Citrus Sinensis ID: 028609


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200------
MRCSSYGLIIPGSESRFLTTTTTPTTNKKPDRFPRIYPTSVSFGSLKVKAKLNDAAGGTATATAVVDESKELSFYDLLGIPESVSLVEIKQAYKQMARKYHPDVSPPDRVEEYTQRFIRVQEAYETLSDPGLRALYDRDLSMGLHLAFSARRRQQNDDFQVRSEWRNRWQSQLSELKRRSMNKDAGGNISWAARMRRKRDGLSQEL
cccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccHHHHccccccccHHHccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccHHHHccccccccccc
cccccccEEEcccccccccccccccccccccccccccccccccccccccEcccccccccccccccccHcccccHHHHHcccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccHcHHHHHHHHHHHccc
mrcssygliipgsesrfltttttpttnkkpdrfpriyptsvsfgslKVKAKlndaaggtaTATAVVdeskelsfydllgipesVSLVEIKQAYKQMARkyhpdvsppdrvEEYTQRFIRVQEAYEtlsdpglralydrdlsmgLHLAFSARRRQQNDDFQVRSEWRNRWQSQLSELKRRSmnkdaggniSWAARMRRKRDGLSQEL
mrcssygliipgsesrfltttttpttnkkpdrfpriyptsvsfgsLKVKAKLNDAAGGTATATAVVDESKELSFYDLLGIPESVSLVEIKQAYKQMARkyhpdvsppdrvEEYTQRFIRVQEayetlsdpglRALYDRDLSMGLHLAFSARRRQQNDDFQVRSEWRNRWQSqlselkrrsmnkdaggniswaarmrrkrdglsqel
MRCSSYGLIIPGSESRFLtttttpttNKKPDRFPRIYPTSVSFGSLKVKAKLNDaaggtatataVVDESKELSFYDLLGIPESVSLVEIKQAYKQMARKYHPDVSPPDRVEEYTQRFIRVQEAYETLSDPGLRALYDRDLSMGLHLAFSARRRQQNDDFQVRSEWRNRWQSQLSELKRRSMNKDAGGNISWAARMRRKRDGLSQEL
************************************YPTSVSFGSLKVKAKLNDAAGGTATATAVVDESKELSFYDLLGIPESVSLVEIKQAYKQMARKY*********VEEYTQRFIRVQEAYETLSDPGLRALYDRDLSMGLHLAFS*********************************************************
**********PGSESRFL***************************************************KELSFYDLLGIPESVSLVEIKQAYKQMARKYHPDVSPPDR*EEYTQRFIRVQEAYETLSDPGLRALYDRDLSM******************VRSEWRNRWQSQ**********************************
MRCSSYGLIIPGSESRFLTTTTTPTTNKKPDRFPRIYPTSVSFGSLKVKAKLNDAAGGTATATAVVDESKELSFYDLLGIPESVSLVEIKQAYKQMARKYHPDVSPPDRVEEYTQRFIRVQEAYETLSDPGLRALYDRDLSMGLHLAFSARRRQQNDDFQVRSEWRNRWQSQLSELKRRSMNKDAGGNISWAARMR**********
*RCSSYGLIIPGSESRFLTTTTTPTTNKKPDRFPRIYPTSV****LK*********************SKELSFYDLLGIPESVSLVEIKQAYKQMARKYHPDVSPPDRVEEYTQRFIRVQEAYETLSDPGLRALYDRDLSMGLHLAFS*******DDFQVRSEWRNRWQSQLSELKR****************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRCSSYGLIIPGSESRFLTTTTTPTTNKKPDRFPRIYPTSVSFGSLKVKAKLNDAAGGTATATAVVDESKELSFYDLLGIPESVSLVEIKQAYKQMARKYHPDVSPPDRVEEYTQRFIRVQEAYETLSDPGLRALYDRDLSMGLHLAFSARRRQQNDDFQVRSEWRNRWQSQLSELKRRSMNKDAGGNISWAARMRRKRDGLSQEL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query206 2.2.26 [Sep-21-2011]
Q9SDN0197 Chaperone protein dnaJ 20 yes no 0.917 0.959 0.527 6e-50
A5IIT4 369 Chaperone protein DnaJ OS yes no 0.310 0.173 0.507 2e-12
B1LCI2 369 Chaperone protein DnaJ OS yes no 0.310 0.173 0.507 2e-12
Q9WZV3 369 Chaperone protein DnaJ OS yes no 0.310 0.173 0.507 2e-12
B9KAB9 370 Chaperone protein DnaJ OS yes no 0.310 0.172 0.492 4e-12
P25491 409 Mitochondrial protein imp yes no 0.349 0.176 0.48 5e-12
Q05646 370 Chaperone protein DnaJ OS yes no 0.300 0.167 0.507 6e-12
P53863 590 J protein JJJ1 OS=Sacchar no no 0.305 0.106 0.515 9e-12
O66921 376 Chaperone protein DnaJ 2 yes no 0.364 0.199 0.439 1e-11
Q8RB67 384 Chaperone protein DnaJ OS yes no 0.305 0.164 0.492 1e-11
>sp|Q9SDN0|DNJ20_ARATH Chaperone protein dnaJ 20, chloroplastic OS=Arabidopsis thaliana GN=ATJ20 PE=2 SV=2 Back     alignment and function desciption
 Score =  197 bits (500), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 107/203 (52%), Positives = 135/203 (66%), Gaps = 14/203 (6%)

Query: 1   MRCSSYGLIIPGSESRFLTTTTTPTTNKKPDRFPRI--YPTSVSFGSLKVKAKLNDAAGG 58
           M+C     I+  +   F      P ++ +P   P    YPT   F S +++++L      
Sbjct: 1   MKCYKSSSILSTNHHPFFYKQQ-PISSLQPTSIPTTISYPTRTRFSSTRIQSRL------ 53

Query: 59  TATATAVVDESKELSFYDLLGIPESVSLVEIKQAYKQMARKYHPDVSPPDRVEEYTQRFI 118
             T    V +S++LSFYDLLG+ ESV+L EIKQAYKQ+ARKYHPDVSPPDRVEEYT RFI
Sbjct: 54  --THDDPVKQSEDLSFYDLLGVTESVTLPEIKQAYKQLARKYHPDVSPPDRVEEYTDRFI 111

Query: 119 RVQEAYETLSDPGLRALYDRDLSMGLHLAFSARRRQQNDDFQV--RSEWRNRWQSQLSEL 176
           RVQEAYETLSDP  R LYDRDLSMG   +FS RR+ + D   V  +SEW+ +WQ+QLS L
Sbjct: 112 RVQEAYETLSDPRRRVLYDRDLSMGFSFSFSGRRQNRYDQEVVEEKSEWKAKWQTQLSGL 171

Query: 177 KRRSMNKDAGGNISWAARMRRKR 199
           +RRS  KD    +SWAARMRR++
Sbjct: 172 RRRSNQKD-NNTMSWAARMRRQQ 193




Have a continuous role in plant development probably in the structural organization of compartments.
Arabidopsis thaliana (taxid: 3702)
>sp|A5IIT4|DNAJ_THEP1 Chaperone protein DnaJ OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|B1LCI2|DNAJ_THESQ Chaperone protein DnaJ OS=Thermotoga sp. (strain RQ2) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q9WZV3|DNAJ_THEMA Chaperone protein DnaJ OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|B9KAB9|DNAJ_THENN Chaperone protein DnaJ OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|P25491|MAS5_YEAST Mitochondrial protein import protein MAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDJ1 PE=1 SV=1 Back     alignment and function description
>sp|Q05646|DNAJ_ERYRH Chaperone protein DnaJ OS=Erysipelothrix rhusiopathiae GN=dnaJ PE=2 SV=1 Back     alignment and function description
>sp|P53863|JJJ1_YEAST J protein JJJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JJJ1 PE=1 SV=1 Back     alignment and function description
>sp|O66921|DNAJ2_AQUAE Chaperone protein DnaJ 2 OS=Aquifex aeolicus (strain VF5) GN=dnaJ2 PE=3 SV=1 Back     alignment and function description
>sp|Q8RB67|DNAJ_THETN Chaperone protein DnaJ OS=Thermoanaerobacter tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query206
224128988196 predicted protein [Populus trichocarpa] 0.927 0.974 0.606 3e-62
118486703196 unknown [Populus trichocarpa] 0.927 0.974 0.601 6e-62
224060341197 predicted protein [Populus trichocarpa] 0.927 0.969 0.589 1e-59
255553998201 Chaperone protein dnaJ 20, chloroplast p 0.936 0.960 0.588 9e-58
356512453184 PREDICTED: chaperone protein dnaJ 20, ch 0.878 0.983 0.574 2e-53
225433479216 PREDICTED: chaperone protein dnaJ 20, ch 0.927 0.884 0.573 9e-53
351721851186 DnaJ-like protein [Glycine max] gi|14642 0.873 0.967 0.568 1e-52
113374278177 DnaJ-like protein isoform [Solanum phure 0.733 0.853 0.645 7e-52
297804938197 hypothetical protein ARALYDRAFT_493532 [ 0.917 0.959 0.536 5e-50
6691127197 DnaJ-like protein [Arabidopsis thaliana] 0.917 0.959 0.532 9e-49
>gi|224128988|ref|XP_002328862.1| predicted protein [Populus trichocarpa] gi|222839292|gb|EEE77629.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 128/211 (60%), Positives = 157/211 (74%), Gaps = 20/211 (9%)

Query: 1   MRCSSYGLIIPGSES-RFLTTTTTPTTNKKPDRFPRIYPTS-VSFGSLKVKAKLNDAAGG 58
           MRC  YGL+IPGSE+ RF  +   P     P+   R+   S +  GS K KA +N   G 
Sbjct: 1   MRC--YGLMIPGSETTRFYQSPLKP----DPNPILRVKTVSRIPIGSFKTKATINAKVGA 54

Query: 59  TATATAVVDESKELSFYDLLGIPESVSLVEIKQAYKQMARKYHPDVSPPDRVEEYTQRFI 118
                    E  ++SFY+LLGI ES +L EIKQAYKQ+ARKYHPDVSPPDRVEEYT+RFI
Sbjct: 55  ---------ELGQMSFYELLGITESGTLPEIKQAYKQLARKYHPDVSPPDRVEEYTRRFI 105

Query: 119 RVQEAYETLSDPGLRALYDRDLSMGLHLAFSARRR---QQNDDFQVRSEWRNRWQSQLSE 175
           RVQEAYETLSDP +R +YDRD++ GLHLAFSARRR   Q +++ + R+EW+NRWQSQLSE
Sbjct: 106 RVQEAYETLSDPRMREIYDRDMAKGLHLAFSARRRYPHQNDEEMEERTEWKNRWQSQLSE 165

Query: 176 LKRRSMNKDAGGNISWAARMRRKRDGLSQEL 206
           LKRRS NK AGG++SWAARMRR+R+GLS++L
Sbjct: 166 LKRRSTNKGAGGSMSWAARMRRQREGLSEDL 196




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|118486703|gb|ABK95188.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224060341|ref|XP_002300151.1| predicted protein [Populus trichocarpa] gi|118487270|gb|ABK95463.1| unknown [Populus trichocarpa] gi|222847409|gb|EEE84956.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255553998|ref|XP_002518039.1| Chaperone protein dnaJ 20, chloroplast precursor, putative [Ricinus communis] gi|223542635|gb|EEF44172.1| Chaperone protein dnaJ 20, chloroplast precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356512453|ref|XP_003524933.1| PREDICTED: chaperone protein dnaJ 20, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|225433479|ref|XP_002264154.1| PREDICTED: chaperone protein dnaJ 20, chloroplastic [Vitis vinifera] gi|147777520|emb|CAN64811.1| hypothetical protein VITISV_024996 [Vitis vinifera] gi|298205225|emb|CBI17284.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|351721851|ref|NP_001235176.1| DnaJ-like protein [Glycine max] gi|146424720|dbj|BAF62127.1| DnaJ-like protein [Glycine max] Back     alignment and taxonomy information
>gi|113374278|gb|ABI34703.1| DnaJ-like protein isoform [Solanum phureja] Back     alignment and taxonomy information
>gi|297804938|ref|XP_002870353.1| hypothetical protein ARALYDRAFT_493532 [Arabidopsis lyrata subsp. lyrata] gi|297316189|gb|EFH46612.1| hypothetical protein ARALYDRAFT_493532 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|6691127|gb|AAF24498.1|AF214107_1 DnaJ-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query206
TAIR|locus:2119465197 J20 "AT4G13830" [Arabidopsis t 0.747 0.781 0.6 7.9e-46
GENEDB_PFALCIPARUM|MAL13P1.162247 MAL13P1.162 "DNAJ-like protein 0.349 0.291 0.465 4.4e-13
UNIPROTKB|C0H5E9247 MAL13P1.162 "DNAJ like protein 0.349 0.291 0.465 4.4e-13
GENEDB_PFALCIPARUM|PFL0565w 244 PFL0565w "heat shock protein D 0.330 0.278 0.434 5.6e-13
UNIPROTKB|Q7KQK3 244 PFL0565w "Heat shock protein D 0.330 0.278 0.434 5.6e-13
ZFIN|ZDB-GENE-040115-3 474 dnaja3b "DnaJ (Hsp40) homolog, 0.514 0.223 0.381 2.5e-12
UNIPROTKB|Q9UBS3223 DNAJB9 "DnaJ homolog subfamily 0.592 0.547 0.302 3.1e-12
SGD|S000005008 409 YDJ1 "Type I HSP40 co-chaperon 0.320 0.161 0.492 3.8e-12
TIGR_CMR|DET_1411 330 DET_1411 "DnaJ family protein" 0.330 0.206 0.442 4.6e-12
WB|WBGene00001034 395 dnj-16 [Caenorhabditis elegans 0.334 0.174 0.452 7.8e-12
TAIR|locus:2119465 J20 "AT4G13830" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 481 (174.4 bits), Expect = 7.9e-46, P = 7.9e-46
 Identities = 99/165 (60%), Positives = 121/165 (73%)

Query:    37 YPTSVSFGSLKVKAKLNDXXXXXXXXXXVVDESKELSFYDLLGIPESVSLVEIKQAYKQM 96
             YPT   F S +++++L             V +S++LSFYDLLG+ ESV+L EIKQAYKQ+
Sbjct:    38 YPTRTRFSSTRIQSRLTHDDP--------VKQSEDLSFYDLLGVTESVTLPEIKQAYKQL 89

Query:    97 ARKYHPDVSPPDRVEEYTQRFIRVQEAYETLSDPGLRALYDRDLSMGLHLAFSARRRQQN 156
             ARKYHPDVSPPDRVEEYT RFIRVQEAYETLSDP  R LYDRDLSMG   +FS RR+ + 
Sbjct:    90 ARKYHPDVSPPDRVEEYTDRFIRVQEAYETLSDPRRRVLYDRDLSMGFSFSFSGRRQNRY 149

Query:   157 DDFQV--RSEWRNRWQSQLSELKRRSMNKDAGGNISWAARMRRKR 199
             D   V  +SEW+ +WQ+QLS L+RRS  KD    +SWAARMRR++
Sbjct:   150 DQEVVEEKSEWKAKWQTQLSGLRRRSNQKD-NNTMSWAARMRRQQ 193




GO:0006457 "protein folding" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
GO:0015996 "chlorophyll catabolic process" evidence=RCA
GENEDB_PFALCIPARUM|MAL13P1.162 MAL13P1.162 "DNAJ-like protein, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|C0H5E9 MAL13P1.162 "DNAJ like protein, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PFL0565w PFL0565w "heat shock protein DNAJ homologue Pfj4" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q7KQK3 PFL0565w "Heat shock protein DNAJ homologue Pfj4" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040115-3 dnaja3b "DnaJ (Hsp40) homolog, subfamily A, member 3B" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UBS3 DNAJB9 "DnaJ homolog subfamily B member 9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
SGD|S000005008 YDJ1 "Type I HSP40 co-chaperone" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
TIGR_CMR|DET_1411 DET_1411 "DnaJ family protein" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
WB|WBGene00001034 dnj-16 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SDN0DNJ20_ARATHNo assigned EC number0.52700.91740.9593yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_Genewise1_v1.C_880038
SubName- Full=Putative uncharacterized protein; (196 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.VI.26.1
annotation not avaliable (325 aa)
       0.504
grail3.0261001401
hypothetical protein (124 aa)
       0.503
eugene3.02610008
hypothetical protein (132 aa)
       0.503
eugene3.00860035
hypothetical protein (705 aa)
       0.502
eugene3.00770061
hypothetical protein (277 aa)
       0.502
eugene3.00130164
hypothetical protein (660 aa)
       0.502
eugene3.00120231
hypothetical protein (668 aa)
       0.502
estExt_fgenesh4_pm.C_LG_I0291
SubName- Full=Putative uncharacterized protein; (666 aa)
       0.502
estExt_fgenesh4_pg.C_1500058
hypothetical protein (706 aa)
       0.502
estExt_Genewise1_v1.C_LG_III0234
hypothetical protein (666 aa)
       0.502

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
pfam0022663 pfam00226, DnaJ, DnaJ domain 2e-22
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 4e-22
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 4e-21
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 3e-19
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 6e-19
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 1e-17
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 4e-17
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 7e-17
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 1e-16
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 2e-16
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 6e-16
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 2e-15
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 6e-15
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 6e-14
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 9e-14
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 1e-13
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 2e-13
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 3e-13
PRK14299 291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 3e-13
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 3e-13
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 5e-13
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 5e-13
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 7e-13
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 1e-12
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 1e-12
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 2e-12
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 2e-12
PRK10266 306 PRK10266, PRK10266, curved DNA-binding protein Cbp 5e-12
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 5e-12
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 3e-11
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 8e-11
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 6e-10
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 9e-10
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 1e-09
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 6e-09
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 3e-08
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 8e-08
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 3e-05
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 6e-05
PRK01356166 PRK01356, hscB, co-chaperone HscB; Provisional 7e-05
COG1076174 COG1076, DjlA, DnaJ-domain-containing proteins 1 [ 2e-04
COG5269 379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 2e-04
PHA02624 647 PHA02624, PHA02624, large T antigen; Provisional 4e-04
PRK03578176 PRK03578, hscB, co-chaperone HscB; Provisional 0.004
PHA03102153 PHA03102, PHA03102, Small T antigen; Reviewed 0.004
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
 Score = 85.7 bits (213), Expect = 2e-22
 Identities = 31/64 (48%), Positives = 44/64 (68%), Gaps = 2/64 (3%)

Query: 74  FYDLLGIPESVSLVEIKQAYKQMARKYHPDVSPPDRVEEYTQRFIRVQEAYETLSDPGLR 133
           +Y++LG+P   S  EIK+AY+++A KYHPD +P D      ++F  + EAYE LSDP  R
Sbjct: 2   YYEILGVPRDASDEEIKKAYRKLALKYHPDKNPGD--PAAEEKFKEINEAYEVLSDPEKR 59

Query: 134 ALYD 137
           A+YD
Sbjct: 60  AIYD 63


DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63

>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|167217 PRK01356, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222912 PHA02624, PHA02624, large T antigen; Provisional Back     alignment and domain information
>gnl|CDD|235133 PRK03578, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|222986 PHA03102, PHA03102, Small T antigen; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 206
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.92
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 99.9
PRK14288 369 chaperone protein DnaJ; Provisional 99.85
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 99.85
PRK14296 372 chaperone protein DnaJ; Provisional 99.84
KOG0716 279 consensus Molecular chaperone (DnaJ superfamily) [ 99.83
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.83
PRK14286 372 chaperone protein DnaJ; Provisional 99.82
PRK14279 392 chaperone protein DnaJ; Provisional 99.82
PRK14282 369 chaperone protein DnaJ; Provisional 99.81
PRK14287 371 chaperone protein DnaJ; Provisional 99.8
PRK14285 365 chaperone protein DnaJ; Provisional 99.8
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.8
PRK14277 386 chaperone protein DnaJ; Provisional 99.8
KOG0719 264 consensus Molecular chaperone (DnaJ superfamily) [ 99.8
PRK14294 366 chaperone protein DnaJ; Provisional 99.8
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.8
PRK14283 378 chaperone protein DnaJ; Provisional 99.8
PRK14298 377 chaperone protein DnaJ; Provisional 99.8
PRK14276 380 chaperone protein DnaJ; Provisional 99.8
PRK14301 373 chaperone protein DnaJ; Provisional 99.79
PRK14297 380 chaperone protein DnaJ; Provisional 99.79
PRK14295 389 chaperone protein DnaJ; Provisional 99.79
PRK14284 391 chaperone protein DnaJ; Provisional 99.79
PRK14291 382 chaperone protein DnaJ; Provisional 99.79
PRK14299 291 chaperone protein DnaJ; Provisional 99.79
PRK14280 376 chaperone protein DnaJ; Provisional 99.79
PRK14281 397 chaperone protein DnaJ; Provisional 99.78
KOG0691 296 consensus Molecular chaperone (DnaJ superfamily) [ 99.78
PRK10767 371 chaperone protein DnaJ; Provisional 99.78
PRK14278 378 chaperone protein DnaJ; Provisional 99.77
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.76
PRK14289 386 chaperone protein DnaJ; Provisional 99.76
PRK14290 365 chaperone protein DnaJ; Provisional 99.76
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.75
PRK14300 372 chaperone protein DnaJ; Provisional 99.75
KOG0715 288 consensus Molecular chaperone (DnaJ superfamily) [ 99.75
PRK05014171 hscB co-chaperone HscB; Provisional 99.74
PRK14292 371 chaperone protein DnaJ; Provisional 99.74
PRK14293 374 chaperone protein DnaJ; Provisional 99.74
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.73
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.72
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.71
PRK01356166 hscB co-chaperone HscB; Provisional 99.7
PRK03578176 hscB co-chaperone HscB; Provisional 99.7
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.69
PRK00294173 hscB co-chaperone HscB; Provisional 99.69
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.66
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.65
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.64
PHA03102153 Small T antigen; Reviewed 99.61
PRK01773173 hscB co-chaperone HscB; Provisional 99.56
KOG0720 490 consensus Molecular chaperone (DnaJ superfamily) [ 99.54
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.5
KOG0714 306 consensus Molecular chaperone (DnaJ superfamily) [ 99.46
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 99.45
KOG0722 329 consensus Molecular chaperone (DnaJ superfamily) [ 99.41
PHA02624 647 large T antigen; Provisional 99.4
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.38
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.35
PTZ00100116 DnaJ chaperone protein; Provisional 99.35
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.29
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 99.22
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 99.0
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.35
KOG0568 342 consensus Molecular chaperone (DnaJ superfamily) [ 98.34
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 98.13
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 97.83
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 97.56
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.92
KOG0431453 consensus Auxilin-like protein and related protein 96.61
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 94.09
PF1344662 RPT: A repeated domain in UCH-protein 90.4
KOG0724 335 consensus Zuotin and related molecular chaperones 86.22
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.92  E-value=1.7e-25  Score=198.07  Aligned_cols=74  Identities=43%  Similarity=0.778  Sum_probs=69.7

Q ss_pred             cccccccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCccHHHHHHHHHHHHHHHHHcCChhHHHHHHHhhhhccc
Q 028609           70 KELSFYDLLGIPESVSLVEIKQAYKQMARKYHPDVSPPDRVEEYTQRFIRVQEAYETLSDPGLRALYDRDLSMGLH  145 (206)
Q Consensus        70 ~~~d~Y~iLgv~~~as~~eIkkaYr~l~~~~HPDk~~~~~~~~a~~~f~~I~~Ay~vLsdp~~R~~YD~~~~~~~~  145 (206)
                      ...|||+||||+++|+.+|||+|||+||++||||+|+..  ++|.++|++|++||+||+||++|+.||+++..++.
T Consensus         2 ~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~--~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~   75 (371)
T COG0484           2 AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGD--KEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFK   75 (371)
T ss_pred             CccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCC--HHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccc
Confidence            357999999999999999999999999999999999964  58899999999999999999999999999998876



>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 7e-11
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 3e-10
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 3e-10
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 4e-10
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 2e-09
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 2e-09
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 2e-09
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 3e-09
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 4e-09
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 5e-09
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 6e-09
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 2e-08
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 3e-08
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 3e-08
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 5e-08
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 1e-07
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 1e-07
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 3e-07
3lz8_A 329 Structure Of A Putative Chaperone Dnaj From Klebsie 4e-07
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 2e-05
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 2e-05
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 3e-05
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 4e-04
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure

Iteration: 1

Score = 63.9 bits (154), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 31/66 (46%), Positives = 47/66 (71%), Gaps = 1/66 (1%) Query: 73 SFYDLLGIPESVSLVEIKQAYKQMARKYHPDVSPPDRVEEYTQRFIRVQEAYETLSDPGL 132 ++Y++LG+ S S +IK+AY+++A ++HPD + PD EE ++F V EAYE LSD Sbjct: 10 NYYEVLGVQASASPEDIKKAYRKLALRWHPDKN-PDNKEEAEKKFKLVSEAYEVLSDSKK 68 Query: 133 RALYDR 138 R+LYDR Sbjct: 69 RSLYDR 74
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 2e-23
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 5e-23
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 7e-22
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 3e-21
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 4e-21
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 6e-21
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 6e-21
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 6e-21
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 8e-21
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 9e-21
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 1e-20
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 2e-20
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 2e-20
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 2e-20
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 3e-20
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 9e-20
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 1e-19
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 2e-19
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 2e-19
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 2e-18
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 2e-18
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 1e-17
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 9e-17
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 2e-16
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 3e-16
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-15
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 6e-15
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 3e-13
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 1e-12
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 4e-10
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 4e-10
2guz_A71 Mitochondrial import inner membrane translocase su 2e-07
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 1e-06
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
 Score = 94.2 bits (235), Expect = 2e-23
 Identities = 30/87 (34%), Positives = 45/87 (51%), Gaps = 3/87 (3%)

Query: 74  FYDLLGIPESVSLVEIKQAYKQMARKYHPDVSPPDRVEEYTQRFIRVQEAYETLSDPGLR 133
           +Y +LG+  +  L  IK AY+++ARKYHPDVS  +  E    +F  + EA+E L D   R
Sbjct: 30  YYAILGVQPTDDLKTIKTAYRRLARKYHPDVSKENDAEA---KFKDLAEAWEVLKDEQRR 86

Query: 134 ALYDRDLSMGLHLAFSARRRQQNDDFQ 160
           A YD+         F  +R+     + 
Sbjct: 87  AEYDQLWQHRNDPGFGRQRQTHEQSYS 113


>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query206
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.88
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.87
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.87
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.87
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.86
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.86
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.86
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.86
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.86
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.86
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.85
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.85
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.85
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.85
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.84
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.84
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.83
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.83
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.83
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.8
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.79
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.79
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.76
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.72
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.72
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.72
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.71
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.71
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.69
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.65
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.65
2guz_A71 Mitochondrial import inner membrane translocase su 99.63
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.62
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.16
2guz_B65 Mitochondrial import inner membrane translocase su 98.87
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 90.85
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
Probab=99.88  E-value=1.7e-22  Score=150.80  Aligned_cols=76  Identities=33%  Similarity=0.612  Sum_probs=69.0

Q ss_pred             cccccccccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCccHHHHHHHHHHHHHHHHHcCChhHHHHHHHhhhhccc
Q 028609           68 ESKELSFYDLLGIPESVSLVEIKQAYKQMARKYHPDVSPPDRVEEYTQRFIRVQEAYETLSDPGLRALYDRDLSMGLH  145 (206)
Q Consensus        68 ~~~~~d~Y~iLgv~~~as~~eIkkaYr~l~~~~HPDk~~~~~~~~a~~~f~~I~~Ay~vLsdp~~R~~YD~~~~~~~~  145 (206)
                      .....|||+||||+++++.++||++|++|++++|||+++..  +++.++|+.|++||+||+||.+|..||.++..|+.
T Consensus        13 ~~~~~~~Y~vLgv~~~as~~eIk~aYr~la~~~HPDk~~~~--~~a~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~~   88 (109)
T 2ctw_A           13 STSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDN--PEAADKFKEINNAHAILTDATKRNIYDKYGSLGLY   88 (109)
T ss_dssp             TSCSCCHHHHHTCCTTCCHHHHHHHHHHHHHHSCTTTSTTC--HHHHHHHHHHHHHHHHHTCHHHHHHHHHTCHHHHH
T ss_pred             CCCCCCHHHHcCcCCCCCHHHHHHHHHHHHHHHCcCCCCCc--HHHHHHHHHHHHHHHHHcCHHHHHHHHHhcccccc
Confidence            34567999999999999999999999999999999999764  46789999999999999999999999999877655



>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 206
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 2e-16
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 1e-15
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 5e-15
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 3e-13
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 9e-13
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 2e-11
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 1e-10
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-08
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK)
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 69.7 bits (170), Expect = 2e-16
 Identities = 22/91 (24%), Positives = 46/91 (50%), Gaps = 4/91 (4%)

Query: 57  GGTATATAVVDESKELSFYDLLGIPESVSLVEIKQAYKQMARKYHPDVSPPDRVE----E 112
           G + ++   ++++ +  +Y +LG   S ++ ++KQ Y+++   YHPD    D       E
Sbjct: 1   GSSGSSGMALEQTLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEE 60

Query: 113 YTQRFIRVQEAYETLSDPGLRALYDRDLSMG 143
             Q+FI + +A++ L +   +  YD   S  
Sbjct: 61  CMQKFIEIDQAWKILGNEETKKKYDLQRSGP 91


>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query206
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.91
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.86
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.81
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.78
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.73
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.67
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.66
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]
Probab=99.91  E-value=5.4e-25  Score=152.44  Aligned_cols=72  Identities=38%  Similarity=0.684  Sum_probs=66.1

Q ss_pred             ccccccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCccHHHHHHHHHHHHHHHHHcCChhHHHHHHHhhhhcc
Q 028609           71 ELSFYDLLGIPESVSLVEIKQAYKQMARKYHPDVSPPDRVEEYTQRFIRVQEAYETLSDPGLRALYDRDLSMGL  144 (206)
Q Consensus        71 ~~d~Y~iLgv~~~as~~eIkkaYr~l~~~~HPDk~~~~~~~~a~~~f~~I~~Ay~vLsdp~~R~~YD~~~~~~~  144 (206)
                      ..|||+||||+++|+.++||+||+++++++|||+++.+.  .+.+.|..|++||+||+||.+|..||.+|..++
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~--~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~   73 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDK--EAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAF   73 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTC--HHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSSC
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCCh--HHHHHHHHHHHHHHhcCCHHHHHHHHHhCcccc
Confidence            469999999999999999999999999999999987653  566789999999999999999999999987665



>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure