVTLNGNNPESCGLGTQHPICKRQYKNSMKRGSSCALSSAME---R  152 (344)
T ss_pred             cchhhhhhhhccccccccccCccccccccccCCcccccccccccccccccccchhHHHHhhhhcccccccchHhhh---h
Confidence              89999999999999         43333333332222          11122222111           12343   6


Q ss_pred             ccccccCCCCccccccccccceeeecccccccCCCCCCCchhhhhHHhccc---------cCCChhhhhccc
Q 028527          145 LSDKDLDRNDECGICMENCTKMVTRKHFSLERIPDKYFSHNGLIMNYRNAR---------SQSCLFAVAAYR  207 (208)
Q Consensus       145 ~s~id~~~d~eCgICME~~~k~V~~k~~~~~~Lpn~~C~H~fCl~Cir~~R---------SkSCP~CR~~~~  207 (208)
                      .+..+.++|++||||||++++++ ....+++||||  |+|+||++|||+||         +++|||||++.+
T Consensus       153 ~~a~~~s~~k~CGICme~i~ek~-~~~~rfgilpn--C~H~~Cl~Cir~wr~~~q~~~~~sksCP~CRv~s~  221 (344)
T KOG1039|consen  153 SFALQKSSEKECGICMETINEKA-ASERRFGILPN--CNHSFCLNCIRKWRQATQFESKTSKSCPFCRVPSS  221 (344)
T ss_pred             ccCcCccccccceehhhhccccc-hhhhhcccCCC--cchhhhhcHhHhhhhhhccccccccCCCcccCccc
Confidence            67777889999999999977777 55677888999  99999999999999         689999999764

>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02400 cellulose synthase Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PLN02436 cellulose synthase A Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>PLN02915 cellulose synthase A [UDP-forming], catalytic subunit Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 4e-07
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
 Score = 47.0 bits (111), Expect = 4e-07
 Identities = 20/87 (22%), Positives = 31/87 (35%), Gaps = 16/87 (18%)

Query: 87  GMPALSS-----KERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRKRVEE 141
           G P         +E   + ++F AII    ++LE    E E    +            EE
Sbjct: 4   GSPGFQEHWALMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQK-----------EE 52

Query: 142 RRKLSDKDLDRNDECGICMENCTKMVT 168
                +  L+   +C IC E   + VT
Sbjct: 53  VLSHMNDVLENELQCIICSEYFIEAVT 79

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.0
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.97
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.94
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.93
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.91
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.82
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.82
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.81
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.81
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.8
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.8
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.8
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.8
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.8
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.78
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.77
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.77
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.75
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.74
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.73
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.73
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.73
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.73
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.72
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.71
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.7
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.7
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.69
2ect_A78 Ring finger protein 126; metal binding protein, st 98.69
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.66
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.65
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.62
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.61
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.61
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.6
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.59
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.57
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.56
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.52
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.52
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.52
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.51
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.51
2ea5_A68 Cell growth regulator with ring finger domain prot 98.5
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.49
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.48
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.45
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.42
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.4
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.39
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.32
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.31
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.3
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.29
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.23
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.19
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.1
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.07
3hcs_A 170 TNF receptor-associated factor 6; cross-brace, bet 98.03
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 97.94
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 97.93
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.83
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 97.83
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 97.56
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.45
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.37
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.27
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 96.88
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 96.62
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 96.13
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 96.09
3nw0_A238 Non-structural maintenance of chromosomes element 93.99
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 90.05
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 88.79
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
Probab=99.00  E-value=1.5e-10  Score=89.35  Aligned_cols=45  Identities=20%  Similarity=0.252  Sum_probs=37.3

Q ss_pred             CCCccccccccccceeeecccccccCCCCCCCchhhhhHHhcc--ccCCChhhhhccc
Q 028527          152 RNDECGICMENCTKMVTRKHFSLERIPDKYFSHNGLIMNYRNA--RSQSCLFAVAAYR  207 (208)
Q Consensus       152 ~d~eCgICME~~~k~V~~k~~~~~~Lpn~~C~H~fCl~Cir~~--RSkSCP~CR~~~~  207 (208)
                      .+..|.||++.-...|.         -+  |+|+||..||..|  ++.+||+||.++.
T Consensus        52 ~~~~C~iC~~~~~~~~~---------~~--CgH~fc~~Ci~~~~~~~~~CP~Cr~~~~   98 (138)
T 4ayc_A           52 NELQCIICSEYFIEAVT---------LN--CAHSFCSYCINEWMKRKIECPICRKDIK   98 (138)
T ss_dssp             HHSBCTTTCSBCSSEEE---------ET--TSCEEEHHHHHHHTTTCSBCTTTCCBCC
T ss_pred             ccCCCcccCcccCCceE---------CC--CCCCccHHHHHHHHHcCCcCCCCCCcCC
Confidence            45689999998777666         34  9999999999977  4578999998874
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.03
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.96
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.93
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.8
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.77
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.75
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.74
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.64
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.61
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.53
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.48
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.45
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.28
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.03
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 97.84
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.62
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 91.1
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.03  E-value=3.2e-11  Score=80.80  Aligned_cols=47  Identities=15%  Similarity=0.261  Sum_probs=36.4

Q ss_pred             CCCCcccccccccc--ceeeecccccccCCCCCCCchhhhhHHhcc--ccCCChhhhhcc
Q 028527          151 DRNDECGICMENCT--KMVTRKHFSLERIPDKYFSHNGLIMNYRNA--RSQSCLFAVAAY  206 (208)
Q Consensus       151 ~~d~eCgICME~~~--k~V~~k~~~~~~Lpn~~C~H~fCl~Cir~~--RSkSCP~CR~~~  206 (208)
                      +.+.+|+|||+.-.  +.+.       .+|.  |+|.||..||.+|  ++.+||.||.++
T Consensus         3 ed~~~C~ICl~~~~~~~~~~-------~l~~--C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i   53 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEAR-------FLPR--CGHGFHAECVDMWLGSHSTCPLCRLTV   53 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCE-------ECSS--SCCEECTTHHHHTTTTCCSCSSSCCCS
T ss_pred             CCCCCCeEECccccCCCEEE-------EeCC--CCCcccHHHHHHHHHhCCcCCCCCCEe
Confidence            46678999998742  1221       2477  9999999999988  457999999876
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure