Citrus Sinensis ID: 028600


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MKNSFRIFTRLGGVRYYAAFGSKDLKIDGVKDVIAVASGKGGVGKSTTAVNLAVALASKCQLKVGLLDADVYGPSVPMMMKIDQKPEVTKDMKMVPIENYGVKCMSMGFLVPSSSPVVWRGPMVMSALRKMSREVDWGNLDILVIDMPPGTGDAQLTTTQTLQLSGALIVSTPQDVALIDARKGITMFSKVQVPVCSFLAQIISSMV
cccccccccccccccccccccccccccccccEEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccEEEEEcccccEEEEEEccccccccEEEccHHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHHHHcccccEEEEEcccccccc
ccccEEEEEEEccccccccccccccccccccEEEEEEcEcccccHHHHHHHHHHHHHHHcccEEEEEEcccccccccHHcccccccccccccEEEEHHHcccEEEEEEEEccccccEEEccHHHHHHHHHHHHHcccccccEEEEEcccccccHEEEEEccccccEEEEEEcHHHHHHHHHHHHHHHHHHccccEEEEEEcccEcEc
MKNSFRIFTRLGGVRYyaafgskdlkidgVKDVIAVasgkggvgksTTAVNLAVALASKCQLKVGlldadvygpsvpmmmkidqkpevtkdmkmvpienygvkcmsmgflvpssspvvwrgpmVMSALRKMSrevdwgnldilvidmppgtgdaqlTTTQTLQLSgalivstpqdvALIDARKGITMFSKVQVPVCSFLAQIISSMV
MKNSFRIFTRLGGVRYYAAfgskdlkidgVKDVIAVasgkggvgksTTAVNLAVALASKCQLKVGLLDADVYGPSVPMMMKIDQKPEVTKDMKMVPIENYGVKCMSMGFLVPSSSPVVWRGPMVMSALRKMSREVDWGNLDILVIDMPPGTGDAQLTTTQTLQLSGALIVSTPQDVALIDARKGITMFSKVQVPVCSFLAQIISSMV
MKNSFRIFTRLGGVRYYAAFGSKDLKIDGVKDVIAVASGKGGVGKSTTAVNLAVALASKCQLKVGLLDADVYGPSVPMMMKIDQKPEVTKDMKMVPIENYGVKCMSMGFLVPSSSPVVWRGPMVMSALRKMSREVDWGNLDILVIDMPPGTGDAqltttqtlqlSGALIVSTPQDVALIDARKGITMFSKVQVPVCSFLAQIISSMV
****FRIFTRLGGVRYYAAFGSKDLKIDGVKDVIAVASGKGGVGKSTTAVNLAVALASKCQLKVGLLDADVYGPSVPMMMKID***EVTKDMKMVPIENYGVKCMSMGFLVPSSSPVVWRGPMVMSALRKMSREVDWGNLDILVIDMPPGTGDAQLTTTQTLQLSGALIVSTPQDVALIDARKGITMFSKVQVPVCSFLAQII****
*******************************DVIAVASGKGGVGKSTTAVNLAVALASKCQLKVGLLDADVYGPSVPMMMK************MVPIENYGVKCMSMGFLVPSSSPVVWRGPMVMSALRKMSREVDWGNLDILVIDMPPGTGDAQLTTTQTLQLSGALIVSTPQDVALIDARKGITMFSKVQVPVCSFLAQIISSMV
MKNSFRIFTRLGGVRYYAAFGSKDLKIDGVKDVIAVASGKGGVGKSTTAVNLAVALASKCQLKVGLLDADVYGPSVPMMMKIDQKPEVTKDMKMVPIENYGVKCMSMGFLVPSSSPVVWRGPMVMSALRKMSREVDWGNLDILVIDMPPGTGDAQLTTTQTLQLSGALIVSTPQDVALIDARKGITMFSKVQVPVCSFLAQIISSMV
**NSFRIFTRLGGVRYYAAFGSKDLKIDGVKDVIAVASGKGGVGKSTTAVNLAVALASKCQLKVGLLDADVYGPSVPMMMKIDQKPEVTKDMKMVPIENYGVKCMSMGFLVPSSSPVVWRGPMVMSALRKMSREVDWGNLDILVIDMPPGTGDAQLTTTQTLQLSGALIVSTPQDVALIDARKGITMFSKVQVPVCSFLAQIISSMV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKNSFRIFTRLGGVRYYAAFGSKDLKIDGVKDVIAVASGKGGVGKSTTAVNLAVALASKCQLKVGLLDADVYGPSVPMMMKIDQKPEVTKDMKMVPIENYGVKCMSMGFLVPSSSPVVWRGPMVMSALRKMSREVDWGNLDILVIDMPPGTGDAQLTTTQTLQLSGALIVSTPQDVALIDARKGITMFSKVQVPVCSFLAQIISSMV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query207 2.2.26 [Sep-21-2011]
Q54F15323 Iron-sulfur protein NUBPL yes no 0.845 0.541 0.578 1e-56
Q8TB37319 Iron-sulfur protein NUBPL yes no 0.869 0.564 0.618 4e-56
Q9CWD8319 Iron-sulfur protein NUBPL yes no 0.869 0.564 0.613 1e-55
P45135370 Protein mrp homolog OS=Ha yes no 0.811 0.454 0.535 4e-48
P0AF08369 Protein mrp OS=Escherichi N/A no 0.845 0.474 0.548 7e-47
P0AF09369 Protein mrp OS=Escherichi yes no 0.845 0.474 0.548 7e-47
Q6CE48312 Iron-sulfur protein IND1 yes no 0.845 0.560 0.5 1e-46
Q9ZMM5368 Protein mrp homolog OS=He yes no 0.830 0.467 0.497 1e-45
O24999368 Protein mrp homolog OS=He no no 0.830 0.467 0.497 2e-45
P72190287 Uncharacterized ATP-bindi N/A no 0.797 0.574 0.565 9e-44
>sp|Q54F15|NUBPL_DICDI Iron-sulfur protein NUBPL OS=Dictyostelium discoideum GN=nubpl PE=3 SV=1 Back     alignment and function desciption
 Score =  219 bits (557), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 103/178 (57%), Positives = 137/178 (76%), Gaps = 3/178 (1%)

Query: 27  IDGVKDVIAVASGKGGVGKSTTAVNLAVALASKCQLKVGLLDADVYGPSVPMMM--KIDQ 84
           I+G+K++IAV+S KGGVGKST AVN+A+ L+S   L VGLLD DV+GPS+P+MM  K  +
Sbjct: 53  IEGIKNIIAVSSAKGGVGKSTCAVNIALGLSSH-NLSVGLLDVDVFGPSIPLMMDLKNHE 111

Query: 85  KPEVTKDMKMVPIENYGVKCMSMGFLVPSSSPVVWRGPMVMSALRKMSREVDWGNLDILV 144
           KP   +  +M+P++NYG+KCMSMGFLV    P++WRGPMV SAL K+ R+ DWG+LD+LV
Sbjct: 112 KPFTNELNQMIPLQNYGIKCMSMGFLVNEDDPIIWRGPMVGSALEKLLRQTDWGHLDVLV 171

Query: 145 IDMPPGTGDAQLTTTQTLQLSGALIVSTPQDVALIDARKGITMFSKVQVPVCSFLAQI 202
            D+PPGTGDA LT  Q + L+GA+IVSTPQDVAL D  +G+ MF KV+VP+   +  +
Sbjct: 172 CDLPPGTGDAILTMCQRVPLTGAVIVSTPQDVALADVVRGVNMFKKVEVPILGLVENM 229




Required for the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). May deliver of one or more Fe-S clusters to complex I subunits.
Dictyostelium discoideum (taxid: 44689)
>sp|Q8TB37|NUBPL_HUMAN Iron-sulfur protein NUBPL OS=Homo sapiens GN=NUBPL PE=1 SV=3 Back     alignment and function description
>sp|Q9CWD8|NUBPL_MOUSE Iron-sulfur protein NUBPL OS=Mus musculus GN=Nubpl PE=2 SV=2 Back     alignment and function description
>sp|P45135|MRP_HAEIN Protein mrp homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=mrp PE=3 SV=2 Back     alignment and function description
>sp|P0AF08|MRP_ECOLI Protein mrp OS=Escherichia coli (strain K12) GN=mrp PE=3 SV=1 Back     alignment and function description
>sp|P0AF09|MRP_ECOL6 Protein mrp OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mrp PE=3 SV=1 Back     alignment and function description
>sp|Q6CE48|IND1_YARLI Iron-sulfur protein IND1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IND1 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZMM5|MRP_HELPJ Protein mrp homolog OS=Helicobacter pylori (strain J99) GN=mrp PE=3 SV=1 Back     alignment and function description
>sp|O24999|MRP_HELPY Protein mrp homolog OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=mrp PE=3 SV=2 Back     alignment and function description
>sp|P72190|YCAB_PSEFR Uncharacterized ATP-binding protein in capB 3'region OS=Pseudomonas fragi PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query207
255559965293 Protein mrp, putative [Ricinus communis] 0.975 0.689 0.758 1e-84
224085613293 predicted protein [Populus trichocarpa] 0.975 0.689 0.748 5e-83
224062188260 predicted protein [Populus trichocarpa] 0.859 0.684 0.803 1e-79
356536802277 PREDICTED: iron-sulfur protein NUBPL-lik 0.879 0.657 0.747 8e-77
356545830277 PREDICTED: iron-sulfur protein NUBPL-lik 0.879 0.657 0.752 8e-77
388502488279 unknown [Lotus japonicus] 0.879 0.652 0.747 5e-76
147777913 341 hypothetical protein VITISV_031406 [Viti 0.893 0.542 0.724 1e-75
225437266 341 PREDICTED: iron-sulfur protein NUBPL [Vi 0.893 0.542 0.724 1e-75
449490453294 PREDICTED: iron-sulfur protein NUBPL-lik 0.917 0.646 0.717 3e-75
449444635294 PREDICTED: iron-sulfur protein NUBPL-lik 0.917 0.646 0.712 1e-74
>gi|255559965|ref|XP_002521001.1| Protein mrp, putative [Ricinus communis] gi|223539838|gb|EEF41418.1| Protein mrp, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  317 bits (813), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 154/203 (75%), Positives = 174/203 (85%), Gaps = 1/203 (0%)

Query: 1   MKNSFRIFTRLGGVRYYA-AFGSKDLKIDGVKDVIAVASGKGGVGKSTTAVNLAVALASK 59
           MK   R   RLGG R YA +F    L+++GVKDVIAVASGKGGVGKSTTAVNLAVALA+K
Sbjct: 1   MKGFLRPLGRLGGYRCYATSFSRSKLRLEGVKDVIAVASGKGGVGKSTTAVNLAVALATK 60

Query: 60  CQLKVGLLDADVYGPSVPMMMKIDQKPEVTKDMKMVPIENYGVKCMSMGFLVPSSSPVVW 119
           CQLKVGLLDADVYGPS+P MM+ID+KP+VT D KM+PIENYGVKCMS+GFLV   +P+VW
Sbjct: 61  CQLKVGLLDADVYGPSIPTMMRIDRKPDVTADTKMIPIENYGVKCMSIGFLVEKDAPIVW 120

Query: 120 RGPMVMSALRKMSREVDWGNLDILVIDMPPGTGDAQLTTTQTLQLSGALIVSTPQDVALI 179
           RGPMVMSAL KM R VDWGNLDILV+DMPPGTGDAQLT +Q LQLSGALIVSTPQDVALI
Sbjct: 121 RGPMVMSALEKMLRGVDWGNLDILVVDMPPGTGDAQLTVSQNLQLSGALIVSTPQDVALI 180

Query: 180 DARKGITMFSKVQVPVCSFLAQI 202
           DAR+G+ MFSKVQVP+  F+  +
Sbjct: 181 DARRGVKMFSKVQVPILGFIENM 203




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224085613|ref|XP_002307635.1| predicted protein [Populus trichocarpa] gi|222857084|gb|EEE94631.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224062188|ref|XP_002300792.1| predicted protein [Populus trichocarpa] gi|222842518|gb|EEE80065.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356536802|ref|XP_003536923.1| PREDICTED: iron-sulfur protein NUBPL-like [Glycine max] Back     alignment and taxonomy information
>gi|356545830|ref|XP_003541337.1| PREDICTED: iron-sulfur protein NUBPL-like [Glycine max] Back     alignment and taxonomy information
>gi|388502488|gb|AFK39310.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|147777913|emb|CAN75726.1| hypothetical protein VITISV_031406 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225437266|ref|XP_002282449.1| PREDICTED: iron-sulfur protein NUBPL [Vitis vinifera] gi|297735519|emb|CBI17959.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449490453|ref|XP_004158610.1| PREDICTED: iron-sulfur protein NUBPL-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449444635|ref|XP_004140079.1| PREDICTED: iron-sulfur protein NUBPL-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query207
TAIR|locus:2122995313 INDH "iron-sulfur protein requ 0.884 0.584 0.695 2.2e-66
UNIPROTKB|F1NG62289 NUBPL "Uncharacterized protein 0.874 0.626 0.606 8.9e-54
UNIPROTKB|E1BE32331 NUBPL "Uncharacterized protein 0.874 0.546 0.612 3e-53
UNIPROTKB|Q8TB37319 NUBPL "Iron-sulfur protein NUB 0.874 0.567 0.612 3.8e-53
RGD|1307232319 Nubpl "nucleotide binding prot 0.874 0.567 0.606 4.9e-53
MGI|MGI:1924076319 Nubpl "nucleotide binding prot 0.874 0.567 0.606 6.3e-53
UNIPROTKB|E2REF1333 NUBPL "Uncharacterized protein 0.855 0.531 0.601 1.7e-52
DICTYBASE|DDB_G0291193323 nubpl "Mrp/NBP35 family protei 0.811 0.520 0.578 1.1e-50
UNIPROTKB|Q60CU7361 MCA0052 "MrP protein" [Methylo 0.845 0.484 0.511 2.3e-48
UNIPROTKB|Q4K759364 PFL_4843 "Uncharacterized prot 0.792 0.450 0.591 6.9e-47
TAIR|locus:2122995 INDH "iron-sulfur protein required for NADH dehydrogenase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 675 (242.7 bits), Expect = 2.2e-66, P = 2.2e-66
 Identities = 128/184 (69%), Positives = 155/184 (84%)

Query:    24 DLKIDGVKDVIAVASGKGGVGKSTTAVNLAVALASKCQLKVGLLDADVYGPSVPMMMKID 83
             +L++ GVKD+IAVASGKGGVGKS+TAVNLAVALA+KC+LK+GLLDADVYGPSVP+MM I+
Sbjct:    36 ELRLHGVKDIIAVASGKGGVGKSSTAVNLAVALANKCELKIGLLDADVYGPSVPIMMNIN 95

Query:    84 QKPEVTKDMKMVPIENYGVKCMSMGFLVPSSSPVVWRGPMVMSALRKMSREVDWGNLDIL 143
             QKP+V +DMKM+P+ENYGVKCMSMG LV   +P+VWRGPMVMSAL KM++ VDWG+LDIL
Sbjct:    96 QKPQVNQDMKMIPVENYGVKCMSMGLLVEKDAPLVWRGPMVMSALAKMTKGVDWGDLDIL 155

Query:   144 VIDMPPGTGDAXXXXXXXXXXSGALIVSTPQDVALIDARKGITMFSKVQVPVCSFLAQII 203
             V+DMPPGTGDA          SGA+IVSTPQDVAL DA +GI+MF KV+VP+   L + +
Sbjct:   156 VVDMPPGTGDAQISISQNLKLSGAVIVSTPQDVALADANRGISMFDKVRVPILG-LVENM 214

Query:   204 SSMV 207
             S  V
Sbjct:   215 SCFV 218




GO:0005739 "mitochondrion" evidence=ISM;IDA
UNIPROTKB|F1NG62 NUBPL "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BE32 NUBPL "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TB37 NUBPL "Iron-sulfur protein NUBPL" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1307232 Nubpl "nucleotide binding protein-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1924076 Nubpl "nucleotide binding protein-like" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2REF1 NUBPL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291193 nubpl "Mrp/NBP35 family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q60CU7 MCA0052 "MrP protein" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
UNIPROTKB|Q4K759 PFL_4843 "Uncharacterized protein" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00051274
hypothetical protein (293 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_Genewise1_v1.C_LG_VII0255
cysteine desulfurase/transaminase (EC-2.8.1.7) (452 aa)
      0.445
fgenesh4_pg.C_scaffold_15960000001
Predicted protein (371 aa)
      0.425

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
PRK11670369 PRK11670, PRK11670, antiporter inner membrane prot 8e-74
cd02037169 cd02037, MRP-like, MRP (Multiple Resistance and pH 1e-66
COG0489265 COG0489, Mrp, ATPases involved in chromosome parti 4e-56
pfam1060981 pfam10609, ParA, ParA/MinD ATPase like 7e-29
COG0455262 COG0455, flhG, Antiactivator of flagellar biosynth 8e-18
COG1192259 COG1192, Soj, ATPases involved in chromosome parti 8e-14
pfam01656217 pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide bi 1e-13
cd03110179 cd03110, Fer4_NifH_child, This protein family's fu 3e-13
COG1149284 COG1149, COG1149, MinD superfamily P-loop ATPase c 2e-12
cd02042104 cd02042, ParA, ParA and ParB of Caulobacter cresce 4e-12
cd02038139 cd02038, FleN-like, FleN is a member of the Fer4_N 1e-11
cd02036179 cd02036, MinD, Bacterial cell division requires th 2e-11
pfam13614145 pfam13614, AAA_31, AAA domain 1e-10
TIGR01969251 TIGR01969, minD_arch, cell division ATPase MinD, a 4e-10
cd03111106 cd03111, CpaE_like, This protein family consists o 6e-08
TIGR03018207 TIGR03018, pepcterm_TyrKin, exopolysaccharide/PEP- 9e-08
COG2894272 COG2894, MinD, Septum formation inhibitor-activati 2e-07
cd0198399 cd01983, Fer4_NifH, The Fer4_NifH superfamily cont 3e-07
TIGR01968261 TIGR01968, minD_bact, septum site-determining prot 5e-07
CHL00175281 CHL00175, minD, septum-site determining protein; V 2e-06
pfam09140262 pfam09140, MipZ, ATPase MipZ 2e-06
cd02035217 cd02035, ArsA, ArsA ATPase functionas as an efflux 3e-06
PHA02518211 PHA02518, PHA02518, ParA-like protein; Provisional 4e-05
TIGR03815322 TIGR03815, CpaE_hom_Actino, helicase/secretion nei 9e-05
COG0003 322 COG0003, ArsA, Predicted ATPase involved in chromo 1e-04
PRK13185270 PRK13185, chlL, protochlorophyllide reductase iron 1e-04
TIGR01007204 TIGR01007, eps_fam, capsular exopolysaccharide fam 2e-04
cd02032267 cd02032, Bchl_like, This family of proteins contai 4e-04
cd02117212 cd02117, NifH_like, This family contains the NifH 4e-04
cd02034116 cd02034, CooC, The accessory protein CooC, which c 8e-04
COG1348 278 COG1348, NifH, Nitrogenase subunit NifH (ATPase) [ 0.002
COG3640255 COG3640, CooC, CO dehydrogenase maturation factor 0.002
TIGR03371246 TIGR03371, cellulose_yhjQ, cellulose synthase oper 0.002
TIGR01281268 TIGR01281, DPOR_bchL, light-independent protochlor 0.002
cd02040270 cd02040, NifH, NifH gene encodes component II (iro 0.003
TIGR03029274 TIGR03029, EpsG, chain length determinant protein 0.003
PRK13231264 PRK13231, PRK13231, nitrogenase reductase-like pro 0.004
CHL00072 290 CHL00072, chlL, photochlorophyllide reductase subu 0.004
>gnl|CDD|183270 PRK11670, PRK11670, antiporter inner membrane protein; Provisional Back     alignment and domain information
 Score =  226 bits (579), Expect = 8e-74
 Identities = 97/170 (57%), Positives = 130/170 (76%), Gaps = 2/170 (1%)

Query: 27  IDGVKDVIAVASGKGGVGKSTTAVNLAVALASKCQLKVGLLDADVYGPSVPMMMKI-DQK 85
           ++GVK++IAV+SGKGGVGKS+TAVNLA+ALA++   KVG+LDAD+YGPS+P M+   DQ+
Sbjct: 103 VNGVKNIIAVSSGKGGVGKSSTAVNLALALAAE-GAKVGILDADIYGPSIPTMLGAEDQR 161

Query: 86  PEVTKDMKMVPIENYGVKCMSMGFLVPSSSPVVWRGPMVMSALRKMSREVDWGNLDILVI 145
           P       M PI  +G+   S+G+LV   + +VWRGPM   AL +M +E  W +LD LV+
Sbjct: 162 PTSPDGTHMAPIMAHGLATNSIGYLVTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVL 221

Query: 146 DMPPGTGDAQLTTTQTLQLSGALIVSTPQDVALIDARKGITMFSKVQVPV 195
           DMPPGTGD QLT  Q + ++GA++V+TPQD+ALIDA+KGI MF KV+VPV
Sbjct: 222 DMPPGTGDIQLTLAQNIPVTGAVVVTTPQDIALIDAKKGIVMFEKVEVPV 271


Length = 369

>gnl|CDD|238994 cd02037, MRP-like, MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>gnl|CDD|223563 COG0489, Mrp, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|204531 pfam10609, ParA, ParA/MinD ATPase like Back     alignment and domain information
>gnl|CDD|223531 COG0455, flhG, Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] Back     alignment and domain information
>gnl|CDD|224113 COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|216631 pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide binding domain Back     alignment and domain information
>gnl|CDD|239384 cd03110, Fer4_NifH_child, This protein family's function is unkown Back     alignment and domain information
>gnl|CDD|224071 COG1149, COG1149, MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|238997 cd02042, ParA, ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>gnl|CDD|238995 cd02038, FleN-like, FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>gnl|CDD|238993 cd02036, MinD, Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>gnl|CDD|222264 pfam13614, AAA_31, AAA domain Back     alignment and domain information
>gnl|CDD|131024 TIGR01969, minD_arch, cell division ATPase MinD, archaeal Back     alignment and domain information
>gnl|CDD|239385 cd03111, CpaE_like, This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>gnl|CDD|132063 TIGR03018, pepcterm_TyrKin, exopolysaccharide/PEP-CTERM locus tyrosine autokinase Back     alignment and domain information
>gnl|CDD|225447 COG2894, MinD, Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|238941 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>gnl|CDD|131023 TIGR01968, minD_bact, septum site-determining protein MinD Back     alignment and domain information
>gnl|CDD|214385 CHL00175, minD, septum-site determining protein; Validated Back     alignment and domain information
>gnl|CDD|220125 pfam09140, MipZ, ATPase MipZ Back     alignment and domain information
>gnl|CDD|238992 cd02035, ArsA, ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>gnl|CDD|222854 PHA02518, PHA02518, ParA-like protein; Provisional Back     alignment and domain information
>gnl|CDD|234363 TIGR03815, CpaE_hom_Actino, helicase/secretion neighborhood CpaE-like protein Back     alignment and domain information
>gnl|CDD|223082 COG0003, ArsA, Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|237293 PRK13185, chlL, protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130080 TIGR01007, eps_fam, capsular exopolysaccharide family Back     alignment and domain information
>gnl|CDD|238989 cd02032, Bchl_like, This family of proteins contains bchL and chlL Back     alignment and domain information
>gnl|CDD|239034 cd02117, NifH_like, This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>gnl|CDD|238991 cd02034, CooC, The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>gnl|CDD|224267 COG1348, NifH, Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226166 COG3640, CooC, CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|234188 TIGR03371, cellulose_yhjQ, cellulose synthase operon protein YhjQ Back     alignment and domain information
>gnl|CDD|130348 TIGR01281, DPOR_bchL, light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein Back     alignment and domain information
>gnl|CDD|238996 cd02040, NifH, NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>gnl|CDD|132074 TIGR03029, EpsG, chain length determinant protein tyrosine kinase EpsG Back     alignment and domain information
>gnl|CDD|183904 PRK13231, PRK13231, nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|177011 CHL00072, chlL, photochlorophyllide reductase subunit L Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 207
PRK11670369 antiporter inner membrane protein; Provisional 100.0
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t 99.98
TIGR01007204 eps_fam capsular exopolysaccharide family. This mo 99.98
TIGR03029274 EpsG chain length determinant protein tyrosine kin 99.97
KOG3022300 consensus Predicted ATPase, nucleotide-binding [Ce 99.97
COG0489265 Mrp ATPases involved in chromosome partitioning [C 99.97
TIGR01969251 minD_arch cell division ATPase MinD, archaeal. Thi 99.97
CHL00175281 minD septum-site determining protein; Validated 99.96
PRK11519719 tyrosine kinase; Provisional 99.96
PRK09841726 cryptic autophosphorylating protein tyrosine kinas 99.96
cd02117212 NifH_like This family contains the NifH (iron prot 99.96
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 99.96
TIGR01005754 eps_transp_fam exopolysaccharide transport protein 99.96
TIGR01968261 minD_bact septum site-determining protein MinD. Th 99.96
PRK13869405 plasmid-partitioning protein RepA; Provisional 99.96
PRK13232273 nifH nitrogenase reductase; Reviewed 99.95
COG0455262 flhG Antiactivator of flagellar biosynthesis FleN, 99.95
PRK10818270 cell division inhibitor MinD; Provisional 99.95
PRK13185270 chlL protochlorophyllide reductase iron-sulfur ATP 99.95
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein Y 99.95
COG2894272 MinD Septum formation inhibitor-activating ATPase 99.95
PRK13705388 plasmid-partitioning protein SopA; Provisional 99.95
PRK13233275 nifH nitrogenase reductase; Reviewed 99.95
PHA02519387 plasmid partition protein SopA; Reviewed 99.95
TIGR03815322 CpaE_hom_Actino helicase/secretion neighborhood Cp 99.94
TIGR03453387 partition_RepA plasmid partitioning protein RepA. 99.94
COG1192259 Soj ATPases involved in chromosome partitioning [C 99.94
cd02032267 Bchl_like This family of proteins contains bchL an 99.94
TIGR01281268 DPOR_bchL light-independent protochlorophyllide re 99.94
CHL00072 290 chlL photochlorophyllide reductase subunit L 99.94
PRK13235274 nifH nitrogenase reductase; Reviewed 99.94
cd02040270 NifH NifH gene encodes component II (iron protein) 99.94
PRK10037250 cell division protein; Provisional 99.94
PRK13236 296 nitrogenase reductase; Reviewed 99.94
PHA02518211 ParA-like protein; Provisional 99.94
cd03110179 Fer4_NifH_child This protein family's function is 99.93
PRK13234 295 nifH nitrogenase reductase; Reviewed 99.93
PRK13849231 putative crown gall tumor protein VirC1; Provision 99.93
TIGR01287275 nifH nitrogenase iron protein. This model describe 99.93
cd02036179 MinD Bacterial cell division requires the formatio 99.93
PRK13231264 nitrogenase reductase-like protein; Reviewed 99.93
PRK13230279 nitrogenase reductase-like protein; Reviewed 99.92
PF01656195 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai 99.92
PF06564243 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p 99.92
PF07015231 VirC1: VirC1 protein; InterPro: IPR009744 This fam 99.91
TIGR02016296 BchX chlorophyllide reductase iron protein subunit 99.91
cd03111106 CpaE_like This protein family consists of proteins 99.9
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 99.9
cd02033 329 BchX Chlorophyllide reductase converts chlorophyll 99.89
cd02035217 ArsA ArsA ATPase functionas as an efflux pump loca 99.88
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 99.88
COG1149284 MinD superfamily P-loop ATPase containing an inser 99.88
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). 99.87
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 99.87
PF13614157 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ 99.85
PF09140261 MipZ: ATPase MipZ; InterPro: IPR015223 Cell divisi 99.83
PF00142273 Fer4_NifH: 4Fe-4S iron sulfur cluster binding prot 99.81
COG4963366 CpaE Flp pilus assembly protein, ATPase CpaE [Intr 99.8
COG1348278 NifH Nitrogenase subunit NifH (ATPase) [Inorganic 99.8
PF02374305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 99.74
COG0003322 ArsA Predicted ATPase involved in chromosome parti 99.66
cd03114148 ArgK-like The function of this protein family is u 99.65
TIGR00064272 ftsY signal recognition particle-docking protein F 99.65
TIGR00347166 bioD dethiobiotin synthase. Dethiobiotin synthase 99.62
cd02034116 CooC The accessory protein CooC, which contains a 99.57
PRK10867 433 signal recognition particle protein; Provisional 99.57
PRK13768253 GTPase; Provisional 99.56
cd03115173 SRP The signal recognition particle (SRP) mediates 99.55
TIGR00959 428 ffh signal recognition particle protein. This mode 99.55
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 99.53
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 99.52
PRK10416318 signal recognition particle-docking protein FtsY; 99.52
PRK13886241 conjugal transfer protein TraL; Provisional 99.52
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 99.49
PRK00771 437 signal recognition particle protein Srp54; Provisi 99.47
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 99.46
PRK00090222 bioD dithiobiotin synthetase; Reviewed 99.45
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 99.39
COG0132223 BioD Dethiobiotin synthetase [Coenzyme metabolism] 99.37
KOG2825323 consensus Putative arsenite-translocating ATPase [ 99.35
PRK14974336 cell division protein FtsY; Provisional 99.33
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 99.32
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 99.31
PRK12374231 putative dithiobiotin synthetase; Provisional 99.31
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 99.3
PRK01077 451 cobyrinic acid a,c-diamide synthase; Validated 99.28
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 99.27
TIGR00750 300 lao LAO/AO transport system ATPase. Mutations have 99.26
COG1703 323 ArgK Putative periplasmic protein kinase ArgK and 99.26
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 99.26
PF13500199 AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R 99.23
PRK14493 274 putative bifunctional molybdopterin-guanine dinucl 99.23
PRK09435 332 membrane ATPase/protein kinase; Provisional 99.23
KOG0780 483 consensus Signal recognition particle, subunit Srp 99.17
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 99.16
TIGR00345284 arsA arsenite-activated ATPase (arsA). The N-termi 99.15
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 99.13
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 99.13
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 99.13
PRK05632 684 phosphate acetyltransferase; Reviewed 99.1
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 99.09
PF1060981 ParA: ParA/MinD ATPase like; InterPro: IPR019591 T 99.07
PRK00784 488 cobyric acid synthase; Provisional 99.06
KOG1532 366 consensus GTPase XAB1, interacts with DNA repair p 99.06
cd03109134 DTBS Dethiobiotin synthetase (DTBS) is the penulti 99.04
TIGR00313 475 cobQ cobyric acid synthase CobQ. 99.04
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 99.03
COG0552340 FtsY Signal recognition particle GTPase [Intracell 98.9
TIGR00379 449 cobB cobyrinic acid a,c-diamide synthase. This mod 98.87
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 98.87
PRK13896 433 cobyrinic acid a,c-diamide synthase; Provisional 98.86
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 98.85
PRK13505 557 formate--tetrahydrofolate ligase; Provisional 98.81
COG1797 451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme 98.8
PRK06278476 cobyrinic acid a,c-diamide synthase; Validated 98.79
KOG0781587 consensus Signal recognition particle receptor, al 98.75
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 98.55
cd00477 524 FTHFS Formyltetrahydrofolate synthetase (FTHFS) ca 98.47
KOG1533 290 consensus Predicted GTPase [General function predi 98.42
PRK13506 578 formate--tetrahydrofolate ligase; Provisional 98.41
COG1341 398 Predicted GTPase or GTP-binding protein [General f 98.35
PLN02974 817 adenosylmethionine-8-amino-7-oxononanoate transami 98.28
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 98.25
cd04170 268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 98.24
cd04169 267 RF3 RF3 subfamily. Peptide chain release factor 3 98.24
cd01886 270 EF-G Elongation factor G (EF-G) subfamily. Translo 98.23
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 98.14
PRK14494229 putative molybdopterin-guanine dinucleotide biosyn 98.12
cd00881189 GTP_translation_factor GTP translation factor fami 98.12
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 98.12
cd04168 237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 98.1
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 98.08
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 98.07
cd03112158 CobW_like The function of this protein family is u 98.07
TIGR00503 527 prfC peptide chain release factor 3. This translat 98.01
PRK00741 526 prfC peptide chain release factor 3; Provisional 98.0
PRK08233182 hypothetical protein; Provisional 97.99
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 97.99
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.98
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.98
PRK14495 452 putative molybdopterin-guanine dinucleotide biosyn 97.97
PRK00889175 adenylylsulfate kinase; Provisional 97.97
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 97.95
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 97.94
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 97.92
COG1492 486 CobQ Cobyric acid synthase [Coenzyme metabolism] 97.91
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 97.91
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 97.89
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 97.88
COG2403 449 Predicted GTPase [General function prediction only 97.86
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.86
PRK12740 668 elongation factor G; Reviewed 97.85
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 97.84
PLN03127 447 Elongation factor Tu; Provisional 97.83
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 97.82
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.81
PRK00007 693 elongation factor G; Reviewed 97.8
PHA02542 473 41 41 helicase; Provisional 97.8
COG1160 444 Predicted GTPases [General function prediction onl 97.78
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 97.78
PRK00049 396 elongation factor Tu; Reviewed 97.78
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 97.76
PRK12739 691 elongation factor G; Reviewed 97.76
PRK10218 607 GTP-binding protein; Provisional 97.74
PRK00089 292 era GTPase Era; Reviewed 97.74
PRK04296190 thymidine kinase; Provisional 97.72
COG1159 298 Era GTPase [General function prediction only] 97.71
PRK07667193 uridine kinase; Provisional 97.67
PRK05480209 uridine/cytidine kinase; Provisional 97.66
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 97.66
KOG1534273 consensus Putative transcription factor FET5 [Tran 97.65
PRK00093 435 GTP-binding protein Der; Reviewed 97.64
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 97.64
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 97.61
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 97.58
cd04171164 SelB SelB subfamily. SelB is an elongation factor 97.58
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 97.58
PRK06067234 flagellar accessory protein FlaH; Validated 97.57
COG0857 354 Pta BioD-like N-terminal domain of phosphotransace 97.57
cd03116159 MobB Molybdenum is an essential trace element in t 97.57
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.56
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 97.55
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 97.54
PRK06696223 uridine kinase; Validated 97.53
smart00382148 AAA ATPases associated with a variety of cellular 97.52
cd01394218 radB RadB. The archaeal protein radB shares simila 97.52
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 97.51
TIGR00485 394 EF-Tu translation elongation factor TU. This align 97.51
cd03113255 CTGs CTP synthetase (CTPs) is a two-domain protein 97.5
COG1066 456 Sms Predicted ATP-dependent serine protease [Postt 97.5
PRK12735 396 elongation factor Tu; Reviewed 97.49
CHL00071 409 tufA elongation factor Tu 97.49
PRK03846198 adenylylsulfate kinase; Provisional 97.49
PRK12736 394 elongation factor Tu; Reviewed 97.49
PTZ00416 836 elongation factor 2; Provisional 97.46
TIGR00436 270 era GTP-binding protein Era. Era is an essential G 97.46
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 97.45
PRK11537 318 putative GTP-binding protein YjiA; Provisional 97.44
PRK05973237 replicative DNA helicase; Provisional 97.42
PRK13351 687 elongation factor G; Reviewed 97.4
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 97.4
PF02606 326 LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPr 97.4
PLN03126 478 Elongation factor Tu; Provisional 97.38
PLN00043 447 elongation factor 1-alpha; Provisional 97.38
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 97.37
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 97.35
PRK11823 446 DNA repair protein RadA; Provisional 97.34
PF00154322 RecA: recA bacterial DNA recombination protein; In 97.33
TIGR02475 341 CobW cobalamin biosynthesis protein CobW. A broade 97.32
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 97.32
PRK05595444 replicative DNA helicase; Provisional 97.3
PRK15453 290 phosphoribulokinase; Provisional 97.29
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This 97.26
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 97.25
cd01393226 recA_like RecA is a bacterial enzyme which has rol 97.25
TIGR00682 311 lpxK tetraacyldisaccharide 4'-kinase. Also called 97.24
PF07755301 DUF1611: Protein of unknown function (DUF1611); In 97.24
PRK14491 597 putative bifunctional molybdopterin-guanine dinucl 97.23
PRK04328249 hypothetical protein; Provisional 97.23
PRK00652325 lpxK tetraacyldisaccharide 4'-kinase; Reviewed 97.21
PRK07952244 DNA replication protein DnaC; Validated 97.2
KOG0635207 consensus Adenosine 5'-phosphosulfate kinase [Inor 97.19
PRK07560 731 elongation factor EF-2; Reviewed 97.19
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 97.19
PRK12317 425 elongation factor 1-alpha; Reviewed 97.18
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 97.17
PF13479213 AAA_24: AAA domain 97.16
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 97.16
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 97.16
PRK14489366 putative bifunctional molybdopterin-guanine dinucl 97.14
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 97.12
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 97.12
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 97.12
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 97.12
PRK09270229 nucleoside triphosphate hydrolase domain-containin 97.11
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 97.1
TIGR00235207 udk uridine kinase. Model contains a number of lon 97.1
PRK03003 472 GTP-binding protein Der; Reviewed 97.07
PLN00116 843 translation elongation factor EF-2 subunit; Provis 97.07
PRK05433 600 GTP-binding protein LepA; Provisional 97.07
COG0523 323 Putative GTPases (G3E family) [General function pr 97.06
PF1324576 AAA_19: Part of AAA domain 97.06
TIGR02012321 tigrfam_recA protein RecA. This model describes or 97.05
CHL00189 742 infB translation initiation factor 2; Provisional 97.04
cd02029 277 PRK_like Phosphoribulokinase-like (PRK-like) is a 97.04
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 97.03
KOG2743 391 consensus Cobalamin synthesis protein [Coenzyme tr 97.01
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.0
TIGR03575 340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 96.98
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 96.98
COG3598 402 RepA RecA-family ATPase [DNA replication, recombin 96.97
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 96.96
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 96.96
KOG1805 1100 consensus DNA replication helicase [Replication, r 96.94
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 96.92
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 96.89
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 96.88
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 96.87
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 96.87
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 96.86
PRK05439311 pantothenate kinase; Provisional 96.86
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 96.85
PRK05541176 adenylylsulfate kinase; Provisional 96.83
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 96.82
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 96.81
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.79
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.77
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 96.76
PRK06762166 hypothetical protein; Provisional 96.76
PRK09519 790 recA DNA recombination protein RecA; Reviewed 96.76
cd00983325 recA RecA is a bacterial enzyme which has roles in 96.76
cd01878204 HflX HflX subfamily. A distinct conserved domain w 96.76
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.73
PRK09165497 replicative DNA helicase; Provisional 96.71
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 96.69
PRK09302 509 circadian clock protein KaiC; Reviewed 96.67
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 96.67
COG3367339 Uncharacterized conserved protein [Function unknow 96.66
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 96.65
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 96.65
PRK14733204 coaE dephospho-CoA kinase; Provisional 96.65
PHA00729226 NTP-binding motif containing protein 96.65
TIGR00101199 ureG urease accessory protein UreG. This model rep 96.63
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 96.59
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 96.59
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.58
COG4108 528 PrfC Peptide chain release factor RF-3 [Translatio 96.58
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 96.5
PF06418276 CTP_synth_N: CTP synthase N-terminus; InterPro: IP 96.48
COG4088261 Predicted nucleotide kinase [Nucleotide transport 96.46
PRK09354 349 recA recombinase A; Provisional 96.46
PRK06526254 transposase; Provisional 96.45
PRK04004 586 translation initiation factor IF-2; Validated 96.44
PRK12377248 putative replication protein; Provisional 96.42
PRK13507 587 formate--tetrahydrofolate ligase; Provisional 96.41
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 96.41
PRK07414178 cob(I)yrinic acid a,c-diamide adenosyltransferase; 96.4
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 96.39
PF01268 557 FTHFS: Formate--tetrahydrofolate ligase; InterPro: 96.38
KOG2749 415 consensus mRNA cleavage and polyadenylation factor 96.37
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 96.36
PRK11058 426 GTPase HflX; Provisional 96.33
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 96.33
PRK08760476 replicative DNA helicase; Provisional 96.33
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 96.33
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 96.28
TIGR00665434 DnaB replicative DNA helicase. This model describe 96.23
PRK08506 472 replicative DNA helicase; Provisional 96.23
PRK05642234 DNA replication initiation factor; Validated 96.21
PRK06835329 DNA replication protein DnaC; Validated 96.2
PLN02924220 thymidylate kinase 96.19
COG0050 394 TufB GTPases - translation elongation factors [Tra 96.17
COG2759 554 MIS1 Formyltetrahydrofolate synthetase [Nucleotide 96.16
PRK08939306 primosomal protein DnaI; Reviewed 96.15
PRK13949169 shikimate kinase; Provisional 96.14
PRK12298 390 obgE GTPase CgtA; Reviewed 96.12
PRK09183259 transposase/IS protein; Provisional 96.12
PRK08727233 hypothetical protein; Validated 96.11
PRK06893229 DNA replication initiation factor; Validated 96.1
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 96.08
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 96.07
PRK08006471 replicative DNA helicase; Provisional 96.07
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 96.06
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 96.06
PRK06749428 replicative DNA helicase; Provisional 96.05
PRK06904472 replicative DNA helicase; Validated 96.03
PRK05748448 replicative DNA helicase; Provisional 96.03
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 96.02
PTZ00141 446 elongation factor 1- alpha; Provisional 96.01
PTZ00035337 Rad51 protein; Provisional 95.99
COG4240300 Predicted kinase [General function prediction only 95.98
PRK08840464 replicative DNA helicase; Provisional 95.97
PRK08903227 DnaA regulatory inactivator Hda; Validated 95.96
PTZ00301210 uridine kinase; Provisional 95.96
COG1663 336 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell env 95.95
PF01935229 DUF87: Domain of unknown function DUF87; InterPro: 95.93
PLN03186342 DNA repair protein RAD51 homolog; Provisional 95.93
PLN03046460 D-glycerate 3-kinase; Provisional 95.92
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 95.9
PLN03118211 Rab family protein; Provisional 95.89
PF12846 304 AAA_10: AAA-like domain 95.89
PRK08116268 hypothetical protein; Validated 95.87
PRK08181269 transposase; Validated 95.87
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 95.86
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 95.83
PRK08084235 DNA replication initiation factor; Provisional 95.81
PRK06921266 hypothetical protein; Provisional 95.81
PRK06321472 replicative DNA helicase; Provisional 95.8
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.79
PF13173128 AAA_14: AAA domain 95.78
PRK07933213 thymidylate kinase; Validated 95.76
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 95.76
PRK08118167 topology modulation protein; Reviewed 95.73
PRK06217183 hypothetical protein; Validated 95.73
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 95.73
PRK05380 533 pyrG CTP synthetase; Validated 95.73
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 95.72
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 95.69
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 95.68
PRK05636505 replicative DNA helicase; Provisional 95.67
PLN02796347 D-glycerate 3-kinase 95.64
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 95.63
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 95.61
PLN02348 395 phosphoribulokinase 95.61
TIGR02236310 recomb_radA DNA repair and recombination protein R 95.6
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 95.57
KOG3220225 consensus Similar to bacterial dephospho-CoA kinas 95.55
PRK07004460 replicative DNA helicase; Provisional 95.54
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 95.5
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 95.5
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 95.5
TIGR00337 525 PyrG CTP synthase. CTP synthase is involved in pyr 95.48
PF02572172 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase 95.48
PRK00131175 aroK shikimate kinase; Reviewed 95.47
PLN02759 637 Formate--tetrahydrofolate ligase 95.45
PRK14734200 coaE dephospho-CoA kinase; Provisional 95.44
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 95.4
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 95.35
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 95.34
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 95.34
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 95.29
PRK09302509 circadian clock protein KaiC; Reviewed 95.29
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 95.28
PRK00698205 tmk thymidylate kinase; Validated 95.26
PRK04301317 radA DNA repair and recombination protein RadA; Va 95.24
PRK01906 338 tetraacyldisaccharide 4'-kinase; Provisional 95.24
COG0504 533 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide 95.23
PF05729166 NACHT: NACHT domain 95.22
PRK13973213 thymidylate kinase; Provisional 95.22
PLN02327 557 CTP synthase 95.21
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 95.19
PRK06851367 hypothetical protein; Provisional 95.18
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 95.17
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 95.17
PF01121180 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th 95.16
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 95.11
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 95.11
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 95.06
PTZ00386 625 formyl tetrahydrofolate synthetase; Provisional 95.01
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 95.0
COG2874235 FlaH Predicted ATPases involved in biogenesis of a 94.98
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 94.97
PRK06547172 hypothetical protein; Provisional 94.97
PRK00091 307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 94.96
COG2109198 BtuR ATP:corrinoid adenosyltransferase [Coenzyme m 94.95
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 94.93
PRK09866 741 hypothetical protein; Provisional 94.92
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 94.92
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 94.91
PRK06761 282 hypothetical protein; Provisional 94.9
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 94.89
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 94.89
PRK04040188 adenylate kinase; Provisional 94.87
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 94.82
COG1855 604 ATPase (PilT family) [General function prediction 94.8
PRK05057172 aroK shikimate kinase I; Reviewed 94.8
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 94.78
PRK03731171 aroL shikimate kinase II; Reviewed 94.76
PLN02200234 adenylate kinase family protein 94.72
TIGR03172232 probable selenium-dependent hydroxylase accessory 94.71
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 94.69
PTZ00327 460 eukaryotic translation initiation factor 2 gamma s 94.68
PRK14490 369 putative bifunctional molybdopterin-guanine dinucl 94.65
cd00154159 Rab Rab family. Rab GTPases form the largest famil 94.64
KOG3062 281 consensus RNA polymerase II elongator associated p 94.64
PRK07413 382 hypothetical protein; Validated 94.61
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 94.6
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 94.57
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 94.57
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 94.56
PRK00093 435 GTP-binding protein Der; Reviewed 94.51
PRK15494 339 era GTPase Era; Provisional 94.51
PRK07261171 topology modulation protein; Provisional 94.5
PRK13947171 shikimate kinase; Provisional 94.48
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 94.47
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 94.45
PRK07773 886 replicative DNA helicase; Validated 94.42
PRK00081194 coaE dephospho-CoA kinase; Reviewed 94.37
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 94.36
cd04173 222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 94.33
COG1217 603 TypA Predicted membrane GTPase involved in stress 94.31
PRK06851 367 hypothetical protein; Provisional 94.29
PRK12339197 2-phosphoglycerate kinase; Provisional 94.29
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 94.23
PRK14732196 coaE dephospho-CoA kinase; Provisional 94.21
COG1100219 GTPase SAR1 and related small G proteins [General 94.21
COG1936180 Predicted nucleotide kinase (related to CMP and AM 94.19
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 94.18
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 94.16
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 94.15
PLN02165 334 adenylate isopentenyltransferase 94.15
PRK05306 787 infB translation initiation factor IF-2; Validated 94.12
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 94.12
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 94.08
PF00004132 AAA: ATPase family associated with various cellula 94.07
PRK14730195 coaE dephospho-CoA kinase; Provisional 94.06
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 94.0
PRK13975196 thymidylate kinase; Provisional 93.99
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 93.98
PHA02530 300 pseT polynucleotide kinase; Provisional 93.95
PRK04000 411 translation initiation factor IF-2 subunit gamma; 93.92
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 93.91
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 93.89
TIGR03680 406 eif2g_arch translation initiation factor 2 subunit 93.89
PRK14731208 coaE dephospho-CoA kinase; Provisional 93.89
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 93.87
PRK03839180 putative kinase; Provisional 93.86
smart00178184 SAR Sar1p-like members of the Ras-family of small 93.86
PRK12422 445 chromosomal replication initiation protein; Provis 93.85
TIGR00362405 DnaA chromosomal replication initiator protein Dna 93.81
PTZ00451244 dephospho-CoA kinase; Provisional 93.78
PRK13948182 shikimate kinase; Provisional 93.78
TIGR00376 637 DNA helicase, putative. The gene product may repre 93.77
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 93.75
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 93.68
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 93.68
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 93.68
PRK12338 319 hypothetical protein; Provisional 93.65
PRK13946184 shikimate kinase; Provisional 93.63
PRK14530215 adenylate kinase; Provisional 93.63
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport 93.62
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 93.59
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 93.59
COG0703172 AroK Shikimate kinase [Amino acid transport and me 93.58
PRK02496184 adk adenylate kinase; Provisional 93.48
PRK14531183 adenylate kinase; Provisional 93.47
KOG1145 683 consensus Mitochondrial translation initiation fac 93.46
KOG0468 971 consensus U5 snRNP-specific protein [Translation, 93.43
PLN02422232 dephospho-CoA kinase 93.41
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 93.4
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 93.39
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 93.38
PRK14527191 adenylate kinase; Provisional 93.32
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 93.32
KOG0448 749 consensus Mitofusin 1 GTPase, involved in mitochon 93.31
PRK07429 327 phosphoribulokinase; Provisional 93.3
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 93.24
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 93.22
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 93.22
PRK00149 450 dnaA chromosomal replication initiation protein; R 93.2
>PRK11670 antiporter inner membrane protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=6.5e-32  Score=219.55  Aligned_cols=193  Identities=48%  Similarity=0.790  Sum_probs=143.0

Q ss_pred             EEEeecCccccccccccccccCCCCeEEEEEeCCCCCcHHHHHHHHHHHHHHhCCCeEEEEecCCCCCCccccccccCCc
Q 028600            7 IFTRLGGVRYYAAFGSKDLKIDGVKDVIAVASGKGGVGKSTTAVNLAVALASKCQLKVGLLDADVYGPSVPMMMKIDQKP   86 (207)
Q Consensus         7 ~~~~~~~~r~~~~~~~~~~~~~~~~k~I~v~s~kgG~GkTt~a~~LA~~la~~~g~~VlliD~d~~~~~l~~~~~~~~~~   86 (207)
                      +.+.++.+|.+..+.    ..++..++|+|+|+|||+||||+++|||.+||+ .|+||++||+|+++++++.+||.....
T Consensus        87 ~~~~~~~~~~~~~~~----~~~~~~~vIaV~S~KGGVGKTT~avNLA~aLA~-~G~rVlLID~D~qgps~~~~lg~~~~~  161 (369)
T PRK11670         87 LSHNIATLKRVNNQP----GVNGVKNIIAVSSGKGGVGKSSTAVNLALALAA-EGAKVGILDADIYGPSIPTMLGAEDQR  161 (369)
T ss_pred             Eeeehhhhccccccc----cCCCCCEEEEEeCCCCCCCHHHHHHHHHHHHHH-CCCcEEEEeCCCCCCCcchhcCCcccC
Confidence            334455566554433    256678999999999999999999999999999 999999999999999998888864322


Q ss_pred             c-ccccccceecccccceeecccccCCCCCcccccchhhHHHHHHHHH-hcccCCCCEEEEcCCCCCCcchhhhhhhhcC
Q 028600           87 E-VTKDMKMVPIENYGVKCMSMGFLVPSSSPVVWRGPMVMSALRKMSR-EVDWGNLDILVIDMPPGTGDAQLTTTQTLQL  164 (207)
Q Consensus        87 ~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~-~l~~~~~D~IiiD~~~~~~~~~~~~~~~~~~  164 (207)
                      . ..+...+.+....++.....+.+........++++.....+.+++. .+. +.||||||||||++++..+++..+..+
T Consensus       162 ~~~~~~~~i~p~~~~g~~~~~~~~l~~~~~~~i~~g~~~~~~l~~~l~~~~~-~~yDyvIID~PPg~gd~~l~~~~l~aa  240 (369)
T PRK11670        162 PTSPDGTHMAPIMAHGLATNSIGYLVTDDNAMVWRGPMASKALMQMLQETLW-PDLDYLVLDMPPGTGDIQLTLAQNIPV  240 (369)
T ss_pred             CcccCCceeeeeeccCcccccHHHhcCcCcceeecCcchHHHHHHHHHHHhh-ccCCEEEEeCCCCCchHHHHHhhhccC
Confidence            1 1112223333333333333333333333344455555667777774 455 889999999999998765656666578


Q ss_pred             ceEEEeeCCchhhHHHHHHHHHHhhhCCCCeeEEEEccccC
Q 028600          165 SGALIVSTPQDVALIDARKGITMFSKVQVPVCSFLAQIISS  205 (207)
Q Consensus       165 d~vi~v~~~~~~~~~~~~~~l~~l~~~~~~~~g~v~N~~~~  205 (207)
                      |.+|+|+.+...++.++.+.++.+.+.+.+++|+|+|+++.
T Consensus       241 d~viiV~tp~~~s~~da~~~i~~~~~~~~~ilGiV~Nm~~~  281 (369)
T PRK11670        241 TGAVVVTTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSMH  281 (369)
T ss_pred             CeEEEEecCchhHHHHHHHHHHHHhccCCCeEEEEEcCCcc
Confidence            99999999999999999999999999999999999999753



>TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase Back     alignment and domain information
>TIGR01007 eps_fam capsular exopolysaccharide family Back     alignment and domain information
>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG Back     alignment and domain information
>KOG3022 consensus Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01969 minD_arch cell division ATPase MinD, archaeal Back     alignment and domain information
>CHL00175 minD septum-site determining protein; Validated Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>TIGR01968 minD_bact septum site-determining protein MinD Back     alignment and domain information
>PRK13869 plasmid-partitioning protein RepA; Provisional Back     alignment and domain information
>PRK13232 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] Back     alignment and domain information
>PRK10818 cell division inhibitor MinD; Provisional Back     alignment and domain information
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ Back     alignment and domain information
>COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK13705 plasmid-partitioning protein SopA; Provisional Back     alignment and domain information
>PRK13233 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PHA02519 plasmid partition protein SopA; Reviewed Back     alignment and domain information
>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein Back     alignment and domain information
>TIGR03453 partition_RepA plasmid partitioning protein RepA Back     alignment and domain information
>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein Back     alignment and domain information
>CHL00072 chlL photochlorophyllide reductase subunit L Back     alignment and domain information
>PRK13235 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>PRK10037 cell division protein; Provisional Back     alignment and domain information
>PRK13236 nitrogenase reductase; Reviewed Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>PRK13234 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>PRK13231 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>PRK13230 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases Back     alignment and domain information
>PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon Back     alignment and domain information
>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins Back     alignment and domain information
>TIGR02016 BchX chlorophyllide reductase iron protein subunit X Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring Back     alignment and domain information
>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>PF13614 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ_A 3KB1_B 1ION_A 3LA6_H 3BFV_B 3CIO_D Back     alignment and domain information
>PF09140 MipZ: ATPase MipZ; InterPro: IPR015223 Cell division in bacteria is facilitated by a polymeric ring structure, the Z ring, composed of tubulin-like FtsZ protofilaments Back     alignment and domain information
>PF00142 Fer4_NifH: 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family; InterPro: IPR000392 This entry represents members of the NifH/BchL/ChlL family Back     alignment and domain information
>COG4963 CpaE Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion] Back     alignment and domain information
>COG1348 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR00347 bioD dethiobiotin synthase Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK13886 conjugal transfer protein TraL; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK00090 bioD dithiobiotin synthetase; Reviewed Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG0132 BioD Dethiobiotin synthetase [Coenzyme metabolism] Back     alignment and domain information
>KOG2825 consensus Putative arsenite-translocating ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12374 putative dithiobiotin synthetase; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13500 AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R_A 4A0H_B 4A0F_B 3FMI_C 3FPA_D 3FMF_C 3FGN_A Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00345 arsA arsenite-activated ATPase (arsA) Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05632 phosphate acetyltransferase; Reviewed Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF10609 ParA: ParA/MinD ATPase like; InterPro: IPR019591 This entry represents ATPases involved in plasmid partitioning [] Back     alignment and domain information
>PRK00784 cobyric acid synthase; Provisional Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>cd03109 DTBS Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms Back     alignment and domain information
>TIGR00313 cobQ cobyric acid synthase CobQ Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00379 cobB cobyrinic acid a,c-diamide synthase Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK13505 formate--tetrahydrofolate ligase; Provisional Back     alignment and domain information
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK06278 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd00477 FTHFS Formyltetrahydrofolate synthetase (FTHFS) catalyzes the ATP-dependent activation of formate ion via its addition to the N10 position of tetrahydrofolate Back     alignment and domain information
>KOG1533 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK13506 formate--tetrahydrofolate ligase; Provisional Back     alignment and domain information
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK14495 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>COG2403 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>KOG1534 consensus Putative transcription factor FET5 [Transcription] Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>COG0857 Pta BioD-like N-terminal domain of phosphotransacetylase [General function prediction only] Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>cd03113 CTGs CTP synthetase (CTPs) is a two-domain protein, which consists of an N-terminal synthetase domain and C-terminal glutaminase domain Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK11537 putative GTP-binding protein YjiA; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PF02606 LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPro: IPR003758 Tetraacyldisaccharide 4'-kinase phosphorylates the 4'-position of a tetraacyldisaccharide 1-phosphate precursor (DS-1-P) of lipid A, but the enzyme has not yet been purified because of instability [] Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>TIGR02475 CobW cobalamin biosynthesis protein CobW Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR00682 lpxK tetraacyldisaccharide 4'-kinase Back     alignment and domain information
>PF07755 DUF1611: Protein of unknown function (DUF1611); InterPro: IPR011669 This entry contains a number of hypothetical bacterial and archaeal proteins Back     alignment and domain information
>PRK14491 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoeA; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK00652 lpxK tetraacyldisaccharide 4'-kinase; Reviewed Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>KOG2743 consensus Cobalamin synthesis protein [Coenzyme transport and metabolism] Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>COG3367 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>PF06418 CTP_synth_N: CTP synthase N-terminus; InterPro: IPR017456 CTP synthase is involved in pyrimidine ribonucleotide/ribonucleoside metabolism, catalysing the synthesis of CTP from UTP by amination of the pyrimidine ring at the 4-position [] Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK13507 formate--tetrahydrofolate ligase; Provisional Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>PF01268 FTHFS: Formate--tetrahydrofolate ligase; InterPro: IPR000559 Formate--tetrahydrofolate ligase (6 Back     alignment and domain information
>KOG2749 consensus mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1 [RNA processing and modification] Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2759 MIS1 Formyltetrahydrofolate synthetase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>PRK06749 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>COG1663 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>PRK05380 pyrG CTP synthetase; Validated Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG3220 consensus Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>TIGR00337 PyrG CTP synthase Back     alignment and domain information
>PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PLN02759 Formate--tetrahydrofolate ligase Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PRK01906 tetraacyldisaccharide 4'-kinase; Provisional Back     alignment and domain information
>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>PLN02327 CTP synthase Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PTZ00386 formyl tetrahydrofolate synthetase; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>TIGR03172 probable selenium-dependent hydroxylase accessory protein YqeC Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>KOG3062 consensus RNA polymerase II elongator associated protein [General function prediction only] Back     alignment and domain information
>PRK07413 hypothetical protein; Validated Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PRK07773 replicative DNA helicase; Validated Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
3kb1_A262 Crystal Structure Of The Nucleotide-Binding Protein 5e-31
2ph1_A262 Crystal Structure Of Nucleotide-Binding Protein Af2 6e-30
3vx3_A248 Crystal Structure Of [nife] Hydrogenase Maturation 3e-21
1wcv_1257 Structure Of The Bacterial Chromosome Segregation P 8e-04
>pdb|3KB1|A Chain A, Crystal Structure Of The Nucleotide-Binding Protein Af_226 In Complex With Adp From Archaeoglobus Fulgidus, Northeast Structural Genomics Consortium Target Gr157 Length = 262 Back     alignment and structure

Iteration: 1

Score = 130 bits (327), Expect = 5e-31, Method: Compositional matrix adjust. Identities = 72/173 (41%), Positives = 103/173 (59%), Gaps = 4/173 (2%) Query: 26 KIDGVKDVIAVASGKGGVGKSTTAVNLAVALASKCQLKVGLLDADVYGPSVPMMMKIDQK 85 ++D + IAV SGKGGVGKST LAV A + + KVG+LDAD GPS+P + +++ Sbjct: 13 RLDKIGFRIAVXSGKGGVGKSTVTALLAVHYAKQGK-KVGILDADFLGPSIPHLFGLEKG 71 Query: 86 PEVTKDMKMVPI--ENYGVKCMSMGFLVPS-SSPVVWRGPMVMSALRKMSREVDWGNLDI 142 D + P+ + G+K S+ FL+P +PV+WRGP++ +R+ V WG LD Sbjct: 72 KVAVSDEGLEPVLTQRLGIKVXSIQFLLPKRETPVIWRGPLIAGXIREFLGRVAWGELDY 131 Query: 143 LVIDMPPGTGDAXXXXXXXXXXSGALIVSTPQDVALIDARKGITMFSKVQVPV 195 L+ID+PPGTGDA +GA+IVSTPQ++ K IT + + V Sbjct: 132 LLIDLPPGTGDAPLTVXQDAKPNGAVIVSTPQELTAAVVEKAITXAEQTKTAV 184
>pdb|2PH1|A Chain A, Crystal Structure Of Nucleotide-Binding Protein Af2382 From Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr165 Length = 262 Back     alignment and structure
>pdb|3VX3|A Chain A, Crystal Structure Of [nife] Hydrogenase Maturation Protein Hypb From Thermococcus Kodakarensis Kod1 Length = 248 Back     alignment and structure
>pdb|1WCV|1 Chain 1, Structure Of The Bacterial Chromosome Segregation Protein Soj Length = 257 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 9e-99
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 6e-20
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 1e-19
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 1e-17
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 1e-15
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 2e-14
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 6e-13
3cwq_A209 Para family chromosome partitioning protein; alpha 6e-13
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 1e-12
2xj4_A 286 MIPZ; replication, cell division, ATPase, WACA; 1. 2e-12
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 4e-11
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 3e-10
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 4e-10
3ez2_A 398 Plasmid partition protein A; type IA, DNA binding, 5e-10
3pg5_A 361 Uncharacterized protein; structural genomics, PSI- 2e-09
3ez9_A 403 Para; DNA binding, winged-HTH, partition, biosynth 2e-09
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 3e-08
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 7e-08
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
3iqw_A 334 Tail-anchored protein targeting factor GET3; ATPas 2e-06
3ug7_A 349 Arsenical pump-driving ATPase; tail-anchored, memb 2e-05
3end_A307 Light-independent protochlorophyllide reductase ir 3e-05
2afh_E 289 Nitrogenase iron protein 1; nitrogen fixation, iro 5e-05
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 6e-05
2woj_A 354 ATPase GET3; tail-anchored, membrane protein, targ 2e-04
3igf_A 374 ALL4481 protein; two-domained protein consisting o 2e-04
3io3_A 348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 3e-04
2woo_A 329 ATPase GET3; tail-anchored, membrane protein, targ 4e-04
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 5e-04
3zq6_A 324 Putative arsenical pump-driving ATPase; tail-ancho 5e-04
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Length = 262 Back     alignment and structure
 Score =  286 bits (733), Expect = 9e-99
 Identities = 74/173 (42%), Positives = 105/173 (60%), Gaps = 4/173 (2%)

Query: 26  KIDGVKDVIAVASGKGGVGKSTTAVNLAVALASKCQLKVGLLDADVYGPSVPMMMKIDQK 85
           ++  +K  IAV SGKGGVGKST    LAV  A +   KVG+LDAD  GPS+P++  +   
Sbjct: 13  RLGKIKSRIAVMSGKGGVGKSTVTALLAVHYARQG-KKVGILDADFLGPSIPILFGLRNA 71

Query: 86  PEVTKDMKMVPI--ENYGVKCMSMGFLVPS-SSPVVWRGPMVMSALRKMSREVDWGNLDI 142
                   + P+  + YG+K MSM FL+P  ++PV+WRGP++   +R+    V WG LD 
Sbjct: 72  RIAVSAEGLEPVLTQKYGIKVMSMQFLLPKENTPVIWRGPLIAGMIREFLGRVAWGELDH 131

Query: 143 LVIDMPPGTGDAQLTTTQTLQLSGALIVSTPQDVALIDARKGITMFSKVQVPV 195
           L+ID+PPGTGDA LT  Q  + +G ++VSTPQ++  +   K I M  +    V
Sbjct: 132 LLIDLPPGTGDAPLTVMQDAKPTGVVVVSTPQELTAVIVEKAINMAEETNTSV 184


>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Length = 245 Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Length = 373 Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Length = 254 Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Length = 260 Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Length = 263 Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Length = 206 Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Length = 209 Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Length = 237 Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Length = 286 Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Length = 267 Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Length = 298 Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Length = 257 Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Length = 398 Back     alignment and structure
>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} Length = 361 Back     alignment and structure
>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A Length = 403 Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Length = 299 Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Length = 286 Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Length = 271 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Length = 334 Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Length = 349 Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Length = 289 Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Length = 589 Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Length = 354 Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Length = 374 Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Length = 348 Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Length = 329 Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Length = 269 Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 324 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query207
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 100.0
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 100.0
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 99.98
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 99.98
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 99.97
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 99.96
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 99.96
3pg5_A 361 Uncharacterized protein; structural genomics, PSI- 99.96
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 99.96
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 99.96
3end_A307 Light-independent protochlorophyllide reductase ir 99.95
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 99.95
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 99.95
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 99.95
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 99.95
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 99.95
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 99.94
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 99.94
3fwy_A314 Light-independent protochlorophyllide reductase I 99.94
3ez9_A403 Para; DNA binding, winged-HTH, partition, biosynth 99.93
3ez2_A398 Plasmid partition protein A; type IA, DNA binding, 99.93
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 99.92
2xj4_A286 MIPZ; replication, cell division, ATPase, WACA; 1. 99.92
3cwq_A209 Para family chromosome partitioning protein; alpha 99.92
2woj_A354 ATPase GET3; tail-anchored, membrane protein, targ 99.92
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 99.91
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 99.91
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 99.9
3io3_A348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 99.88
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 99.87
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 99.83
3igf_A 374 ALL4481 protein; two-domained protein consisting o 99.81
1ihu_A589 Arsenical pump-driving ATPase; aluminum fluoride, 99.81
2xxa_A 433 Signal recognition particle protein; protein trans 99.76
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 99.7
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 99.7
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 99.66
3of5_A228 Dethiobiotin synthetase; structural genomics, cent 99.64
3qxc_A242 Dethiobiotin synthetase; DTBS, structural genomics 99.64
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 99.63
3fgn_A251 Dethiobiotin synthetase; biotin biosynthesis, BIOD 99.62
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 99.61
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 99.59
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 99.58
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 99.54
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 99.45
1vma_A306 Cell division protein FTSY; TM0570, structural gen 99.44
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 99.43
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 99.27
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 99.1
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 99.01
3pzx_A 557 Formate--tetrahydrofolate ligase; HET: TOE; 2.20A 98.93
4a0g_A 831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 98.73
2obn_A349 Hypothetical protein; structural genomics, joint c 98.71
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 98.69
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 98.67
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 98.31
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.3
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 98.3
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 98.28
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 98.26
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 98.2
2g0t_A350 Conserved hypothetical protein; structural genomic 98.14
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 98.06
2og2_A359 Putative signal recognition particle receptor; nuc 98.06
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 98.03
1vco_A 550 CTP synthetase; tetramer, riken structural genomic 98.02
1s1m_A 545 CTP synthase; CTP synthetase, UTP:ammonia ligase ( 98.0
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 97.89
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 97.88
1xjc_A169 MOBB protein homolog; structural genomics, midwest 97.87
1u94_A 356 RECA protein, recombinase A; homologous recombinat 97.85
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 97.85
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 97.84
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 97.8
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 97.79
1xp8_A 366 RECA protein, recombinase A; recombination, radior 97.76
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 97.72
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.67
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 97.62
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 97.62
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 97.61
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 97.57
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.57
3io5_A 333 Recombination and repair protein; storage dimer, i 97.53
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 97.5
3t1o_A198 Gliding protein MGLA; G domain containing protein, 97.47
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 97.46
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 97.46
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 97.44
3iby_A 256 Ferrous iron transport protein B; G protein, G dom 97.39
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 97.38
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 97.36
2hf9_A226 Probable hydrogenase nickel incorporation protein 97.34
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 97.33
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 97.31
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 97.28
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 97.28
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 97.26
2ged_A193 SR-beta, signal recognition particle receptor beta 97.26
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 97.25
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 97.24
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 97.24
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 97.23
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 97.22
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 97.18
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 97.18
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 97.18
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 97.16
2c5m_A294 CTP synthase; cytidine 5-prime triphosphate synthe 97.15
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 97.12
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 97.11
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 97.04
1a7j_A 290 Phosphoribulokinase; transferase, calvin cycle; 2. 97.03
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 97.0
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 96.97
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 96.92
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 96.91
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 96.9
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 96.9
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 96.88
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 96.87
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 96.86
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 96.85
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 96.81
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 96.77
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 96.75
2cvh_A220 DNA repair and recombination protein RADB; filamen 96.74
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.73
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 96.72
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 96.7
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 96.7
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 96.69
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 96.68
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 96.64
1nrj_B218 SR-beta, signal recognition particle receptor beta 96.6
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 96.53
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 96.51
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 96.43
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 96.4
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 96.35
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 96.35
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 96.35
2r6a_A454 DNAB helicase, replicative helicase; replication, 96.34
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.34
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.32
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 96.3
3nva_A 535 CTP synthase; rossman fold, nucleotide binding, LI 96.28
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.26
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 96.2
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 96.2
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 96.19
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 96.12
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.11
3bos_A242 Putative DNA replication factor; P-loop containing 96.1
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 96.09
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 96.09
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 96.08
2vo1_A295 CTP synthase 1; pyrimidine biosynthesis, glutamine 96.06
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 96.0
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 95.97
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 95.95
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 95.91
2z43_A324 DNA repair and recombination protein RADA; archaea 95.89
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 95.87
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 95.87
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 95.86
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 95.82
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 95.82
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 95.81
2qgz_A308 Helicase loader, putative primosome component; str 95.8
2kjq_A149 DNAA-related protein; solution structure, NESG, st 95.78
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 95.7
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 95.68
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 95.67
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 95.67
3do6_A 543 Formate--tetrahydrofolate ligase; TM1766, putative 95.66
1via_A175 Shikimate kinase; structural genomics, transferase 95.66
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 95.62
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 95.62
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 95.61
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 95.59
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 95.57
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 95.55
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 95.53
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 95.52
3lxx_A239 GTPase IMAP family member 4; structural genomics c 95.49
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 95.46
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 95.46
3vaa_A199 Shikimate kinase, SK; structural genomics, center 95.42
1kag_A173 SKI, shikimate kinase I; transferase, structural g 95.38
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 95.37
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 95.36
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 95.35
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 95.33
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 95.3
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 95.3
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 95.3
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 95.27
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 95.27
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 95.25
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 95.24
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 95.21
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.2
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 95.16
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 95.16
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 95.14
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 95.12
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 95.06
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 95.05
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 95.04
3i8s_A 274 Ferrous iron transport protein B; GTPase, GPCR, ir 95.02
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 95.01
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 95.01
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 94.99
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 94.98
3llu_A196 RAS-related GTP-binding protein C; structural geno 94.98
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 94.96
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 94.96
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 94.93
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 94.91
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 94.91
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 94.91
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 94.9
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 94.89
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 94.87
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 94.84
1jwy_B 315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 94.83
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 94.83
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 94.81
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 94.81
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 94.78
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 94.77
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 94.76
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 94.75
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 94.74
1w78_A 422 FOLC bifunctional protein; DHFS, dihydrofolate syn 94.73
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 94.73
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 94.72
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 94.69
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 94.68
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 94.68
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 94.67
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 94.66
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 94.64
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 94.63
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 94.62
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 94.62
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 94.58
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 94.58
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 94.57
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 94.52
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 94.51
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 94.49
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 94.48
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 94.48
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 94.48
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 94.46
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 94.44
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 94.42
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 94.42
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 94.41
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 94.41
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 94.4
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 94.4
1wb1_A 482 Translation elongation factor SELB; selenocysteine 94.38
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 94.35
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 94.34
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 94.33
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 94.32
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 94.31
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 94.29
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 94.29
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 94.27
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 94.26
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 94.26
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.26
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 94.25
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 94.25
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 94.21
1jbw_A 428 Folylpolyglutamate synthase; FPGS folate AMPPCP te 94.18
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 94.16
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 94.16
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 94.15
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 94.14
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 94.11
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 94.11
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 94.11
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 94.06
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 94.06
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 94.05
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 94.01
2vli_A183 Antibiotic resistance protein; transferase, tunica 93.99
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 93.97
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 93.97
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 93.96
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 93.95
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 93.95
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 93.94
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 93.93
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 93.93
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 93.9
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 93.9
4dqx_A277 Probable oxidoreductase protein; structural genomi 93.86
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 93.84
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 93.83
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 93.82
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 93.8
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 93.8
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 93.76
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 93.74
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 93.72
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 93.71
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 93.7
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 93.67
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 93.67
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 93.66
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 93.6
1e8c_A 498 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diami 93.59
1o5z_A 442 Folylpolyglutamate synthase/dihydrofolate synthas; 93.56
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 93.55
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 93.52
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 93.52
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 93.52
3nrs_A 437 Dihydrofolate:folylpolyglutamate synthetase; struc 93.49
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 93.47
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 93.46
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 93.46
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 93.42
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 93.4
2wtz_A 535 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-di 93.36
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 93.35
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 93.31
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 93.29
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 93.29
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 93.26
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 93.23
2vos_A 487 Folylpolyglutamate synthase protein FOLC; ligase, 93.22
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 93.22
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 93.19
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 93.17
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 93.16
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 93.12
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 93.09
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 93.07
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 93.07
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 93.06
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 93.05
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 93.04
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 93.04
2chg_A226 Replication factor C small subunit; DNA-binding pr 93.01
3b1v_A 272 Ferrous iron uptake transporter protein B; G prote 92.99
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 92.99
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 92.95
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 92.95
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 92.94
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 92.92
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 92.89
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 92.88
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 92.88
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 92.88
3tlx_A243 Adenylate kinase 2; structural genomics, structura 92.86
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 92.81
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 92.8
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 92.76
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 92.73
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 92.71
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 92.71
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 92.7
4a74_A231 DNA repair and recombination protein RADA; hydrola 92.66
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 92.62
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 92.57
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 92.55
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 92.54
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 92.53
3a1s_A 258 Iron(II) transport protein B; FEOB, iron transport 92.49
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 92.44
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 92.34
2eyu_A261 Twitching motility protein PILT; pilus retraction 92.34
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 92.33
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 92.3
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 92.29
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 92.23
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 92.23
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 92.2
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 92.18
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 92.13
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 92.09
2ewv_A372 Twitching motility protein PILT; pilus retraction 92.04
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 92.04
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 91.99
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 91.94
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 91.93
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 91.9
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 91.89
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 91.88
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 91.85
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 91.82
3r20_A233 Cytidylate kinase; structural genomics, seattle st 91.81
3hn7_A 524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 91.78
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 91.62
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 91.57
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 91.56
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 91.54
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 91.52
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 91.44
3o47_A329 ADP-ribosylation factor GTPase-activating protein 91.41
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 91.4
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 91.29
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 91.2
1j6u_A 469 UDP-N-acetylmuramate-alanine ligase MURC; structur 91.19
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 91.16
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 91.14
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 91.11
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 91.08
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 91.0
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 90.95
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 90.93
2wji_A165 Ferrous iron transport protein B homolog; membrane 90.9
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 90.73
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 90.69
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 90.65
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 90.6
1p3d_A 475 UDP-N-acetylmuramate--alanine ligase; alpha/beta p 90.56
2fh5_B214 SR-beta, signal recognition particle receptor beta 90.56
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 90.55
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 90.47
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 90.45
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 90.43
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 90.36
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 90.36
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 90.34
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 90.27
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 90.21
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 90.17
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 90.09
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 90.08
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 90.07
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 89.97
2f00_A 491 UDP-N-acetylmuramate--L-alanine ligase; amide bond 89.93
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 89.83
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 89.81
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 89.8
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 89.79
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 89.79
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 89.73
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 89.73
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 89.69
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 89.68
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 89.66
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 89.61
3bs4_A260 Uncharacterized protein PH0321; structural genomic 89.61
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 89.56
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 89.53
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 89.5
1xzp_A 482 Probable tRNA modification GTPase TRME; GTP-bindin 89.49
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 89.44
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 89.39
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 89.34
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 89.34
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 89.32
3gee_A 476 MNME, tRNA modification GTPase MNME; G protein, cy 89.24
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 89.22
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 89.17
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 89.14
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 89.13
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 89.11
3gem_A260 Short chain dehydrogenase; structural genomics, AP 89.06
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 89.05
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 89.02
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 89.0
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 88.98
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 88.93
2fna_A 357 Conserved hypothetical protein; structural genomic 88.9
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 88.82
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 88.8
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 88.68
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 88.25
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 88.45
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 88.42
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 88.39
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 88.39
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 88.36
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 88.35
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 88.33
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 88.31
1p9r_A418 General secretion pathway protein E; bacterial typ 88.28
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 88.27
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 88.25
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 88.21
1dek_A241 Deoxynucleoside monophosphate kinase; transferase, 88.19
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 88.18
1tue_A212 Replication protein E1; helicase, replication, E1E 88.15
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 88.1
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 88.07
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 88.07
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 88.07
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 88.06
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 88.05
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 88.0
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=1.5e-34  Score=227.72  Aligned_cols=188  Identities=15%  Similarity=0.218  Sum_probs=156.5

Q ss_pred             EEEEeecCccccccccccccccCCCCeEEEEEeCCCCCcHHHHHHHHHHHHHHhCCCeEEEEecCCCCCCccccccccCC
Q 028600            6 RIFTRLGGVRYYAAFGSKDLKIDGVKDVIAVASGKGGVGKSTTAVNLAVALASKCQLKVGLLDADVYGPSVPMMMKIDQK   85 (207)
Q Consensus         6 ~~~~~~~~~r~~~~~~~~~~~~~~~~k~I~v~s~kgG~GkTt~a~~LA~~la~~~g~~VlliD~d~~~~~l~~~~~~~~~   85 (207)
                      ++.|+++.+|+++.+....    ..+|+|+|+|+|||+||||+|+|||.++|+ .|+||++||+|++.++++.+|+.+..
T Consensus        71 ~~~Ea~r~lrt~l~~~~~~----~~~kvI~vts~kgG~GKTtva~nLA~~lA~-~G~rVLLID~D~~~~~l~~~~~~~~~  145 (286)
T 3la6_A           71 LAIEAIRSLRTSLHFAMMQ----AQNNVLMMTGVSPSIGMTFVCANLAAVISQ-TNKRVLLIDCDMRKGYTHELLGTNNV  145 (286)
T ss_dssp             HHHHHHHHHHHHHHHHSTT----TTCCEEEEEESSSSSSHHHHHHHHHHHHHT-TTCCEEEEECCTTTCCHHHHHTCCCT
T ss_pred             HHHHHHHHHHHHHhhhccC----CCCeEEEEECCCCCCcHHHHHHHHHHHHHh-CCCCEEEEeccCCCCCHHHHhCCCCC
Confidence            3457899999999997743    348999999999999999999999999999 99999999999999999999998876


Q ss_pred             cccccc--------ccceecccccceeecccccCCCCCcccccchhhHHHHHHHHHhcccCCCCEEEEcCCCCCCcchhh
Q 028600           86 PEVTKD--------MKMVPIENYGVKCMSMGFLVPSSSPVVWRGPMVMSALRKMSREVDWGNLDILVIDMPPGTGDAQLT  157 (207)
Q Consensus        86 ~~~~~~--------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~~D~IiiD~~~~~~~~~~~  157 (207)
                      .++.+.        ..+.+....++++++.+...+...+.     .....+.++++.++ +.||+||||+||.+..... 
T Consensus       146 ~gl~~~l~~~~~~~~~i~~~~~~~l~vl~~g~~~~~~~el-----l~~~~l~~ll~~l~-~~yD~VIIDtpp~~~~~da-  218 (286)
T 3la6_A          146 NGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSEL-----LMSERFAELVNWAS-KNYDLVLIDTPPILAVTDA-  218 (286)
T ss_dssp             TCHHHHHHTSSCTTTTCEECSSTTEEEECCCSCCSCHHHH-----HTSHHHHHHHHHHH-HHCSEEEEECCCTTTCTHH-
T ss_pred             CCHHHHccCCCCHHHheeccCCCCEEEEeCCCCCCCHHHH-----hchHHHHHHHHHHH-hCCCEEEEcCCCCcchHHH-
Confidence            655432        33455556789999988755433322     33578999999999 9999999999998764333 


Q ss_pred             hhhhhcCceEEEeeCCchhhHHHHHHHHHHhhhCCCCeeEEEEccccC
Q 028600          158 TTQTLQLSGALIVSTPQDVALIDARKGITMFSKVQVPVCSFLAQIISS  205 (207)
Q Consensus       158 ~~~~~~~d~vi~v~~~~~~~~~~~~~~l~~l~~~~~~~~g~v~N~~~~  205 (207)
                      ......+|.+++|+.++.++...+.+.++.+++.+.+++|+|+|+++.
T Consensus       219 ~~l~~~aD~vllVv~~~~~~~~~~~~~~~~l~~~g~~~~GvVlN~v~~  266 (286)
T 3la6_A          219 AIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFR  266 (286)
T ss_dssp             HHHTTTCSEEEEEEETTTSBHHHHHHHHHHHHHTTCCCCEEEEEEECC
T ss_pred             HHHHHHCCeEEEEEeCCCCcHHHHHHHHHHHHhCCCCEEEEEEcCccc
Confidence            334447999999999999999999999999999999999999999974



>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} Back     alignment and structure
>3qxc_A Dethiobiotin synthetase; DTBS, structural genomics, ATP BIND biology, protein structure initiative, midwest center for S genomics, MCSG; HET: ATP; 1.34A {Helicobacter pylori} PDB: 3mle_A* 3qxh_A* 3qxj_A* 3qxs_A* 3qxx_A* 3qy0_A* 2qmo_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure
>2obn_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: PG4; 2.30A {Anabaena variabilis} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2g0t_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.67A {Thermotoga maritima} SCOP: c.37.1.10 Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A Back     alignment and structure
>1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>2vo1_A CTP synthase 1; pyrimidine biosynthesis, glutamine amidotransferase, phosphorylation, amidotransferase, cytidine 5-prime triphos synthetase, UTP; 2.8A {Homo sapiens} SCOP: c.37.1.10 PDB: 3ihl_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3do6_A Formate--tetrahydrofolate ligase; TM1766, putative formyltetrahydrofolate synthetase, structural genomics; HET: MSE; 1.85A {Thermotoga maritima} SCOP: c.37.1.0 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1w78_A FOLC bifunctional protein; DHFS, dihydrofolate synthase, synthase, ATP-binding, folate biosynthesis, ligase, multifunctional enzyme; HET: KCX PD8 ADP; 1.82A {Escherichia coli} PDB: 1w7k_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1jbw_A Folylpolyglutamate synthase; FPGS folate AMPPCP ternary complex, ligase; HET: KCX ACQ TMF; 1.85A {Lactobacillus casei} SCOP: c.59.1.2 c.72.2.2 PDB: 1fgs_A* 1jbv_A* 2gca_A 2gc5_A* 2gc6_A* 2gcb_A Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1e8c_A UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diaminopimelate ligase; peptidoglycan biosynthesis; HET: KCX UAG API; 2.00A {Escherichia coli} SCOP: c.98.1.1 c.59.1.1 c.72.2.1 Back     alignment and structure
>1o5z_A Folylpolyglutamate synthase/dihydrofolate synthas; TM0166, structural genomics, JC protein structure initiative; 2.10A {Thermotoga maritima} SCOP: c.59.1.2 c.72.2.2 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3nrs_A Dihydrofolate:folylpolyglutamate synthetase; structural genomics, center for structural genomics of infec diseases, csgid; HET: TLA MES; 1.80A {Yersinia pestis} PDB: 3n2a_A* 3pyz_A* 3qcz_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2wtz_A UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-diaminopimelate ligase; nucleotide-binding, peptidoglycan synthesis, MURE, C shape; HET: KCX UAG; 3.00A {Mycobacterium tuberculosis} PDB: 2xja_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2vos_A Folylpolyglutamate synthase protein FOLC; ligase, peptidoglycan synthesis, cell division; HET: ADP; 2.0A {Mycobacterium tuberculosis} PDB: 2vor_A* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1j6u_A UDP-N-acetylmuramate-alanine ligase MURC; structural genomics, TM0231, JCSG, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA ANP; 1.70A {Haemophilus influenzae} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 PDB: 1gqq_A* 1p31_A* 1gqy_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 207
d1ihua2279 c.37.1.10 (A:308-586) Arsenite-translocating ATPas 1e-30
d1cp2a_269 c.37.1.10 (A:) Nitrogenase iron protein {Clostridi 2e-22
d1g3qa_237 c.37.1.10 (A:) Cell division regulator MinD {Archa 2e-22
d2afhe1 289 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azot 7e-21
d1hyqa_232 c.37.1.10 (A:) Cell division regulator MinD {Archa 1e-18
d1ihua1296 c.37.1.10 (A:1-296) Arsenite-translocating ATPase 9e-18
d1byia_224 c.37.1.10 (A:) Dethiobiotin synthetase {Escherichi 1e-13
d1ls1a2207 c.37.1.10 (A:89-295) GTPase domain of the signal s 6e-06
d1bifa1213 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fruct 7e-04
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Length = 279 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Arsenite-translocating ATPase ArsA
species: Escherichia coli [TaxId: 562]
 Score =  111 bits (277), Expect = 1e-30
 Identities = 31/202 (15%), Positives = 60/202 (29%), Gaps = 33/202 (16%)

Query: 26  KIDGVKDVIAVASGKGGVGKSTTAVNLAVALASKCQLKVGLLDAD-------VYGPSVPM 78
            I   +  + +  GKGGVGK+T A  +AV LA      V L  +D           S+  
Sbjct: 14  DIARNEHGLIMLMGKGGVGKTTMAAAIAVRLADM-GFDVHLTTSDPAAHLSMTLNGSLNN 72

Query: 79  MMKIDQKPEVTKDMKMVPIENYGVKCMSMGFLVPSSSPVVWRGPMVMSALRKMSREVDWG 138
           +      P    +     +     K +           +       ++  +  SR +   
Sbjct: 73  LQVSRIDPHEETERYRQHVLETKGKELDEAGKRLLEEDLRSPCTEEIAVFQAFSRVIREA 132

Query: 139 NLDILVIDMPP-------------------------GTGDAQLTTTQTLQLSGALIVSTP 173
               +V+D  P                         G     +   Q  + +  L+V+ P
Sbjct: 133 GKRFVVMDTAPTGHTLLLLDATGAYHREIAKKMGEKGHFTTPMMLLQDPERTKVLLVTLP 192

Query: 174 QDVALIDARKGITMFSKVQVPV 195
           +   +++A        +  +  
Sbjct: 193 ETTPVLEAANLQADLERAGIHP 214


>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Length = 269 Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 237 Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Length = 289 Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 232 Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Length = 296 Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Length = 224 Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Length = 207 Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 213 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query207
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 99.97
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 99.97
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 99.95
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 99.94
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 99.9
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 99.89
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 99.76
d2qy9a2211 GTPase domain of the signal recognition particle r 99.42
d1okkd2207 GTPase domain of the signal recognition particle r 99.39
d1ls1a2207 GTPase domain of the signal sequence recognition p 99.39
d1vmaa2213 GTPase domain of the signal recognition particle r 99.37
d1j8yf2211 GTPase domain of the signal sequence recognition p 99.33
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 98.9
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 98.82
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 98.58
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 98.56
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 98.44
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 98.32
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 98.28
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 98.27
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 98.23
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 97.98
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 97.91
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.87
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 97.79
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.61
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 97.5
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 97.49
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.48
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 97.45
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.45
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 97.42
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 97.33
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.33
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 97.32
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 97.31
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.31
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 97.21
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 97.2
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 97.12
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.12
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.1
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 97.01
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 96.94
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.88
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.88
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 96.88
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 96.87
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 96.8
d1s1ma2266 CTP synthase PyrG, N-terminal domain {Escherichia 96.79
d1eg7a_ 549 Formyltetrahydrofolate synthetase {Moorella thermo 96.71
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.69
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 96.69
d2g0ta1338 Hypothetical protein TM0796 {Thermotoga maritima [ 96.61
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.59
d1vcoa2272 CTP synthase PyrG, N-terminal domain {Thermus ther 96.56
d1e8ca3234 UDP-N-acetylmuramyl tripeptide synthetase MurE {Es 96.54
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 96.52
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.49
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.49
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.45
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 96.41
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 96.41
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.39
d2vo1a1273 CTP synthase PyrG, N-terminal domain {Human (Homo 96.27
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 96.22
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.12
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 96.1
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.0
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 95.98
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.98
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.86
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.84
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 95.84
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.83
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 95.82
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 95.81
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.61
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 95.35
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.31
d2gc6a2296 Folylpolyglutamate synthetase {Lactobacillus casei 95.31
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.29
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.29
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.29
d1gg4a4214 UDP-murNac-tripeptide D-alanyl-D-alanine-adding en 95.25
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.24
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.22
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.18
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.15
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 95.1
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.06
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 95.04
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.03
d1o5za2296 Folylpolyglutamate synthetase {Thermotoga maritima 95.02
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 94.95
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 94.87
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 94.77
d2jfga3204 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 94.7
d1p3da3215 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 94.58
d1j6ua3207 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 94.56
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 94.43
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 94.33
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 94.31
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 94.26
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.25
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 94.19
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.19
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 94.18
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 94.09
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 94.02
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.8
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 93.75
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 93.71
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 93.69
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 93.68
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 93.67
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 93.57
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 93.54
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 93.41
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 93.25
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 93.16
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 92.96
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 92.82
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 92.82
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 92.59
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 92.57
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 92.49
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 92.47
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 92.46
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 92.33
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 92.31
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 92.27
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 92.24
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 92.23
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 92.22
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 92.12
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 92.1
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 91.88
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 91.85
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 91.72
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 91.61
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 91.32
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 91.19
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 91.17
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 91.16
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 91.1
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 91.07
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 90.91
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 90.88
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 90.46
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 90.45
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.43
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 90.42
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 90.42
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 90.38
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 90.35
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 90.29
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 90.28
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 90.25
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 90.24
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 90.24
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 90.22
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 90.18
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 90.17
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 90.09
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 90.03
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 89.95
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 89.89
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 89.87
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 89.8
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 89.79
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 89.71
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 89.6
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 89.57
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 89.5
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 89.46
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 89.45
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 89.42
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 89.25
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 89.09
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 89.08
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 89.04
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 88.98
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 88.86
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 88.83
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 88.73
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 88.62
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 88.61
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 88.4
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 88.37
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 88.33
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 88.28
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 88.23
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 88.2
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 87.98
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 87.95
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 87.87
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 87.78
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 87.73
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 87.72
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 87.71
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 87.68
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 87.45
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 87.41
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 87.36
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 87.35
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 87.34
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 87.12
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 87.01
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 86.91
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 86.91
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 86.62
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 86.52
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 86.51
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 86.3
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 86.23
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 86.01
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 85.99
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 85.97
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 85.92
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 85.89
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 85.89
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 85.85
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 85.84
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 85.52
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 85.47
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 85.42
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 85.35
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 85.33
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 85.14
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 84.98
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 84.8
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 84.73
d2hyda1255 Putative multidrug export ATP-binding/permease pro 84.64
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 84.59
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 84.43
d1svma_362 Papillomavirus large T antigen helicase domain {Si 84.41
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 84.4
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 84.24
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 84.18
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 84.03
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 83.95
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 83.94
d1rzua_ 477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 83.89
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 83.85
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 83.84
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 83.78
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 83.7
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 83.17
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 83.04
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 83.02
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 82.97
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 82.74
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 82.58
d2awna2232 Maltose transport protein MalK, N-terminal domain 82.47
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 82.37
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 82.35
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 82.32
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 82.28
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 82.23
d1g2912240 Maltose transport protein MalK, N-terminal domain 82.2
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 82.17
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 82.15
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 82.1
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 82.06
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 82.06
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 82.04
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 81.67
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 81.52
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 81.47
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 81.43
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 81.36
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 81.32
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 81.25
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 81.23
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 81.21
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 81.05
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 80.99
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 80.57
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 80.54
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 80.54
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 80.51
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 80.46
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 80.4
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 80.39
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 80.33
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 80.21
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 80.15
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 80.12
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 80.11
d1jala1 278 YchF GTP-binding protein N-terminal domain {Haemop 80.1
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Cell division regulator MinD
species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]
Probab=99.97  E-value=6e-31  Score=199.35  Aligned_cols=165  Identities=24%  Similarity=0.320  Sum_probs=133.7

Q ss_pred             CeEEEEEeCCCCCcHHHHHHHHHHHHHHhCCCeEEEEecCCCCCCccccccccCCccccc--------cccceecccccc
Q 028600           31 KDVIAVASGKGGVGKSTTAVNLAVALASKCQLKVGLLDADVYGPSVPMMMKIDQKPEVTK--------DMKMVPIENYGV  102 (207)
Q Consensus        31 ~k~I~v~s~kgG~GkTt~a~~LA~~la~~~g~~VlliD~d~~~~~l~~~~~~~~~~~~~~--------~~~~~~~~~~~~  102 (207)
                      ||+|+|+|+|||+||||+|+|||.+||+ .|+||++||+|++.++++.+++.+.......        ..........++
T Consensus         1 ~kvIav~s~KGGvGKTtia~nlA~~la~-~g~~VlliD~D~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   79 (232)
T d1hyqa_           1 VRTITVASGKGGTGKTTITANLGVALAQ-LGHDVTIVDADITMANLELILGMEGLPVTLQNVLAGEARIDEAIYVGPGGV   79 (232)
T ss_dssp             CEEEEEEESSSCSCHHHHHHHHHHHHHH-TTCCEEEEECCCSSSSHHHHTTCCCCCCCHHHHHTTSSCGGGGCEECGGGC
T ss_pred             CEEEEEECCCCCChHHHHHHHHHHHHHh-CCCCEEEEeCCCCCCCHHHHhCCCcCcchhhhhhccccccccccccCCccc
Confidence            6999999999999999999999999999 9999999999999999999998765432211        123333445566


Q ss_pred             eeecccccCCCCCcccccchhhHHHHHHHHHhcccCCCCEEEEcCCCCCCcchhhhhhhhcCceEEEeeCCchhhHHHHH
Q 028600          103 KCMSMGFLVPSSSPVVWRGPMVMSALRKMSREVDWGNLDILVIDMPPGTGDAQLTTTQTLQLSGALIVSTPQDVALIDAR  182 (207)
Q Consensus       103 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~~D~IiiD~~~~~~~~~~~~~~~~~~d~vi~v~~~~~~~~~~~~  182 (207)
                      .+++.+...      ..........+..+++.++ +.||+||+|+|++++.  .....+..+|.+++|+.++..++..+.
T Consensus        80 ~~l~~~~~~------~~~~~~~~~~l~~~l~~l~-~~~D~viiD~~~~~~~--~~~~~l~~ad~v~~v~~~~~~~~~~~~  150 (232)
T d1hyqa_          80 KVVPAGVSL------EGLRKANPEKLEDVLTQIM-ESTDILLLDAPAGLER--SAVIAIAAAQELLLVVNPEISSITDGL  150 (232)
T ss_dssp             EEEECCSCH------HHHHHHCHHHHHHHHHHHH-HTCSEEEEECCSSSSH--HHHHHHHHSSEEEEEECSSHHHHHHHH
T ss_pred             eeEeeeccc------ccccccchhhHHHHHHHHh-hccceeeecccccccc--hhHHHhhhhheeeeeccccccchhhhh
Confidence            666655321      1112234678889999998 9999999999998874  445666689999999999999999999


Q ss_pred             HHHHHhhhCCCCeeEEEEccccC
Q 028600          183 KGITMFSKVQVPVCSFLAQIISS  205 (207)
Q Consensus       183 ~~l~~l~~~~~~~~g~v~N~~~~  205 (207)
                      +.+..+++.+.+++++|+|++++
T Consensus       151 ~~~~~~~~~~~~~~~iv~N~~~~  173 (232)
T d1hyqa_         151 KTKIVAERLGTKVLGVVVNRITT  173 (232)
T ss_dssp             HHHHHHHHHTCEEEEEEEEEECT
T ss_pred             hhhhhhhhccccccccccccccc
Confidence            99999999999999999999864



>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1s1ma2 c.37.1.10 (A:1-266) CTP synthase PyrG, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eg7a_ c.37.1.10 (A:) Formyltetrahydrofolate synthetase {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g0ta1 c.37.1.10 (A:1-338) Hypothetical protein TM0796 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1vcoa2 c.37.1.10 (A:11-282) CTP synthase PyrG, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e8ca3 c.72.2.1 (A:104-337) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vo1a1 c.37.1.10 (A:1-273) CTP synthase PyrG, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2gc6a2 c.72.2.2 (A:1-296) Folylpolyglutamate synthetase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1gg4a4 c.72.2.1 (A:99-312) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2jfga3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3da3 c.72.2.1 (A:107-321) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1j6ua3 c.72.2.1 (A:89-295) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure