Citrus Sinensis ID: 028605

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200------
MVQCLDGLKHFCVVVVNCCDADLYKQPRGLEDPEALARETVFSVSEIEALYELFKKISSAVIDDGLINKVFDLFDTKHNGILDFEEFARALSIFHPNSPIDDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLSDDVIESIIDKTFEEADTKHDGKIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT
cccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHccccHHHHHHHHHHHHcccccccccHHHHHHHHcccccccccEEHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcHHHHHHccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHccccccccccccccccHHHHHHcccccHHHHHHHHHHHHHHcHHHccccHHHHHHHHHccccccEEEHHHHHHHHHcccccccHHHHHHHHHHHEcccccccEcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccHHHHHHcccHHHHHHHcccccEEEEcccccc
MVQCLDGLKHFCVVVVNccdadlykqprgledpealarETVFSVSEIEALYELFKKISSaviddglinKVFDlfdtkhngilDFEEFARALsifhpnspiddkieFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLSDDVIESIIDKtfeeadtkhdgkidkeEWRNLVLRHPSLLKNMTLQYLKDItttfpsfvfhsqvddt
MVQCLDGLKHFCVVVVNCCDADLYKQPRGLEDPEALARETVFSVSEIEALYELFKKISSAVIDDGLINKVFDLFDTKHNGILDFEEFARALSIFHPNSPIDDKIEFSFQLYDLKQQGFIERQEVKQMVVATLtesgmnlsdDVIESIIDKTfeeadtkhdgkidkeewrNLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT
MVQCLDGLKHFCVVVVNCCDADLYKQPRGLEDPEALARETVFSVSEIEALYELFKKISSAVIDDGLINKVFDLFDTKHNGILDFEEFARALSIFHPNSPIDDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLSDDVIESIIDKTFEEADTKHDGKIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT
**QCLDGLKHFCVVVVNCCDADLYKQPRGLEDPEALARETVFSVSEIEALYELFKKISSAVIDDGLINKVFDLFDTKHNGILDFEEFARALSIFHPNSPIDDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLSDDVIESIIDKTFEEA****DGKIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVFH******
*******LKHFCVVVVNCC***************ALARETVFSVSEIEALYELFKKISSAVIDDGLINKVFDLFDTKHNGILDFEEFARALSIFHPNSPIDDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGM*LSDDVIESIIDKTFEEADTKHDGKIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPS***H******
MVQCLDGLKHFCVVVVNCCDADLYKQPRGLEDPEALARETVFSVSEIEALYELFKKISSAVIDDGLINKVFDLFDTKHNGILDFEEFARALSIFHPNSPIDDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLSDDVIESIIDKTFEEADTKHDGKIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT
*VQCLDGLKHFCVVVVNCCDADLYKQPRGLEDPEALARETVFSVSEIEALYELFKKISSAVIDDGLINKVFDLFDTKHNGILDFEEFARALSIFHPNSPIDDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLSDDVIESIIDKTFEEADTKHDGKIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQ****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVQCLDGLKHFCVVVVNCCDADLYKQPRGLEDPEALARETVFSVSEIEALYELFKKISSAVIDDGLINKVFDLFDTKHNGILDFEEFARALSIFHPNSPIDDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLSDDVIESIIDKTFEEADTKHDGKIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query206 2.2.26 [Sep-21-2011]
Q75LU8225 Calcineurin B-like protei yes no 0.995 0.911 0.814 1e-102
Q3HRP5225 Calcineurin B-like protei no no 0.995 0.911 0.792 1e-100
Q8LAS7226 Calcineurin B-like protei yes no 1.0 0.911 0.800 1e-99
Q8LEM7226 Calcineurin B-like protei no no 1.0 0.911 0.792 4e-99
Q3HRP1226 Calcineurin B-like protei no no 1.0 0.911 0.730 2e-92
Q9C5P6226 Calcineurin B-like protei no no 0.966 0.880 0.654 8e-79
Q7XC27213 Calcineurin B-like protei no no 0.907 0.877 0.591 3e-65
O81445213 Calcineurin B-like protei no no 0.922 0.892 0.561 2e-62
Q9LTB8213 Calcineurin B-like protei no no 0.849 0.821 0.584 1e-60
Q9SUA6214 Calcineurin B-like protei no no 0.669 0.644 0.782 2e-60
>sp|Q75LU8|CNBL3_ORYSJ Calcineurin B-like protein 3 OS=Oryza sativa subsp. japonica GN=CBL3 PE=1 SV=1 Back     alignment and function desciption
 Score =  370 bits (950), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/226 (81%), Positives = 197/226 (87%), Gaps = 21/226 (9%)

Query: 1   MVQCLDGLKHFCVVVVNCCDADLYKQPRGLEDPEALARETVFSVSEIEALYELFKKISSA 60
           M+QCL+G+K  C V++ CCD DL KQP+GLEDPE LARETVFSVSE+EALYELFKKISSA
Sbjct: 1   MLQCLEGVKQLCGVLLKCCDLDL-KQPKGLEDPEILARETVFSVSEVEALYELFKKISSA 59

Query: 61  VIDDGLINK--------------------VFDLFDTKHNGILDFEEFARALSIFHPNSPI 100
           VIDDGLINK                    VFDLFDTKHNGIL FEEFARALS+FHPN+P+
Sbjct: 60  VIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPL 119

Query: 101 DDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLSDDVIESIIDKTFEEADTKHD 160
           D+KI+FSFQLYDLKQQGFIERQEVKQMVVATL ESGMNLSD+VIESIIDKTFEEADTKHD
Sbjct: 120 DEKIDFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLSDEVIESIIDKTFEEADTKHD 179

Query: 161 GKIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 206
           GKIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT
Sbjct: 180 GKIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 225
Acts as a calcium sensor. CBL proteins interact with CIPK serine-threonine protein kinases. Binding of a CBL protein to the regulatory NAF domain of a CIPK protein lead to the activation of the kinase in a calcium-dependent manner.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q3HRP5|CNBL2_ORYSJ Calcineurin B-like protein 2 OS=Oryza sativa subsp. japonica GN=CBL2 PE=2 SV=1 Back     alignment and function description
>sp|Q8LAS7|CNBL2_ARATH Calcineurin B-like protein 2 OS=Arabidopsis thaliana GN=CBL2 PE=1 SV=2 Back     alignment and function description
>sp|Q8LEM7|CNBL3_ARATH Calcineurin B-like protein 3 OS=Arabidopsis thaliana GN=CBL3 PE=1 SV=2 Back     alignment and function description
>sp|Q3HRP1|CNBL6_ORYSJ Calcineurin B-like protein 6 OS=Oryza sativa subsp. japonica GN=CBL6 PE=2 SV=1 Back     alignment and function description
>sp|Q9C5P6|CNBL6_ARATH Calcineurin B-like protein 6 OS=Arabidopsis thaliana GN=CBL6 PE=2 SV=2 Back     alignment and function description
>sp|Q7XC27|CNBL1_ORYSJ Calcineurin B-like protein 1 OS=Oryza sativa subsp. japonica GN=CBL1 PE=2 SV=2 Back     alignment and function description
>sp|O81445|CNBL1_ARATH Calcineurin B-like protein 1 OS=Arabidopsis thaliana GN=CBL1 PE=1 SV=3 Back     alignment and function description
>sp|Q9LTB8|CNBL9_ARATH Calcineurin B-like protein 9 OS=Arabidopsis thaliana GN=CBL9 PE=1 SV=3 Back     alignment and function description
>sp|Q9SUA6|CNBL7_ARATH Calcineurin B-like protein 7 OS=Arabidopsis thaliana GN=CBL7 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query206
147770306226 hypothetical protein VITISV_029390 [Viti 1.0 0.911 0.858 1e-108
449491221226 PREDICTED: LOW QUALITY PROTEIN: calcineu 1.0 0.911 0.853 1e-107
449434060226 PREDICTED: calcineurin B-like protein 3- 1.0 0.911 0.853 1e-107
166788449226 calcineurin B-like protein [Phaseolus vu 1.0 0.911 0.858 1e-107
356522091226 PREDICTED: calcineurin B-like protein 3- 1.0 0.911 0.849 1e-106
363807678226 uncharacterized protein LOC100791045 [Gl 1.0 0.911 0.853 1e-106
224089529226 predicted protein [Populus trichocarpa] 1.0 0.911 0.845 1e-105
255568116224 calcineurin B, putative [Ricinus communi 0.990 0.910 0.853 1e-105
115531880226 calcineurin B-like protein 3 [Populus eu 1.0 0.911 0.840 1e-105
358347114227 Calcineurin B-like protein [Medicago tru 1.0 0.907 0.823 1e-103
>gi|147770306|emb|CAN62487.1| hypothetical protein VITISV_029390 [Vitis vinifera] gi|229609883|gb|ACQ83557.1| calcineurin B-like protein 03 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 194/226 (85%), Positives = 203/226 (89%), Gaps = 20/226 (8%)

Query: 1   MVQCLDGLKHFCVVVVNCCDADLYKQPRGLEDPEALARETVFSVSEIEALYELFKKISSA 60
           M+QCL+G+KH C VVVNCCDADLYKQP+GLEDPEALARETVFSVSEIEALYELFKKISSA
Sbjct: 1   MLQCLEGVKHLCAVVVNCCDADLYKQPKGLEDPEALARETVFSVSEIEALYELFKKISSA 60

Query: 61  VIDDGLINK--------------------VFDLFDTKHNGILDFEEFARALSIFHPNSPI 100
           VIDDGLINK                    VFDLFDTKHNGILDFEEFARALS+FHPN+PI
Sbjct: 61  VIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILDFEEFARALSVFHPNAPI 120

Query: 101 DDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLSDDVIESIIDKTFEEADTKHD 160
           +DKI+FSFQLYDLKQQGFIERQEVKQMVVATL ESGMNLSDDVIESIIDKTFEEADTKHD
Sbjct: 121 EDKIDFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLSDDVIESIIDKTFEEADTKHD 180

Query: 161 GKIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 206
           GKIDKEEWR+LVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT
Sbjct: 181 GKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 226

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449491221|ref|XP_004158833.1| PREDICTED: LOW QUALITY PROTEIN: calcineurin B-like protein 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449434060|ref|XP_004134814.1| PREDICTED: calcineurin B-like protein 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|166788449|dbj|BAG06680.1| calcineurin B-like protein [Phaseolus vulgaris] Back     alignment and taxonomy information
>gi|356522091|ref|XP_003529683.1| PREDICTED: calcineurin B-like protein 3-like [Glycine max] Back     alignment and taxonomy information
>gi|363807678|ref|NP_001241908.1| uncharacterized protein LOC100791045 [Glycine max] gi|255641958|gb|ACU21246.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224089529|ref|XP_002308747.1| predicted protein [Populus trichocarpa] gi|133925833|gb|ABO43669.1| calcineurin B-like protein 3 [Populus trichocarpa] gi|222854723|gb|EEE92270.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255568116|ref|XP_002525034.1| calcineurin B, putative [Ricinus communis] gi|223535696|gb|EEF37361.1| calcineurin B, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|115531880|gb|ABJ09706.1| calcineurin B-like protein 3 [Populus euphratica] Back     alignment and taxonomy information
>gi|358347114|ref|XP_003637607.1| Calcineurin B-like protein [Medicago truncatula] gi|355503542|gb|AES84745.1| Calcineurin B-like protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query206
UNIPROTKB|Q8L7F6225 CnB "Calcineurin B-like protei 0.674 0.617 0.956 3.8e-95
TAIR|locus:2161760226 CBL2 "AT5G55990" [Arabidopsis 0.674 0.615 0.913 1e-92
TAIR|locus:2130499226 CBL6 "calcineurin B-like prote 0.985 0.898 0.662 2.3e-71
TAIR|locus:2129306213 CBL1 "calcineurin B-like prote 0.669 0.647 0.615 2e-61
TAIR|locus:2152012213 CBL9 "calcineurin B-like prote 0.669 0.647 0.615 7.8e-60
TAIR|locus:2123767256 CBL10 "AT4G33000" [Arabidopsis 0.674 0.542 0.611 4.2e-57
TAIR|locus:2133857214 CBL7 "calcineurin B-like prote 0.669 0.644 0.782 1.6e-56
TAIR|locus:2169794222 SOS3 "SALT OVERLY SENSITIVE 3" 0.635 0.590 0.580 1.3e-55
TAIR|locus:2125162203 CBL5 "calcineurin B-like prote 0.631 0.640 0.530 1.2e-41
TAIR|locus:2019439214 CBL8 "calcineurin B-like prote 0.752 0.724 0.5 3e-37
UNIPROTKB|Q8L7F6 CnB "Calcineurin B-like protein" [Pisum sativum (taxid:3888)] Back     alignment and assigned GO terms
 Score = 697 (250.4 bits), Expect = 3.8e-95, Sum P(2) = 3.8e-95
 Identities = 133/139 (95%), Positives = 137/139 (98%)

Query:    68 NKVFDLFDTKHNGILDFEEFARALSIFHPNSPIDDKIEFSFQLYDLKQQGFIERQEVKQM 127
             ++VFDLFDTKHNGIL FEEFARALS+FHPN+PIDDKIEFSFQLYDLKQQGFIERQEVKQM
Sbjct:    87 DRVFDLFDTKHNGILGFEEFARALSVFHPNAPIDDKIEFSFQLYDLKQQGFIERQEVKQM 146

Query:   128 VVATLTESGMNLSDDVIESIIDKTFEEADTKHDGKIDKEEWRNLVLRHPSLLKNMTLQYL 187
             VVATL ESGMNLSDDVIESIIDKTFEEADTKHDGKIDKEEWRNLVLRHPSLLKNMTLQYL
Sbjct:   147 VVATLAESGMNLSDDVIESIIDKTFEEADTKHDGKIDKEEWRNLVLRHPSLLKNMTLQYL 206

Query:   188 KDITTTFPSFVFHSQVDDT 206
             KDITTTFPSFVFHSQVDDT
Sbjct:   207 KDITTTFPSFVFHSQVDDT 225
GO:0005515 "protein binding" evidence=IPI
TAIR|locus:2161760 CBL2 "AT5G55990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130499 CBL6 "calcineurin B-like protein 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129306 CBL1 "calcineurin B-like protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152012 CBL9 "calcineurin B-like protein 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2123767 CBL10 "AT4G33000" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133857 CBL7 "calcineurin B-like protein 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169794 SOS3 "SALT OVERLY SENSITIVE 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125162 CBL5 "calcineurin B-like protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019439 CBL8 "calcineurin B-like protein 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8LEM7CNBL3_ARATHNo assigned EC number0.79201.00.9115nono
Q75LU8CNBL3_ORYSJNo assigned EC number0.81410.99510.9111yesno
Q8LAS7CNBL2_ARATHNo assigned EC number0.80081.00.9115yesno
Q3HRP5CNBL2_ORYSJNo assigned EC number0.79200.99510.9111nono
Q3HRP1CNBL6_ORYSJNo assigned EC number0.73001.00.9115nono

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
CBL3
SubName- Full=Calcineurin B-like protein 3; (227 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 7e-13
PTZ00184149 PTZ00184, PTZ00184, calmodulin; Provisional 9e-07
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 1e-06
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 2e-05
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 3e-04
pfam1320225 pfam13202, EF_hand_3, EF hand 3e-04
pfam1383353 pfam13833, EF_hand_6, EF-hand domain pair 0.001
PTZ00183158 PTZ00183, PTZ00183, centrin; Provisional 0.001
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information 
 Score = 63.5 bits (155), Expect = 7e-13
 Identities = 41/158 (25%), Positives = 74/158 (46%), Gaps = 28/158 (17%)

Query: 40  TVFSVSEIEALYELFKKI---SSAVID----------------DGLINKVFDLFDTKHNG 80
           T  +  +I+ L E F+     S  +ID                +  INK+F+  D   N 
Sbjct: 12  TQLTEEQIQELKEAFQLFDRDSDGLIDRNELGKILRSLGFNPSEAEINKLFEEIDAG-NE 70

Query: 81  ILDFEEFARALSIFHPNSPIDDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLS 140
            +DF EF   +S+       ++++  +F+L+D    G+I   E++++    L   G  LS
Sbjct: 71  TVDFPEFLTVMSVKLKRGDKEEELREAFKLFDKDHDGYISIGELRRV----LKSLGERLS 126

Query: 141 DDVIESIIDKTFEEADTKHDGKIDKEEWRNLVLRHPSL 178
           D+     ++K  +E D   DG+ID EE++ L+   P++
Sbjct: 127 DE----EVEKLLKEYDEDGDGEIDYEEFKKLIKDSPTI 160

Length = 160
>gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|205383 pfam13202, EF_hand_3, EF hand Back     alignment and domain information
>gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|185503 PTZ00183, PTZ00183, centrin; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 206
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 99.93
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 99.91
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.88
KOG0038189 consensus Ca2+-binding kinase interacting protein 99.82
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 99.78
PTZ00183158 centrin; Provisional 99.75
PTZ00184149 calmodulin; Provisional 99.71
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 99.67
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 99.53
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 99.48
KOG0036 463 consensus Predicted mitochondrial carrier protein 99.41
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 99.39
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 99.39
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 99.33
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.24
PTZ00184149 calmodulin; Provisional 99.18
PTZ00183158 centrin; Provisional 99.16
PLN02964 644 phosphatidylserine decarboxylase 99.15
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 99.12
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 99.1
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 99.01
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 99.0
PLN02964 644 phosphatidylserine decarboxylase 98.97
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.95
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.94
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 98.93
KOG0377631 consensus Protein serine/threonine phosphatase RDG 98.91
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.9
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.89
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.87
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.83
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 98.82
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.8
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.76
cd0005267 EH Eps15 homology domain; found in proteins implic 98.75
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.71
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.69
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.68
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 98.62
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 98.58
KOG4666412 consensus Predicted phosphate acyltransferase, con 98.55
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 98.52
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.5
KOG0036 463 consensus Predicted mitochondrial carrier protein 98.45
KOG2562493 consensus Protein phosphatase 2 regulatory subunit 98.44
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.43
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 98.41
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.4
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 98.4
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.39
PF1465866 EF-hand_9: EF-hand domain 98.38
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.37
cd0005267 EH Eps15 homology domain; found in proteins implic 98.36
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.34
KOG2643 489 consensus Ca2+ binding protein, contains EF-hand m 98.32
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.3
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.27
KOG00402399 consensus Ca2+-binding actin-bundling protein (spe 98.25
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.23
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.22
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.2
KOG4251362 consensus Calcium binding protein [General functio 98.16
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.14
KOG2643489 consensus Ca2+ binding protein, contains EF-hand m 98.14
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 98.14
KOG0751 694 consensus Mitochondrial aspartate/glutamate carrie 98.12
PRK12309391 transaldolase/EF-hand domain-containing protein; P 98.07
KOG0041244 consensus Predicted Ca2+-binding protein, EF-Hand 98.04
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.02
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.01
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.98
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.92
KOG4065144 consensus Uncharacterized conserved protein [Funct 97.9
PF1465866 EF-hand_9: EF-hand domain 97.9
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.82
PRK12309391 transaldolase/EF-hand domain-containing protein; P 97.79
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 97.71
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.63
KOG0377631 consensus Protein serine/threonine phosphatase RDG 97.6
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 97.51
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 97.45
KOG0041244 consensus Predicted Ca2+-binding protein, EF-Hand 97.43
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.29
KOG00402399 consensus Ca2+-binding actin-bundling protein (spe 97.14
KOG0751 694 consensus Mitochondrial aspartate/glutamate carrie 97.06
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.01
KOG4251362 consensus Calcium binding protein [General functio 96.98
PF0906990 EF-hand_3: EF-hand; InterPro: IPR015154 Like other 96.76
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 96.75
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 96.69
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 96.44
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 96.41
KOG0038189 consensus Ca2+-binding kinase interacting protein 96.3
KOG0046 627 consensus Ca2+-binding actin-bundling protein (fim 96.12
KOG3555434 consensus Ca2+-binding proteoglycan Testican [Gene 96.11
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 95.94
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 95.8
KOG4347671 consensus GTPase-activating protein VRP [General f 95.78
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 94.95
KOG0039 646 consensus Ferric reductase, NADH/NADPH oxidase and 94.88
KOG0046 627 consensus Ca2+-binding actin-bundling protein (fim 94.68
KOG0169 746 consensus Phosphoinositide-specific phospholipase 94.6
KOG4578421 consensus Uncharacterized conserved protein, conta 94.54
KOG0169 746 consensus Phosphoinositide-specific phospholipase 94.17
PLN02952 599 phosphoinositide phospholipase C 94.11
KOG2562 493 consensus Protein phosphatase 2 regulatory subunit 93.87
KOG0035890 consensus Ca2+-binding actin-bundling protein (act 93.42
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 92.0
KOG4286 966 consensus Dystrophin-like protein [Cell motility; 91.01
KOG4578421 consensus Uncharacterized conserved protein, conta 89.76
KOG3866442 consensus DNA-binding protein of the nucleobindin 89.73
KOG4347671 consensus GTPase-activating protein VRP [General f 89.35
KOG4666412 consensus Predicted phosphate acyltransferase, con 88.44
KOG1955 737 consensus Ral-GTPase effector RALBP1 [Intracellula 87.95
PF05042174 Caleosin: Caleosin related protein; InterPro: IPR0 87.28
KOG4301 434 consensus Beta-dystrobrevin [Cytoskeleton] 87.01
KOG1955 737 consensus Ral-GTPase effector RALBP1 [Intracellula 86.11
KOG4065144 consensus Uncharacterized conserved protein [Funct 85.87
PF14513138 DAG_kinase_N: Diacylglycerol kinase N-terminus; PD 85.66
KOG0998 847 consensus Synaptic vesicle protein EHS-1 and relat 83.55
PF05042174 Caleosin: Caleosin related protein; InterPro: IPR0 82.81
KOG3866442 consensus DNA-binding protein of the nucleobindin 82.8
KOG2243 5019 consensus Ca2+ release channel (ryanodine receptor 82.57
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information 
Probab=99.93  E-value=1.4e-24  Score=164.92  Aligned_cols=164  Identities=46%  Similarity=0.717  Sum_probs=144.2

Q ss_pred             hccccCCCCCCCCCCCcHHHHHhhcC----CCHHHHHHHHHHHHhhccCCcCccHHHH-----------------HHhHH
Q 028605           16 VNCCDADLYKQPRGLEDPEALARETV----FSVSEIEALYELFKKISSAVIDDGLINK-----------------VFDLF   74 (206)
Q Consensus        16 m~~~~s~~~~~~~~~~~~~~l~~~~~----~s~~e~~~l~~~F~~~d~~~~~~g~i~~-----------------lf~~~   74 (206)
                      |||..|....    .+.++.+...+.    +|..|+.+++.+|.+++.+. +.|++++                 ++..+
T Consensus         1 Mg~~~s~~~~----~~~~~~~~~~~~~~~~fs~~EI~~L~~rF~kl~~~~-~~g~lt~eef~~i~~~~~Np~~~rI~~~f   75 (187)
T KOG0034|consen    1 MGNLSSTLLS----DEDLEELQMYTGDPTQFSANEIERLYERFKKLDRNN-GDGYLTKEEFLSIPELALNPLADRIIDRF   75 (187)
T ss_pred             CCcccccccc----hhhhHHHHhccCCCcccCHHHHHHHHHHHHHhcccc-ccCccCHHHHHHHHHHhcCcHHHHHHHHH
Confidence            7888887533    367888888888    99999999999999999873 4566554                 99999


Q ss_pred             cCCCCCc-ccHHHHHHHHHhhCCCCChHHHHHHHHhhhCCCCCCcccHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHH
Q 028605           75 DTKHNGI-LDFEEFARALSIFHPNSPIDDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLSDDVIESIIDKTFE  153 (206)
Q Consensus        75 d~~~~g~-i~f~ef~~~~~~~~~~~~~~~~~~~~F~~~D~~~~g~It~~Ef~~~l~~~~~~~~~~~~~~~~~~~~~~~f~  153 (206)
                      +.+++|. |+|++|+..++.+.......++++.+|++||.+++|.|+++|+..++..++...... +++.++.++..+|.
T Consensus        76 ~~~~~~~~v~F~~Fv~~ls~f~~~~~~~~Kl~faF~vYD~~~~G~I~reel~~iv~~~~~~~~~~-~~e~~~~i~d~t~~  154 (187)
T KOG0034|consen   76 DTDGNGDPVDFEEFVRLLSVFSPKASKREKLRFAFRVYDLDGDGFISREELKQILRMMVGENDDM-SDEQLEDIVDKTFE  154 (187)
T ss_pred             hccCCCCccCHHHHHHHHhhhcCCccHHHHHHHHHHHhcCCCCCcCcHHHHHHHHHHHHccCCcc-hHHHHHHHHHHHHH
Confidence            9998888 999999999999999777778999999999999999999999999998875543333 69999999999999


Q ss_pred             HhCCCCCCcccHHHHHHHHhhChhHHhhhhhh
Q 028605          154 EADTKHDGKIDKEEWRNLVLRHPSLLKNMTLQ  185 (206)
Q Consensus       154 ~~d~d~~g~Is~~eF~~~l~~~~~~~~~~~~~  185 (206)
                      ++|.|+||.|+++||+.++.+.|.+.+.|+.+
T Consensus       155 e~D~d~DG~IsfeEf~~~v~~~P~~~~~m~~~  186 (187)
T KOG0034|consen  155 EADTDGDGKISFEEFCKVVEKQPDLLEKMTIR  186 (187)
T ss_pred             HhCCCCCCcCcHHHHHHHHHcCccHHHHcCCC
Confidence            99999999999999999999999999999865

>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG4065 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>PF09069 EF-hand_3: EF-hand; InterPro: IPR015154 Like other EF hand domains, this domain forms a helix-loop-helix motif, though since it does not contain the canonical pattern of calcium binding residues found in many EF hand domains, it does not bind calcium ions Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only] Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>KOG4347 consensus GTPase-activating protein VRP [General function prediction only] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0039 consensus Ferric reductase, NADH/NADPH oxidase and related proteins [Inorganic ion transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>KOG4578 consensus Uncharacterized conserved protein, contains KAZAL and TY domains [General function prediction only] Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] Back     alignment and domain information
>KOG0035 consensus Ca2+-binding actin-bundling protein (actinin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>KOG4286 consensus Dystrophin-like protein [Cell motility; Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4578 consensus Uncharacterized conserved protein, contains KAZAL and TY domains [General function prediction only] Back     alignment and domain information
>KOG3866 consensus DNA-binding protein of the nucleobindin family [General function prediction only] Back     alignment and domain information
>KOG4347 consensus GTPase-activating protein VRP [General function prediction only] Back     alignment and domain information
>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] Back     alignment and domain information
>KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin Back     alignment and domain information
>KOG4301 consensus Beta-dystrobrevin [Cytoskeleton] Back     alignment and domain information
>KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4065 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14513 DAG_kinase_N: Diacylglycerol kinase N-terminus; PDB: 1TUZ_A Back     alignment and domain information
>KOG0998 consensus Synaptic vesicle protein EHS-1 and related EH domain proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin Back     alignment and domain information
>KOG3866 consensus DNA-binding protein of the nucleobindin family [General function prediction only] Back     alignment and domain information
>KOG2243 consensus Ca2+ release channel (ryanodine receptor) [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
2zfd_A226 The Crystal Structure Of Plant Specific Calcium Bin 1e-100
1uhn_A189 The Crystal Structure Of The Calcium Binding Protei 1e-85
1v1f_A222 Structure Of The Arabidopsis Thaliana Sos3 Complexe 7e-58
2ehb_A207 The Structure Of The C-Terminal Domain Of The Prote 7e-58
1mf8_B170 Crystal Structure Of Human Calcineurin Complexed Wi 3e-13
1tco_B169 Ternary Complex Of A Calcineurin A Fragment, Calcin 3e-13
2p6b_B156 Crystal Structure Of Human Calcineurin In Complex W 3e-13
3ll8_B155 Crystal Structure Of Calcineurin In Complex With Ak 3e-13
1g8i_A190 Crystal Structure Of Human Frequenin (Neuronal Calc 8e-12
2l2e_A190 Solution Nmr Structure Of Myristoylated Ncs1p In Ap 8e-11
1bjf_A193 Crystal Structure Of Recombinant Bovine Neurocalcin 1e-10
3dd4_A229 Structural Basis Of Kchip4a Modulation Of Kv4.3 Slo 3e-10
1s1e_A224 Crystal Structure Of Kv Channel-Interacting Protein 3e-10
1s6c_A183 Crystal Structure Of The Complex Between Kchip1 And 6e-10
2i2r_E180 Crystal Structure Of The Kchip1KV4.3 T1 COMPLEX Len 2e-09
2nz0_A180 Crystal Structure Of Potassium Channel Kv4.3 In Com 4e-09
2ct9_A208 The Crystal Structure Of Calcineurin B Homologous P 6e-09
2e30_A195 Solution Structure Of The Cytoplasmic Region Of Na+ 1e-08
1fpw_A190 Structure Of Yeast Frequenin Length = 190 2e-08
2jul_A256 Nmr Structure Of Dream Length = 256 3e-08
2bec_A202 Crystal Structure Of Chp2 In Complex With Its Bindi 5e-08
2l4h_A214 The Solution Structure Of Calcium Bound Cib1 Length 3e-07
1dgu_A183 Homology-Based Model Of Calcium-Saturated Cib (Calc 4e-07
2ggz_A211 Crystal Structure Of Human Guanylate Cyclase Activa 5e-07
2r2i_A198 Myristoylated Guanylate Cyclase Activating Protein- 1e-06
4aqr_A149 Crystal Structure Of A Calmodulin In Complex With T 9e-06
1rfj_A149 Crystal Structure Of Potato Calmodulin Pcm6 Length 3e-05
1vrk_A148 The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 3e-05
3ekh_A449 Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER 3e-05
1ooj_A149 Structural Genomics Of Caenorhabditis Elegans : Cal 7e-05
2lv6_A148 The Complex Between Ca-calmodulin And Skeletal Musc 7e-05
2bkh_B149 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 8e-05
2bbm_A148 Solution Structure Of A Calmodulin-Target Peptide C 8e-05
1qs7_A145 The 1.8 Angstrom Structure Of Calmodulin Rs20 Pepti 8e-05
1qtx_A148 The 1.65 Angstrom Structure Of Calmodulin Rs20 Pept 9e-05
2het_A189 Non-Myristoylated Bovine Recoverin (Truncated At C- 1e-04
2i94_A202 Nmr Structure Of Recoverin Bound To Rhodopsin Kinas 1e-04
1omr_A201 Non-Myristoylated Wild-Type Bovine Recoverin With C 1e-04
2l1w_A149 The Solution Structure Of Soybean Calmodulin Isofor 1e-04
1jsa_A201 Myristoylated Recoverin With Two Calciums Bound, Nm 1e-04
3sg6_A450 Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) L 1e-04
3evu_A449 Crystal Structure Of Calcium Bound Dimeric Gcamp2, 1e-04
3ek8_A449 Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER L 1e-04
3evr_A411 Crystal Structure Of Calcium Bound Monomeric Gcamp2 1e-04
1cdm_A144 Modulation Of Calmodulin Plasticity In Molecular Re 1e-04
1xfu_O149 Crystal Structure Of Anthrax Edema Factor (ef) Trun 1e-04
3o78_A415 The Structure Of Ca2+ Sensor (Case-12) Length = 415 1e-04
3o77_A415 The Structure Of Ca2+ Sensor (Case-16) Length = 415 1e-04
2ygg_B150 Complex Of Cambr And Cam Length = 150 1e-04
1prw_A149 Crystal Structure Of Bovine Brain Ca++ Calmodulin I 2e-04
1up5_B148 Chicken Calmodulin Length = 148 2e-04
1y0v_H146 Crystal Structure Of Anthrax Edema Factor (Ef) In C 2e-04
5pal_A109 Crystal Structure Of The Unique Parvalbumin Compone 2e-04
1cdl_A147 Target Enzyme Recognition By Calmodulin: 2.4 Angstr 2e-04
2wel_D150 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 2e-04
2be6_A150 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaC 2e-04
4djc_A152 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCA 2e-04
3ewt_A154 Crystal Structure Of Calmodulin Complexed With A Pe 2e-04
2f2o_A179 Structure Of Calmodulin Bound To A Calcineurin Pept 2e-04
1cm1_A148 Motions Of Calmodulin-Single-Conformer Refinement L 2e-04
4gow_D144 Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX 2e-04
1k93_D144 Crystal Structure Of The Adenylyl Cyclase Domain Of 2e-04
1iq5_A149 CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE 2e-04
2vay_A146 Calmodulin Complexed With Cav1.1 Iq Peptide Length 2e-04
2ix7_A145 Structure Of Apo-Calmodulin Bound To Unconventional 2e-04
2vb6_B149 Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigo 2e-04
3sg2_A449 Crystal Structure Of Gcamp2-T116v,D381y Length = 44 3e-04
1ggz_A148 Crystal Structure Of The Calmodulin-Like Protein (H 3e-04
1omv_A201 Non-Myristoylated Bovine Recoverin (E85q Mutant) Wi 3e-04
1la3_A201 Solution Structure Of Recoverin Mutant, E85q Length 3e-04
1ahr_A146 Calmodulin Mutant With A Two Residue Deletion In Th 5e-04
3kf9_A149 Crystal Structure Of The SdcenSKMLCK COMPLEX Length 5e-04
2d8n_A207 Crystal Structure Of Human Recoverin At 2.2 A Resol 6e-04
3sg7_A448 Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 4 6e-04
1dmo_A148 Calmodulin, Nmr, 30 Structures Length = 148 6e-04
2jt3_A161 Solution Structure Of F153w Cardiac Troponin C Leng 6e-04
2k0j_A148 Solution Structure Of Cam Complexed To Drp1p Length 7e-04
>pdb|2ZFD|A Chain A, The Crystal Structure Of Plant Specific Calcium Binding Protein Atcbl2 In Complex With The Regulatory Domain Of Atcipk14 Length = 226 Back     alignment and structure 
Iteration: 1

 Score =  362 bits (928), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 181/226 (80%), Positives = 189/226 (83%), Gaps = 20/226 (8%)
Query: 1   MVQCLDGLKHFCVVVVNCCDADLYKQPRGLEDPEALARETVFSVSEIEALYELFKKISSA 60
           M QC+DG+KH C  V+ C D DLYKQ  GL DPE LAR+TVFSVSEIEALYELFKKISSA
Sbjct: 1   MSQCVDGIKHLCTSVLGCFDLDLYKQSGGLGDPELLARDTVFSVSEIEALYELFKKISSA 60
Query: 61  VIDDGLINK--------------------VFDLFDTKHNGILDFEEFARALSIFHPNSPI 100
           VIDDGLINK                    VFDLFDTKHNGIL FEEFARALS+FHPN+PI
Sbjct: 61  VIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPI 120
Query: 101 DDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLSDDVIESIIDKTFEEADTKHD 160
           DDKI FSFQLYDLKQQGFIERQEVKQMVVATL ESGMNL D VIE IIDKTFEEADTKHD
Sbjct: 121 DDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLKDTVIEDIIDKTFEEADTKHD 180
Query: 161 GKIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 206
           GKIDKEEWR+LVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQV+DT
Sbjct: 181 GKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVEDT 226
>pdb|1UHN|A Chain A, The Crystal Structure Of The Calcium Binding Protein Atcbl2 From Arabidopsis Thaliana Length = 189 Back     alignment and structure
>pdb|1V1F|A Chain A, Structure Of The Arabidopsis Thaliana Sos3 Complexed With Calcium(Ii) And Manganese(Ii) Ions Length = 222 Back     alignment and structure
>pdb|2EHB|A Chain A, The Structure Of The C-Terminal Domain Of The Protein Kinase Atsos2 Bound To The Calcium Sensor Atsos3 Length = 207 Back     alignment and structure
>pdb|1MF8|B Chain B, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 170 Back     alignment and structure
>pdb|1TCO|B Chain B, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 169 Back     alignment and structure
>pdb|2P6B|B Chain B, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 156 Back     alignment and structure
>pdb|3LL8|B Chain B, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 155 Back     alignment and structure
>pdb|1G8I|A Chain A, Crystal Structure Of Human Frequenin (Neuronal Calcium Sensor 1) Length = 190 Back     alignment and structure
>pdb|2L2E|A Chain A, Solution Nmr Structure Of Myristoylated Ncs1p In Apo Form Length = 190 Back     alignment and structure
>pdb|1BJF|A Chain A, Crystal Structure Of Recombinant Bovine Neurocalcin Delta At 2.4 Angstroms Length = 193 Back     alignment and structure
>pdb|3DD4|A Chain A, Structural Basis Of Kchip4a Modulation Of Kv4.3 Slow Inactivation Length = 229 Back     alignment and structure
>pdb|1S1E|A Chain A, Crystal Structure Of Kv Channel-Interacting Protein 1 (Kchip-1) Length = 224 Back     alignment and structure
>pdb|1S6C|A Chain A, Crystal Structure Of The Complex Between Kchip1 And Kv4.2 N1-30 Length = 183 Back     alignment and structure
>pdb|2I2R|E Chain E, Crystal Structure Of The Kchip1KV4.3 T1 COMPLEX Length = 180 Back     alignment and structure
>pdb|2NZ0|A Chain A, Crystal Structure Of Potassium Channel Kv4.3 In Complex With Its Regulatory Subunit Kchip1 (Casp Target) Length = 180 Back     alignment and structure
>pdb|2CT9|A Chain A, The Crystal Structure Of Calcineurin B Homologous Proein 1 (Chp1) Length = 208 Back     alignment and structure
>pdb|2E30|A Chain A, Solution Structure Of The Cytoplasmic Region Of Na+H+ Exchanger 1 Complexed With Essential Cofactor Calcineurin B Homologous Protein 1 Length = 195 Back     alignment and structure
>pdb|1FPW|A Chain A, Structure Of Yeast Frequenin Length = 190 Back     alignment and structure
>pdb|2JUL|A Chain A, Nmr Structure Of Dream Length = 256 Back     alignment and structure
>pdb|2BEC|A Chain A, Crystal Structure Of Chp2 In Complex With Its Binding Region In Nhe1 And Insights Into The Mechanism Of Ph Regulation Length = 202 Back     alignment and structure
>pdb|2L4H|A Chain A, The Solution Structure Of Calcium Bound Cib1 Length = 214 Back     alignment and structure
>pdb|1DGU|A Chain A, Homology-Based Model Of Calcium-Saturated Cib (Calcium-And Integrin-Binding Protein) Length = 183 Back     alignment and structure
>pdb|2GGZ|A Chain A, Crystal Structure Of Human Guanylate Cyclase Activating Protein-3 Length = 211 Back     alignment and structure
>pdb|2R2I|A Chain A, Myristoylated Guanylate Cyclase Activating Protein-1 With Calcium Bound Length = 198 Back     alignment and structure
>pdb|4AQR|A Chain A, Crystal Structure Of A Calmodulin In Complex With The Regulatory Domain Of A Plasma-Membrane Ca2+-Atpase Length = 149 Back     alignment and structure
>pdb|1RFJ|A Chain A, Crystal Structure Of Potato Calmodulin Pcm6 Length = 149 Back     alignment and structure
>pdb|1VRK|A Chain A, The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|3EKH|A Chain A, Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|1OOJ|A Chain A, Structural Genomics Of Caenorhabditis Elegans : Calmodulin Length = 149 Back     alignment and structure
>pdb|2LV6|A Chain A, The Complex Between Ca-calmodulin And Skeletal Muscle Myosin Light Chain Kinase From Combination Of Nmr And Aqueous And Contrast-matched Saxs Data Length = 148 Back     alignment and structure
>pdb|2BKH|B Chain B, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 149 Back     alignment and structure
>pdb|2BBM|A Chain A, Solution Structure Of A Calmodulin-Target Peptide Complex By Multidimensional Nmr Length = 148 Back     alignment and structure
>pdb|1QS7|A Chain A, The 1.8 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 145 Back     alignment and structure
>pdb|1QTX|A Chain A, The 1.65 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|2HET|A Chain A, Non-Myristoylated Bovine Recoverin (Truncated At C-Terminus) With Calcium Bound To Ef-Hand 3 Length = 189 Back     alignment and structure
>pdb|2I94|A Chain A, Nmr Structure Of Recoverin Bound To Rhodopsin Kinase Length = 202 Back     alignment and structure
>pdb|1OMR|A Chain A, Non-Myristoylated Wild-Type Bovine Recoverin With Calcium Bound To Ef- Hand 3 Length = 201 Back     alignment and structure
>pdb|2L1W|A Chain A, The Solution Structure Of Soybean Calmodulin Isoform 4 Complexed With The Vacuolar Calcium Atpase Bca1 Peptide Length = 149 Back     alignment and structure
>pdb|1JSA|A Chain A, Myristoylated Recoverin With Two Calciums Bound, Nmr, 24 Structures Length = 201 Back     alignment and structure
>pdb|3SG6|A Chain A, Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) Length = 450 Back     alignment and structure
>pdb|3EVU|A Chain A, Crystal Structure Of Calcium Bound Dimeric Gcamp2, (#1) Length = 449 Back     alignment and structure
>pdb|3EK8|A Chain A, Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|3EVR|A Chain A, Crystal Structure Of Calcium Bound Monomeric Gcamp2 Length = 411 Back     alignment and structure
>pdb|1CDM|A Chain A, Modulation Of Calmodulin Plasticity In Molecular Recognition On The Basis Of X-Ray Structures Length = 144 Back     alignment and structure
>pdb|1XFU|O Chain O, Crystal Structure Of Anthrax Edema Factor (ef) Truncation Mutant, Ef-delta 64 In Complex With Calmodulin Length = 149 Back     alignment and structure
>pdb|3O78|A Chain A, The Structure Of Ca2+ Sensor (Case-12) Length = 415 Back     alignment and structure
>pdb|3O77|A Chain A, The Structure Of Ca2+ Sensor (Case-16) Length = 415 Back     alignment and structure
>pdb|2YGG|B Chain B, Complex Of Cambr And Cam Length = 150 Back     alignment and structure
>pdb|1PRW|A Chain A, Crystal Structure Of Bovine Brain Ca++ Calmodulin In A Compact Form Length = 149 Back     alignment and structure
>pdb|1UP5|B Chain B, Chicken Calmodulin Length = 148 Back     alignment and structure
>pdb|1Y0V|H Chain H, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And Pyrophosphate Length = 146 Back     alignment and structure
>pdb|5PAL|A Chain A, Crystal Structure Of The Unique Parvalbumin Component From Muscle Of The Leopard Shark (Triakis Semifasciata). The First X-Ray Study Of An Alpha-Parvalbumin Length = 109 Back     alignment and structure
>pdb|1CDL|A Chain A, Target Enzyme Recognition By Calmodulin: 2.4 Angstroms Structure Of A Calmodulin-Peptide Complex Length = 147 Back     alignment and structure
>pdb|2WEL|D Chain D, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 150 Back     alignment and structure
>pdb|2BE6|A Chain A, 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaCAM COMPLEX Length = 150 Back     alignment and structure
>pdb|4DJC|A Chain A, 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCAM COMPLEX Length = 152 Back     alignment and structure
>pdb|3EWT|A Chain A, Crystal Structure Of Calmodulin Complexed With A Peptide Length = 154 Back     alignment and structure
>pdb|2F2O|A Chain A, Structure Of Calmodulin Bound To A Calcineurin Peptide: A New Way Of Making An Old Binding Mode Length = 179 Back     alignment and structure
>pdb|1CM1|A Chain A, Motions Of Calmodulin-Single-Conformer Refinement Length = 148 Back     alignment and structure
>pdb|4GOW|D Chain D, Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX COMPLEX Length = 144 Back     alignment and structure
>pdb|1K93|D Chain D, Crystal Structure Of The Adenylyl Cyclase Domain Of Anthrax Edema Factor (Ef) In Complex With Calmodulin Length = 144 Back     alignment and structure
>pdb|1IQ5|A Chain A, CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE KINASE Fragment Length = 149 Back     alignment and structure
>pdb|2VAY|A Chain A, Calmodulin Complexed With Cav1.1 Iq Peptide Length = 146 Back     alignment and structure
>pdb|2IX7|A Chain A, Structure Of Apo-Calmodulin Bound To Unconventional Myosin V Length = 145 Back     alignment and structure
>pdb|2VB6|B Chain B, Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigor State ( Crystal Form 2) Length = 149 Back     alignment and structure
>pdb|3SG2|A Chain A, Crystal Structure Of Gcamp2-T116v,D381y Length = 449 Back     alignment and structure
>pdb|1GGZ|A Chain A, Crystal Structure Of The Calmodulin-Like Protein (Hclp) From Human Epithelial Cells Length = 148 Back     alignment and structure
>pdb|1OMV|A Chain A, Non-Myristoylated Bovine Recoverin (E85q Mutant) With Calcium Bound To Ef-Hand 3 Length = 201 Back     alignment and structure
>pdb|1LA3|A Chain A, Solution Structure Of Recoverin Mutant, E85q Length = 201 Back     alignment and structure
>pdb|1AHR|A Chain A, Calmodulin Mutant With A Two Residue Deletion In The Central Helix Length = 146 Back     alignment and structure
>pdb|3KF9|A Chain A, Crystal Structure Of The SdcenSKMLCK COMPLEX Length = 149 Back     alignment and structure
>pdb|2D8N|A Chain A, Crystal Structure Of Human Recoverin At 2.2 A Resolution Length = 207 Back     alignment and structure
>pdb|3SG7|A Chain A, Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 448 Back     alignment and structure
>pdb|1DMO|A Chain A, Calmodulin, Nmr, 30 Structures Length = 148 Back     alignment and structure
>pdb|2JT3|A Chain A, Solution Structure Of F153w Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|2K0J|A Chain A, Solution Structure Of Cam Complexed To Drp1p Length = 148 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 2e-83
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 7e-67
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 2e-54
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 8e-46
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 1e-45
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 2e-43
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 3e-42
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 1e-41
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 2e-41
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 3e-41
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 4e-41
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 2e-40
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 2e-40
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 3e-40
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 4e-40
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 1e-39
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 4e-39
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 9e-37
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 1e-36
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 2e-13
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 1e-05
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 5e-13
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 6e-04
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 8e-13
3lij_A494 Calcium/calmodulin dependent protein kinase with A 8e-13
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 2e-12
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 1e-05
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 3e-12
2hps_A186 Coelenterazine-binding protein with bound coelent; 3e-12
2hps_A186 Coelenterazine-binding protein with bound coelent; 9e-07
2hps_A186 Coelenterazine-binding protein with bound coelent; 9e-05
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 4e-12
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 6e-12
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 7e-12
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 1e-11
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 2e-11
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 3e-11
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 3e-11
2jnf_A158 Troponin C; stretch activated muscle contraction, 5e-11
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 6e-11
3fwb_A161 Cell division control protein 31; gene gating, com 6e-11
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 8e-11
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 9e-11
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 1e-10
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 1e-10
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 1e-10
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 1e-10
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 2e-10
2be4_A 272 Hypothetical protein LOC449832; DR.36843, BC083168 6e-04
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 2e-10
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 3e-10
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 7e-09
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 2e-04
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 3e-10
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 3e-10
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 4e-10
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 1e-08
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 5e-05
1exr_A148 Calmodulin; high resolution, disorder, metal trans 4e-10
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 4e-10
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 9e-07
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 5e-04
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 4e-10
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 5e-10
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 7e-10
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 8e-10
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 1e-09
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 2e-09
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 2e-09
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 2e-09
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 2e-09
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 3e-09
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 3e-09
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 2e-07
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 3e-09
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 4e-09
3a4u_B143 Multiple coagulation factor deficiency protein 2; 4e-09
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 4e-09
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 4e-09
3akb_A166 Putative calcium binding protein; EF-hand, metal b 8e-09
3akb_A166 Putative calcium binding protein; EF-hand, metal b 2e-07
3akb_A166 Putative calcium binding protein; EF-hand, metal b 4e-05
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 8e-09
1y1x_A191 Leishmania major homolog of programmed cell death 9e-09
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 1e-08
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 3e-07
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 2e-04
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 1e-08
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 7e-06
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 7e-04
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 2e-08
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 2e-08
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 2e-08
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 3e-08
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 4e-07
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 1e-05
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 3e-08
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 3e-08
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 4e-08
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 5e-08
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 5e-08
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 5e-08
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 6e-08
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 1e-07
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 1e-07
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 4e-07
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 6e-07
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 7e-07
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 9e-07
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 9e-07
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 1e-06
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 1e-06
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 1e-06
3li6_A66 Calcium-binding protein; calcium signaling protein 2e-06
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 2e-06
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 2e-06
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 9e-06
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 9e-06
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 1e-05
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 3e-05
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 3e-05
1c07_A95 Protein (epidermal growth factor receptor pathway 4e-05
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 4e-05
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 6e-05
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 8e-05
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 9e-05
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 1e-04
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 2e-04
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 5e-04
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 5e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 7e-04
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
 Score =  245 bits (628), Expect = 2e-83
 Identities = 181/226 (80%), Positives = 189/226 (83%), Gaps = 20/226 (8%)

Query: 1   MVQCLDGLKHFCVVVVNCCDADLYKQPRGLEDPEALARETVFSVSEIEALYELFKKISSA 60
           M QC+DG+KH C  V+ C D DLYKQ  GL DPE LAR+TVFSVSEIEALYELFKKISSA
Sbjct: 1   MSQCVDGIKHLCTSVLGCFDLDLYKQSGGLGDPELLARDTVFSVSEIEALYELFKKISSA 60

Query: 61  VIDDGLINK--------------------VFDLFDTKHNGILDFEEFARALSIFHPNSPI 100
           VIDDGLINK                    VFDLFDTKHNGIL FEEFARALS+FHPN+PI
Sbjct: 61  VIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPI 120

Query: 101 DDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLSDDVIESIIDKTFEEADTKHD 160
           DDKI FSFQLYDLKQQGFIERQEVKQMVVATL ESGMNL D VIE IIDKTFEEADTKHD
Sbjct: 121 DDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLKDTVIEDIIDKTFEEADTKHD 180

Query: 161 GKIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 206
           GKIDKEEWR+LVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQV+DT
Sbjct: 181 GKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVEDT 226
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Length = 179 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Length = 143 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Length = 261 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Length = 103 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Length = 714 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query206
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 100.0
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.96
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.93
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.9
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.89
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.88
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.87
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.86
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.86
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.86
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.86
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.85
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.85
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.85
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.84
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.84
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.83
3fwb_A161 Cell division control protein 31; gene gating, com 99.83
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.83
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.83
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.83
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.83
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.82
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.82
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.82
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.81
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.81
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.8
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.8
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.8
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.8
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.8
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.79
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.79
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.78
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.78
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.78
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.77
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.77
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.77
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.76
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.76
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.76
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.76
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.74
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.74
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.74
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.73
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.73
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.73
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.72
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.72
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.72
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.71
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 99.71
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.71
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.71
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.71
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.7
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.7
1y1x_A191 Leishmania major homolog of programmed cell death 99.7
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.7
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.69
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.69
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.68
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.68
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.67
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.66
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.66
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.66
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.65
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.64
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.64
3a4u_B143 Multiple coagulation factor deficiency protein 2; 99.63
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.63
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.63
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.63
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.63
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.63
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.62
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.62
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.61
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.61
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.61
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.6
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.59
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.59
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.59
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.59
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.56
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.56
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.56
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.55
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.55
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.52
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.52
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.5
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.5
1y1x_A191 Leishmania major homolog of programmed cell death 99.48
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.46
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.46
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.46
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.46
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.44
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.43
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.43
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.43
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 99.43
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.42
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.41
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 99.41
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.4
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.4
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.39
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.39
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.38
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.38
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.38
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.37
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.37
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.37
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.37
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.37
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.36
3fwb_A161 Cell division control protein 31; gene gating, com 99.36
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.35
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.35
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.35
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.34
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.34
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.34
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.34
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.34
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.34
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.33
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.33
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 99.32
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.31
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.31
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 99.3
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.3
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.3
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.29
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.29
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.29
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 99.29
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 99.28
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.27
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.27
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.27
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.27
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.26
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.25
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.25
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.25
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.24
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.24
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.23
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 99.23
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.22
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 99.22
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.22
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.2
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.19
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.19
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 99.19
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 99.19
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.19
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.18
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 99.18
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.18
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.18
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 99.17
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.17
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.17
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 99.16
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 99.16
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.16
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.16
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 99.15
1avs_A90 Troponin C; muscle contraction, calcium-activated, 99.15
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 99.15
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.14
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 99.14
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 99.13
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.12
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.12
3li6_A66 Calcium-binding protein; calcium signaling protein 99.12
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.11
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.1
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 99.1
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 99.1
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.09
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.09
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 99.09
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.08
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 99.08
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 99.07
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 99.06
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 99.06
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 99.06
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 99.06
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 99.05
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 99.05
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 99.05
1qjt_A99 EH1, epidermal growth factor receptor substrate su 99.04
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.04
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 99.04
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.03
1c07_A95 Protein (epidermal growth factor receptor pathway 99.03
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 99.02
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.02
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.02
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.01
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 99.01
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 99.0
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.0
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 99.0
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.99
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.99
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 98.97
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.97
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.96
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.96
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.95
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 98.94
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.93
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.91
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.91
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.91
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.9
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.9
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.9
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.89
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.89
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.88
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.87
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.86
2lv7_A100 Calcium-binding protein 7; metal binding protein; 98.86
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.85
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.85
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.85
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.85
3li6_A66 Calcium-binding protein; calcium signaling protein 98.84
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.84
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 98.81
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.81
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.8
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.77
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.76
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.76
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 98.75
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.75
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.74
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.74
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.74
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.73
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.73
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.73
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.71
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.71
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.68
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.67
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.67
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.66
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.65
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.64
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 98.63
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.62
1c07_A95 Protein (epidermal growth factor receptor pathway 98.62
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.6
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.6
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.59
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.58
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.58
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.58
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.57
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 98.57
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.57
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.56
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.56
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.56
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.55
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.54
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.53
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.51
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.5
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.5
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.48
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.48
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.47
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.46
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.46
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.46
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.44
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 98.44
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.44
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.42
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.42
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.4
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.36
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.34
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 98.32
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.29
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 98.21
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.18
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.1
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.06
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 97.94
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 97.85
1nub_A229 Basement membrane protein BM-40; extracellular mod 97.83
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 97.57
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 97.49
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 97.34
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 97.17
1nub_A229 Basement membrane protein BM-40; extracellular mod 96.78
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 94.11
3tdu_A200 DCN1-like protein 1; E2:E3, ligase-protein binding 90.15
3kev_A199 Galieria sulfuraria DCUN1 domain-containing prote; 89.19
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 88.91
4fl4_A88 Glycoside hydrolase family 9; structural genomics, 88.85
2l5y_A150 Stromal interaction molecule 2; EF-hand, SAM domai 86.83
4gba_A 221 DCN1-like protein 3; E3 ligase, ligase-peptide com 84.99
4dh2_B82 Dockerin type 1; cellulosome, cohesin, type I cohe 84.15
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 82.87
2l5y_A150 Stromal interaction molecule 2; EF-hand, SAM domai 82.73
1wlm_A151 Protein CGI-38; structural genomics, NPPSFA, natio 81.91
2jrf_A184 Tubulin polymerization-promoting protein family me 81.52
2kav_A129 Sodium channel protein type 2 subunit alpha; volta 80.09
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
Probab=100.00  E-value=8.3e-33  Score=216.94  Aligned_cols=206  Identities=87%  Similarity=1.309  Sum_probs=148.2

Q ss_pred             CccccccchhhHHHHhccccCCCCCCCCCCCcHHHHHhhcCCCHHHHHHHHHHHHhhccCCcCccHH-------------
Q 028605            1 MVQCLDGLKHFCVVVVNCCDADLYKQPRGLEDPEALARETVFSVSEIEALYELFKKISSAVIDDGLI-------------   67 (206)
Q Consensus         1 ~~~~~~~~~~~~~~~m~~~~s~~~~~~~~~~~~~~l~~~~~~s~~e~~~l~~~F~~~d~~~~~~g~i-------------   67 (206)
                      |-||+.+++.+...+||+++|+.+++++..+.+..+...+.++++++.+++..|..+|.+..++|.|             
T Consensus         1 ~~~~~~~~~~~~~~~MG~~~s~~~~~~l~~~~~~~l~~~~~ls~~ei~~l~~~F~~~D~d~~~~G~I~~~El~~~l~~~~   80 (226)
T 2zfd_A            1 MSQCVDGIKHLCTSVLGCFDLDLYKQSGGLGDPELLARDTVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTN   80 (226)
T ss_dssp             -------------------------------CTHHHHHHSSCCHHHHHHHHHHHHHHHTSSSCSSSBCHHHHHHHHHSCS
T ss_pred             CchhhhhHHHHHHHhhccchhhhccccCCHHHHHHHHHhCCCCHHHHHHHHHHHHHhCcccCCCCeEcHHHHHHHHhccC
Confidence            6789999999999999999999887788889999999999999999999999999999641123333             


Q ss_pred             -------HHHHhHHcCCCCCcccHHHHHHHHHhhCCCCChHHHHHHHHhhhCCCCCCcccHHHHHHHHHHHHHhcCCCCC
Q 028605           68 -------NKVFDLFDTKHNGILDFEEFARALSIFHPNSPIDDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLS  140 (206)
Q Consensus        68 -------~~lf~~~d~~~~g~i~f~ef~~~~~~~~~~~~~~~~~~~~F~~~D~~~~g~It~~Ef~~~l~~~~~~~~~~~~  140 (206)
                             ..+|..+|.+++|.|+|.||..++..........+.++.+|+.+|.+++|.|+.+||..++..+....|..++
T Consensus        81 ~~~~~~~~~~f~~~D~d~dG~I~~~Ef~~~~~~~~~~~~~~~~l~~~F~~~D~d~~G~Is~~E~~~~l~~~~~~~g~~~~  160 (226)
T 2zfd_A           81 KKESLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPIDDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLK  160 (226)
T ss_dssp             SCCCHHHHHHHHHHCSSCSSSBCHHHHHHHHHHTSTTSCHHHHHHHHHHHHCTTSSSSEEHHHHHHHHHHHHHHTTCCCC
T ss_pred             cccHHHHHHHHHHHcCCCCCcCcHHHHHHHHHHHccCCCHHHHHHHHHHHhCCCCCCcccHHHHHHHHHHHHHHcCCCCC
Confidence                   3389999999999999999999998877555788899999999999999999999999998876667789999


Q ss_pred             HHHHHHHHHHHHHHhCCCCCCcccHHHHHHHHhhChhHHhhhhhhhhhhhhhccCcceeccccCCC
Q 028605          141 DDVIESIIDKTFEEADTKHDGKIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT  206 (206)
Q Consensus       141 ~~~~~~~~~~~f~~~d~d~~g~Is~~eF~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  206 (206)
                      +++++.++..+|+.+|.|++|.|+|+||..++..+|.+.+.++.+++.+++..||+||+|+++.||
T Consensus       161 ~~~~~~~~~~~f~~~D~d~dG~I~~~EF~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~  226 (226)
T 2zfd_A          161 DTVIEDIIDKTFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVEDT  226 (226)
T ss_dssp             HHHHHHHHHHHHHHHCSSCSSEECHHHHHHHHHHSGGGGGGGCCGGGGGHHHHC------------
T ss_pred             HHHHHHHHHHHHHHhCCCCCCcCcHHHHHHHHHhChHHHHHhchHHhhchhhcchhHHhhhhhccC
Confidence            999999999999999999999999999999999999999999999999999999999999998886
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A* Back     alignment and structure
>3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A Back     alignment and structure
>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>4gba_A DCN1-like protein 3; E3 ligase, ligase-peptide complex; HET: AME; 2.40A {Homo sapiens} Back     alignment and structure
>4dh2_B Dockerin type 1; cellulosome, cohesin, type I cohesin-dockerin, Pro protein interaction, cell adhesion; 1.75A {Clostridium thermocellum} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 Back     alignment and structure
>2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 206
d2zfda1183 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { 2e-38
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 4e-26
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 9e-26
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 4e-24
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 1e-23
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9e-22
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 6e-21
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 2e-19
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 2e-11
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 2e-10
d1auib_165 a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch 9e-10
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 5e-09
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 7e-09
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 8e-09
d1tuza_118 a.39.1.7 (A:) Diacylglycerol kinase alpha, N-termi 4e-08
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 7e-08
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 1e-07
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 2e-07
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 1e-06
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 5e-04
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 2e-06
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 0.002
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 3e-06
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 4e-06
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 6e-06
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 8e-06
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 1e-04
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-05
d1jfja_134 a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly 1e-05
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 2e-05
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 4e-05
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 6e-05
d1juoa_172 a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 6e-05
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 7e-05
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 8e-05
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 6e-04
d1qx2a_76 a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax 8e-05
d1a4pa_92 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 9e-05
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 1e-04
d3c1va193 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa 2e-04
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 2e-04
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-04
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 2e-04
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 0.003
d1hqva_181 a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous 3e-04
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 5e-04
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 5e-04
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 6e-04
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 6e-04
d1m45a_146 a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye 7e-04
d1zfsa193 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no 0.001
d1psra_100 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 0.001
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 0.003
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 0.004
d1yuta198 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa 0.004
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 0.004
d1e8aa_87 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 0.004
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Calcineurin B-like protein 2
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score =  128 bits (322), Expect = 2e-38
 Identities = 152/183 (83%), Positives = 156/183 (85%), Gaps = 20/183 (10%)

Query: 32  DPEALARETVFSVSEIEALYELFKKISSAVIDDGLINK--------------------VF 71
           DPE LAR+TVFSVSEIEALYELFKKISSAVIDDGLINK                    VF
Sbjct: 1   DPELLARDTVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVF 60

Query: 72  DLFDTKHNGILDFEEFARALSIFHPNSPIDDKIEFSFQLYDLKQQGFIERQEVKQMVVAT 131
           DLFDTKHNGIL FEEFARALS+FHPN+PIDDKI FSFQLYDLKQQGFIERQEVKQMVVAT
Sbjct: 61  DLFDTKHNGILGFEEFARALSVFHPNAPIDDKIHFSFQLYDLKQQGFIERQEVKQMVVAT 120

Query: 132 LTESGMNLSDDVIESIIDKTFEEADTKHDGKIDKEEWRNLVLRHPSLLKNMTLQYLKDIT 191
           L ESGMNL D VIE IIDKTFEEADTKHDGKIDKEEWR+LVLRHPSLLKNMTLQYLKDIT
Sbjct: 121 LAESGMNLKDTVIEDIIDKTFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDIT 180

Query: 192 TTF 194
           TTF
Sbjct: 181 TTF 183
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query206
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.96
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.93
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.93
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.92
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.89
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.87
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.86
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.83
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.82
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.81
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.8
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.76
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.73
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.73
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.68
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.68
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.68
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.66
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.65
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.64
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.63
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.63
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.63
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.61
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.58
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.57
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.57
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.57
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.56
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.56
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.54
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.53
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.52
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.51
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.5
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.48
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.46
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.44
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.44
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.44
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.41
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.41
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.38
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.36
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.36
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.36
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.36
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.35
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.32
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.32
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.31
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.3
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.29
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.29
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.28
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.26
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 99.25
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.24
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.24
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.23
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 99.21
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.2
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.18
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.18
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.17
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.17
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.16
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 99.14
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.11
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.11
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.09
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 99.07
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.07
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.06
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.04
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.04
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.04
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.03
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.01
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.01
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.0
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.98
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.97
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 98.97
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.96
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.95
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.95
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.93
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.93
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 98.93
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.92
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.92
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.92
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.92
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.91
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 98.91
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.9
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.9
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.89
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.88
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.88
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.88
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.87
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.87
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.87
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.85
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.84
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 98.84
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.84
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.83
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.82
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.76
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 98.74
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.74
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.73
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.7
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.68
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.65
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.61
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.61
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.6
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.59
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.53
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.53
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.52
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.51
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.49
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.48
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.46
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.44
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 98.44
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.43
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.39
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.35
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.35
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.28
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.28
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.23
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.22
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.18
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.11
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.06
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.03
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 97.96
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 97.95
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.92
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.91
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.87
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 97.66
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 97.66
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 97.61
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.31
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.28
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.2
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.17
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 97.15
d1h8ba_73 alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} 95.78
d1eg3a297 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 95.4
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 93.5
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 93.33
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 93.02
d2cclb159 Endo-1,4-beta-xylanase Y {Clostridium thermocellum 89.03
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 88.56
d2cclb159 Endo-1,4-beta-xylanase Y {Clostridium thermocellum 85.14
d1dava_71 Cellulosome endoglucanase SS {Clostridium thermoce 84.89
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Calcineurin B-like protein 2
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.96  E-value=4.5e-28  Score=182.54  Aligned_cols=162  Identities=93%  Similarity=1.334  Sum_probs=148.7

Q ss_pred             HHHHHhhcCCCHHHHHHHHHHHHhhccCCcCccHHHH--------------------HHhHHcCCCCCcccHHHHHHHHH
Q 028605           33 PEALARETVFSVSEIEALYELFKKISSAVIDDGLINK--------------------VFDLFDTKHNGILDFEEFARALS   92 (206)
Q Consensus        33 ~~~l~~~~~~s~~e~~~l~~~F~~~d~~~~~~g~i~~--------------------lf~~~d~~~~g~i~f~ef~~~~~   92 (206)
                      ++.++..+.||++|+..+++.|+.++.+..++|.|+.                    +|..+|.+++|.|+|.||+.+++
T Consensus         2 ~~~l~~~t~Fs~~ei~~L~~~F~~~d~~~~~~G~i~~~ef~~~l~~~~~~~~~~~~~lf~~~d~~~dg~I~f~EFl~~l~   81 (183)
T d2zfda1           2 PELLARDTVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGFEEFARALS   81 (183)
T ss_dssp             THHHHHHSSCCHHHHHHHHHHHHHHHTSSSCSSSBCHHHHHHHHHSCSSCCCHHHHHHHHHHCSSCSSSBCHHHHHHHHH
T ss_pred             HHHHhhhCCCCHHHHHHHHHHHHHHCcCCCCCCcCcHHHHHHHHHhcCCCCCHHHHHHHHHHccCCCCcCcHHHHHHHHH
Confidence            4678999999999999999999999876434565554                    99999999999999999999998


Q ss_pred             hhCCCCChHHHHHHHHhhhCCCCCCcccHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHHHhCCCCCCcccHHHHHHHH
Q 028605           93 IFHPNSPIDDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLSDDVIESIIDKTFEEADTKHDGKIDKEEWRNLV  172 (206)
Q Consensus        93 ~~~~~~~~~~~~~~~F~~~D~~~~g~It~~Ef~~~l~~~~~~~~~~~~~~~~~~~~~~~f~~~d~d~~g~Is~~eF~~~l  172 (206)
                      .++...+.+++++.+|+++|.+++|.|+.+|+..++..++...+..+++..++.++..+|..+|.|++|.|+|+||..++
T Consensus        82 ~~~~~~~~~~~~~~~F~~~D~d~~G~Is~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~if~~~D~d~dG~Is~~EF~~~~  161 (183)
T d2zfda1          82 VFHPNAPIDDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLKDTVIEDIIDKTFEEADTKHDGKIDKEEWRSLV  161 (183)
T ss_dssp             HTSTTSCHHHHHHHHHHHHCTTSSSSEEHHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHHCSSCSSEECHHHHHHHH
T ss_pred             hhhccCcHHHHHHHhhcccccCCCCCccHHHHHHHHHHHHhhhhcccchHHHHHHHHHHHHHhCCCCCCeEcHHHHHHHH
Confidence            88776688899999999999999999999999999988888888899999999999999999999999999999999999


Q ss_pred             hhChhHHhhhhhhhhhhhhhcc
Q 028605          173 LRHPSLLKNMTLQYLKDITTTF  194 (206)
Q Consensus       173 ~~~~~~~~~~~~~~~~~~~~~~  194 (206)
                      .++|.+.+.|+++++++++..|
T Consensus       162 ~~~p~~~~~~~l~~~~~~~~~~  183 (183)
T d2zfda1         162 LRHPSLLKNMTLQYLKDITTTF  183 (183)
T ss_dssp             HHSGGGGGGGCCGGGGGHHHHC
T ss_pred             HHCHHHHHHcCchhhccccccC
Confidence            9999999999999999998765
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eg3a2 a.39.1.7 (A:210-306) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1dava_ a.139.1.1 (A:) Cellulosome endoglucanase SS {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure