Citrus Sinensis ID: 028697
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 205 | ||||||
| 255558466 | 373 | F-box/LRR-repeat protein, putative [Rici | 0.990 | 0.544 | 0.828 | 2e-90 | |
| 224082382 | 363 | predicted protein [Populus trichocarpa] | 0.941 | 0.531 | 0.779 | 9e-83 | |
| 449453019 | 376 | PREDICTED: F-box protein SKP2A-like [Cuc | 0.990 | 0.539 | 0.763 | 8e-81 | |
| 363807426 | 371 | uncharacterized protein LOC100793275 [Gl | 0.990 | 0.547 | 0.730 | 2e-79 | |
| 356546950 | 375 | PREDICTED: F-box protein SKP2B-like isof | 0.990 | 0.541 | 0.710 | 2e-78 | |
| 302142727 | 428 | unnamed protein product [Vitis vinifera] | 0.970 | 0.464 | 0.746 | 7e-78 | |
| 359492292 | 370 | PREDICTED: F-box protein SKP2B-like [Vit | 0.970 | 0.537 | 0.746 | 8e-78 | |
| 356515961 | 372 | PREDICTED: F-box protein SKP2A-like [Gly | 0.990 | 0.545 | 0.715 | 8e-78 | |
| 224066761 | 358 | predicted protein [Populus trichocarpa] | 0.834 | 0.477 | 0.837 | 1e-76 | |
| 217073061 | 368 | unknown [Medicago truncatula] | 0.975 | 0.543 | 0.715 | 2e-76 |
| >gi|255558466|ref|XP_002520258.1| F-box/LRR-repeat protein, putative [Ricinus communis] gi|223540477|gb|EEF42044.1| F-box/LRR-repeat protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 337 bits (864), Expect = 2e-90, Method: Compositional matrix adjust.
Identities = 169/204 (82%), Positives = 181/204 (88%), Gaps = 1/204 (0%)
Query: 1 MVGEATNLSSEDLNLCFEKMMMAGAGADRAGGVKMDGVVITEWKDIPMELLLRILSLVDE 60
MVG L SEDLN CFEK+MMAGA + G VKM+GVVITEWKDIPMELLLRI+SLVD+
Sbjct: 1 MVG-GGKLRSEDLNRCFEKLMMAGAAGNTEGRVKMEGVVITEWKDIPMELLLRIVSLVDD 59
Query: 61 PTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLE 120
T+I+ASGVCSGWRDAICLGLTHL LSWCKN+MNNLVL LAPK TKL+TLVLRQDKPQLE
Sbjct: 60 RTIIMASGVCSGWRDAICLGLTHLCLSWCKNHMNNLVLWLAPKFTKLETLVLRQDKPQLE 119
Query: 121 DNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLC 180
DNAVEAIA CHDL+DLDLSKSFKL+D SLYALAHGCPNLT+LNISGCTSFSD L YL
Sbjct: 120 DNAVEAIARYCHDLEDLDLSKSFKLTDCSLYALAHGCPNLTKLNISGCTSFSDGGLEYLT 179
Query: 181 GFCRKLKILNLCGCVKAATDYALQ 204
GFCRKLKILNLCGCVKAATD ALQ
Sbjct: 180 GFCRKLKILNLCGCVKAATDRALQ 203
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224082382|ref|XP_002306672.1| predicted protein [Populus trichocarpa] gi|222856121|gb|EEE93668.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449453019|ref|XP_004144256.1| PREDICTED: F-box protein SKP2A-like [Cucumis sativus] gi|449517068|ref|XP_004165568.1| PREDICTED: F-box protein SKP2A-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|363807426|ref|NP_001242641.1| uncharacterized protein LOC100793275 [Glycine max] gi|255644880|gb|ACU22940.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356546950|ref|XP_003541882.1| PREDICTED: F-box protein SKP2B-like isoform 1 [Glycine max] gi|356546952|ref|XP_003541883.1| PREDICTED: F-box protein SKP2B-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|302142727|emb|CBI19930.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359492292|ref|XP_002268441.2| PREDICTED: F-box protein SKP2B-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356515961|ref|XP_003526665.1| PREDICTED: F-box protein SKP2A-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224066761|ref|XP_002302202.1| predicted protein [Populus trichocarpa] gi|222843928|gb|EEE81475.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|217073061|gb|ACJ84890.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 205 | ||||||
| TAIR|locus:2027082 | 360 | SKP2A [Arabidopsis thaliana (t | 0.839 | 0.477 | 0.779 | 7.7e-71 | |
| TAIR|locus:2025222 | 360 | SKP2B "AT1G77000" [Arabidopsis | 0.921 | 0.525 | 0.691 | 3.3e-70 | |
| UNIPROTKB|F1NHD2 | 423 | FBXL2 "Uncharacterized protein | 0.565 | 0.274 | 0.367 | 2.7e-14 | |
| UNIPROTKB|A6H779 | 423 | FBXL2 "F-box/LRR-repeat protei | 0.565 | 0.274 | 0.376 | 4.4e-14 | |
| UNIPROTKB|F1PWK1 | 422 | FBXL2 "Uncharacterized protein | 0.565 | 0.274 | 0.341 | 2.6e-13 | |
| UNIPROTKB|Q9UKC9 | 423 | FBXL2 "F-box/LRR-repeat protei | 0.565 | 0.274 | 0.341 | 5.5e-13 | |
| UNIPROTKB|Q5R3Z8 | 423 | FBXL2 "F-box/LRR-repeat protei | 0.565 | 0.274 | 0.341 | 5.5e-13 | |
| RGD|1562243 | 422 | Fbxl2 "F-box and leucine-rich | 0.565 | 0.274 | 0.333 | 1.2e-12 | |
| MGI|MGI:1919429 | 423 | Fbxl2 "F-box and leucine-rich | 0.565 | 0.274 | 0.333 | 1.2e-12 | |
| WB|WBGene00015350 | 466 | C02F5.7 [Caenorhabditis elegan | 0.565 | 0.248 | 0.322 | 3.7e-11 |
| TAIR|locus:2027082 SKP2A [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 717 (257.5 bits), Expect = 7.7e-71, P = 7.7e-71
Identities = 134/172 (77%), Positives = 152/172 (88%)
Query: 33 VKMDGVVITEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNN 92
+KM+G+ I EWKDIP+ELL+RILSLVD+ VIVASGVC+GWRDAI GLT L LSWC NN
Sbjct: 18 MKMEGISIKEWKDIPVELLMRILSLVDDRNVIVASGVCTGWRDAISFGLTRLRLSWCNNN 77
Query: 93 MNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYA 152
MN+LVLSL PK KLQTL LRQDKPQLEDNAVEAIAN CH+LQ+LDLSKS K++DRSLYA
Sbjct: 78 MNSLVLSLVPKFVKLQTLNLRQDKPQLEDNAVEAIANHCHELQELDLSKSLKITDRSLYA 137
Query: 153 LAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQ 204
LAHGCP+LT+LN+SGCTSFSD A+AYL FCRKLK+LNLCGCVKA TD AL+
Sbjct: 138 LAHGCPDLTKLNLSGCTSFSDTAIAYLTRFCRKLKVLNLCGCVKAVTDNALE 189
|
|
| TAIR|locus:2025222 SKP2B "AT1G77000" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NHD2 FBXL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6H779 FBXL2 "F-box/LRR-repeat protein 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PWK1 FBXL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UKC9 FBXL2 "F-box/LRR-repeat protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R3Z8 FBXL2 "F-box/LRR-repeat protein 2" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| RGD|1562243 Fbxl2 "F-box and leucine-rich repeat protein 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919429 Fbxl2 "F-box and leucine-rich repeat protein 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00015350 C02F5.7 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 205 | |||
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 7e-10 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 4e-09 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 1e-08 | |
| smart00367 | 26 | smart00367, LRR_CC, Leucine-rich repeat - CC (cyst | 8e-04 | |
| pfam12937 | 47 | pfam12937, F-box-like, F-box-like | 8e-04 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
Score = 56.2 bits (136), Expect = 7e-10
Identities = 36/118 (30%), Positives = 55/118 (46%), Gaps = 6/118 (5%)
Query: 80 GLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDL 139
GL L L C + + L KL+ L+L K ++D + A+A SC +LQ LDL
Sbjct: 29 GLEWLELYMCPIS--DPPLDQLSNCNKLKKLILPGSK-LIDDEGLIALAQSCPNLQVLDL 85
Query: 140 SKSFKLSDRSLYALAHGCPNLTRLNIS---GCTSFSDHALAYLCGFCRKLKILNLCGC 194
++D + ALA CP L +N+ +D +L+ L C L+ + GC
Sbjct: 86 RACENITDSGIVALATNCPKLQTINLGRHRNGHLITDVSLSALGKNCTFLQTVGFAGC 143
|
Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|197685 smart00367, LRR_CC, Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|221867 pfam12937, F-box-like, F-box-like | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 205 | |||
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.84 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.77 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.66 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.29 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.19 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 99.0 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.83 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.82 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.76 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 98.58 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 98.52 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.41 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.41 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.1 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.08 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 97.99 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 97.97 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.85 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.81 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.79 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 97.71 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.42 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 97.3 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.24 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.18 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 96.95 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 96.87 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 96.76 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 96.74 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 96.6 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 96.38 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.34 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 96.01 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 95.96 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 95.94 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 95.82 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 95.66 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 95.42 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 95.2 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 95.13 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 95.1 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 95.08 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 94.99 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 94.99 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 94.82 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 94.78 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 94.73 | |
| PF13013 | 109 | F-box-like_2: F-box-like domain | 94.53 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 94.41 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 93.92 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 93.33 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 92.6 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 92.33 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 92.21 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 90.51 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 90.39 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 89.74 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 89.62 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 89.22 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 88.06 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 87.66 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 86.99 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 86.65 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 86.05 | |
| PF09372 | 97 | PRANC: PRANC domain; InterPro: IPR018272 This pres | 85.82 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 85.48 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 85.0 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 84.42 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 84.24 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 82.27 |
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.84 E-value=9.8e-22 Score=156.38 Aligned_cols=159 Identities=30% Similarity=0.515 Sum_probs=138.6
Q ss_pred CCCCCHHHHHHHHhcCChhHHHHhhccchhhHHhh----cC--------------------------CCceEecCCCCCC
Q 028697 43 WKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAI----CL--------------------------GLTHLSLSWCKNN 92 (205)
Q Consensus 43 ~~~Lp~e~l~~If~~l~~~~l~~~~~vck~w~~~~----~~--------------------------~l~~L~l~~~~~~ 92 (205)
--.||.|++..||++|+...+++++.+|+.|...+ +| .++.+.+++|..+
T Consensus 72 ~~~LPpEl~lkvFS~LDtksl~r~a~~c~~~n~~AlD~~~~q~idL~t~~rDv~g~VV~~~~~Rcgg~lk~LSlrG~r~v 151 (483)
T KOG4341|consen 72 SRSLPPELLLKVFSMLDTKSLCRAAQCCTMWNKLALDGSCWQHIDLFTFQRDVDGGVVENMISRCGGFLKELSLRGCRAV 151 (483)
T ss_pred cccCCHHHHHHHHHHHhHHHHHHHHHHHHHhhhhhhccccceeeehhcchhcCCCcceehHhhhhccccccccccccccC
Confidence 35699999999999999999999999999999875 22 3678888888888
Q ss_pred CHHHHHHHHhcCCCccEEEecCCCCCCCHHHHHHHHhcCcccceeeccCCCCCCHHHHHHHHhcCCCCCEEeecCCCCCC
Q 028697 93 MNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFS 172 (205)
Q Consensus 93 ~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~l~~l~~~~~~L~~L~l~~~~~l~~~~~~~l~~~~~~L~~L~l~~~~~it 172 (205)
.+..+..+...|||+++|.+.+| ..++|..+..+++.|++|+.|++..|..+|+..++.+.+.|++|++++++.|+.|+
T Consensus 152 ~~sslrt~~~~CpnIehL~l~gc-~~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~la~gC~kL~~lNlSwc~qi~ 230 (483)
T KOG4341|consen 152 GDSSLRTFASNCPNIEHLALYGC-KKITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYLAEGCRKLKYLNLSWCPQIS 230 (483)
T ss_pred CcchhhHHhhhCCchhhhhhhcc-eeccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHHHHhhhhHHHhhhccCchhh
Confidence 88888889999999999999888 58999999999999999999999998889999999899999999999999999999
Q ss_pred HHHHHHHHhcCCCCCeEeccCCccccccccc
Q 028697 173 DHALAYLCGFCRKLKILNLCGCVKAATDYAL 203 (205)
Q Consensus 173 ~~~l~~l~~~~~~L~~L~l~~c~~~~~d~~~ 203 (205)
..+++.+.++|++++.+..+||.. .+++++
T Consensus 231 ~~gv~~~~rG~~~l~~~~~kGC~e-~~le~l 260 (483)
T KOG4341|consen 231 GNGVQALQRGCKELEKLSLKGCLE-LELEAL 260 (483)
T ss_pred cCcchHHhccchhhhhhhhccccc-ccHHHH
Confidence 988999998888888888888876 666654
|
|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF13013 F-box-like_2: F-box-like domain | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF09372 PRANC: PRANC domain; InterPro: IPR018272 This presumed domain is found at the C terminus of a variety of Pox virus proteins | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 205 | ||||
| 1fs2_A | 272 | Insights Into Scf Ubiquitin Ligases From The Struct | 5e-09 | ||
| 1fqv_A | 336 | Insights Into Scf Ubiquitin Ligases From The Struct | 3e-08 | ||
| 2p1m_B | 594 | Tir1-ask1 Complex Structure Length = 594 | 4e-04 |
| >pdb|1FS2|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 272 | Back alignment and structure |
|
| >pdb|1FQV|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 336 | Back alignment and structure |
| >pdb|2P1M|B Chain B, Tir1-ask1 Complex Structure Length = 594 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 205 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 2e-28 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 9e-22 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 2e-07 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 6e-24 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 2e-16 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-15 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-15 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 4e-14 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-13 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 9e-07 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-19 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-14 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-14 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-14 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 3e-13 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 8e-13 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 3e-12 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 7e-12 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 4e-11 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 4e-13 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 5e-10 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 4e-08 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 7e-07 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 4e-06 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 3e-04 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 9e-06 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-05 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 5e-05 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 2e-04 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 5e-05 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 7e-05 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 2e-04 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 2e-04 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-04 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 8e-04 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-04 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 4e-04 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 4e-04 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 9e-04 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 4e-04 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 4e-04 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 5e-04 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 5e-04 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 8e-04 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
Score = 107 bits (269), Expect = 2e-28
Identities = 49/176 (27%), Positives = 71/176 (40%), Gaps = 22/176 (12%)
Query: 41 TEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMN------ 94
W +P ELLL I S + P ++ SGVC W +L N++
Sbjct: 7 VSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGR 66
Query: 95 --------------NLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLS 140
+ LA + + + +E + + I + C LQ+L L
Sbjct: 67 LLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLE 126
Query: 141 KSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVK 196
+LSD + LA NL RLN+SGC+ FS+ AL L C +L LNL C
Sbjct: 127 -GLRLSDPIVNTLAK-NSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFD 180
|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 205 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.88 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.82 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.75 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.66 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.6 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.41 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.35 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.33 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.13 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 99.12 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.06 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.97 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 98.95 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.94 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.93 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.89 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.88 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.71 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.63 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.61 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.57 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.51 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.5 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.46 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.36 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.34 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.33 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.22 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.13 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 98.1 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 98.09 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.04 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.03 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.85 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.8 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.77 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.77 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 97.76 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.75 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.74 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.74 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 97.72 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.7 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 97.69 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.67 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.67 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.63 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.58 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 97.55 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.52 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 97.49 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 97.49 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.48 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.48 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.46 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 97.43 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 97.42 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 97.42 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.4 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.38 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 97.37 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.37 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.34 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 97.34 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.3 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 97.29 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.29 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.29 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.28 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.28 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.27 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.27 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.27 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.26 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.26 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.23 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.23 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.22 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.21 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.18 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.17 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.16 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.16 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.16 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.15 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.15 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.13 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.13 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.11 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.11 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.11 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.11 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.1 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.09 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.09 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.08 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.06 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.05 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.03 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.03 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.0 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 96.97 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 96.96 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 96.95 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 96.95 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 96.94 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 96.93 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 96.93 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 96.9 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 96.89 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 96.89 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 96.87 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 96.87 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 96.85 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 96.85 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 96.85 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 96.85 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 96.83 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 96.82 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 96.8 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 96.69 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 96.68 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 96.67 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 96.67 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 96.66 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 96.64 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 96.63 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 96.61 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 96.58 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 96.58 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 96.55 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 96.54 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 96.47 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 96.26 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 96.26 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 96.26 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 96.22 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 96.04 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 96.01 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 96.01 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 95.98 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 95.94 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 95.88 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 95.82 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 95.74 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 95.27 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 94.73 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 94.61 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 94.29 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 93.68 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 93.58 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 93.3 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 92.99 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 90.27 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 89.54 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 85.68 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 84.93 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 82.62 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 81.3 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 80.46 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
Probab=99.88 E-value=1.2e-21 Score=156.51 Aligned_cols=153 Identities=29% Similarity=0.442 Sum_probs=113.1
Q ss_pred CCCCCCCCCHHHHHHHHhcCChhHHHHhhccchhhHHhhc----------------------------------------
Q 028697 39 VITEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAIC---------------------------------------- 78 (205)
Q Consensus 39 ~~~~~~~Lp~e~l~~If~~l~~~~l~~~~~vck~w~~~~~---------------------------------------- 78 (205)
+...|.+||+|++.+||+|++..++.+++.|||+|++++.
T Consensus 5 ~~~~~~~LP~eil~~If~~L~~~d~~~~~~vc~~W~~~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~l~~L~l~~n~l~~ 84 (336)
T 2ast_B 5 PGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQ 84 (336)
T ss_dssp --CCSSSSCHHHHHHHHTTSCHHHHHHTTSSCHHHHHHHTCSTTSSEEECTTCBCCHHHHHHHHHTTCSEEECTTCEECS
T ss_pred ccCChhhCCHHHHHHHHHhCCHHHHHHHHHHHHHHHHHhcCchhheeeccccccCCHHHHHhhhhccceEEEcCCccccc
Confidence 4578999999999999999999999999999999999842
Q ss_pred --------CCCceEecCCCCCCCHHHHHHHHhcCCCccEEEecCCCCCCCHHHHHHHHhcCcccceeeccCCCCCCHHHH
Q 028697 79 --------LGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSL 150 (205)
Q Consensus 79 --------~~l~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~l~~l~~~~~~L~~L~l~~~~~l~~~~~ 150 (205)
.++++|+++++. ++...+......+++|++|++++| .+++.....+.. +++|+.|++++|..+++.++
T Consensus 85 ~~~~~~~~~~L~~L~L~~~~-l~~~~~~~~~~~~~~L~~L~L~~~--~l~~~~~~~l~~-~~~L~~L~L~~~~~l~~~~l 160 (336)
T 2ast_B 85 PLAEHFSPFRVQHMDLSNSV-IEVSTLHGILSQCSKLQNLSLEGL--RLSDPIVNTLAK-NSNLVRLNLSGCSGFSEFAL 160 (336)
T ss_dssp CCCSCCCCBCCCEEECTTCE-ECHHHHHHHHTTBCCCSEEECTTC--BCCHHHHHHHTT-CTTCSEEECTTCBSCCHHHH
T ss_pred cchhhccCCCCCEEEccCCC-cCHHHHHHHHhhCCCCCEEeCcCc--ccCHHHHHHHhc-CCCCCEEECCCCCCCCHHHH
Confidence 134555555543 455556667777888888888876 577666666654 77777777777666777777
Q ss_pred HHHHhcCCCCCEEeecCCCCCCHHHHHHHHhcCC-CCCeEeccCCc
Q 028697 151 YALAHGCPNLTRLNISGCTSFSDHALAYLCGFCR-KLKILNLCGCV 195 (205)
Q Consensus 151 ~~l~~~~~~L~~L~l~~~~~it~~~l~~l~~~~~-~L~~L~l~~c~ 195 (205)
..+...+++|++|++++|..+++.++..+...++ +|++|++++|.
T Consensus 161 ~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~~L~~L~l~~~~ 206 (336)
T 2ast_B 161 QTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYR 206 (336)
T ss_dssp HHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCG
T ss_pred HHHHhcCCCCCEEcCCCCCCcChHHHHHHHHhcccCCCEEEeCCCc
Confidence 6666677777777777766677766666666677 77777777774
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 205 | ||||
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 3e-05 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 6e-04 | |
| d1fs1a1 | 41 | a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ | 9e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-04 | |
| d2ovrb1 | 102 | a.158.1.1 (B:2263-2364) F-box/WD repeat-containing | 0.004 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 41.2 bits (95), Expect = 3e-05
Identities = 27/113 (23%), Positives = 43/113 (38%), Gaps = 10/113 (8%)
Query: 82 THLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSK 141
L L+ NL + +L + R + ++ E S +Q +DLS
Sbjct: 3 QTLDLTG-----KNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHF--SPFRVQHMDLSN 55
Query: 142 SFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGC 194
S + +L+ + C L L++ G SD + L L LNL GC
Sbjct: 56 S-VIEVSTLHGILSQCSKLQNLSLEGL-RLSDPIVNTLAK-NSNLVRLNLSGC 105
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 205 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.7 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.68 | |
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 99.24 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.09 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.94 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.88 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.88 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.84 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.79 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.74 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 98.66 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.64 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.61 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.29 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.9 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.86 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.44 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.42 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.41 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.36 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.3 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.29 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.21 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.09 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 96.96 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 96.8 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 96.75 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 96.73 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 96.68 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 96.43 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 96.32 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 95.85 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 95.63 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 94.52 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 94.45 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 94.43 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 94.35 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 94.23 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 93.65 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 93.58 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 92.31 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 90.81 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 90.5 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 90.23 | |
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 88.38 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 83.79 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.70 E-value=8.2e-17 Score=124.37 Aligned_cols=157 Identities=21% Similarity=0.218 Sum_probs=125.0
Q ss_pred CCCHHHHHHHHhcC-ChhHH--HHhhccchhhHHh-hcCCCceEecCCCCCCCHHHHHHHHhcCCCccEEEecCCCCCCC
Q 028697 45 DIPMELLLRILSLV-DEPTV--IVASGVCSGWRDA-ICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLE 120 (205)
Q Consensus 45 ~Lp~e~l~~If~~l-~~~~l--~~~~~vck~w~~~-~~~~l~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~ 120 (205)
.+.++.+..++.++ ..+.+ ..+.........+ -+++|++|++++|..+++..+..++..|++|++|++++| ..++
T Consensus 57 ~i~~~~l~~l~~~c~~L~~L~L~~~~l~~~~~~~l~~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~~L~ls~c-~~~~ 135 (284)
T d2astb2 57 VIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWC-FDFT 135 (284)
T ss_dssp EECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHHHTTCTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCCC-TTCC
T ss_pred ccCHHHHHHHHHhCCCcccccccccCCCcHHHHHHhcCCCCcCccccccccccccccchhhHHHHhccccccccc-cccc
Confidence 36778888888876 33322 1222222222333 257899999999988999999999999999999999997 5788
Q ss_pred HHHHHH-HHhcCcccceeeccCC-CCCCHHHHHHHHhcCCCCCEEeecCCCCCCHHHHHHHHhcCCCCCeEeccCCcccc
Q 028697 121 DNAVEA-IANSCHDLQDLDLSKS-FKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAA 198 (205)
Q Consensus 121 ~~~l~~-l~~~~~~L~~L~l~~~-~~l~~~~~~~l~~~~~~L~~L~l~~~~~it~~~l~~l~~~~~~L~~L~l~~c~~~~ 198 (205)
+..+.. +...+++|+.|+++++ ..+++.++..+...||+|++|++++|..+++.++..+. .|++|++|++++|.+ +
T Consensus 136 ~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~-~~~~L~~L~L~~C~~-i 213 (284)
T d2astb2 136 EKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFF-QLNYLQHLSLSRCYD-I 213 (284)
T ss_dssp HHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGG-GCTTCCEEECTTCTT-C
T ss_pred cccchhhhcccccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhhc-ccCcCCEEECCCCCC-C
Confidence 877755 5556789999999986 46899999999999999999999999899999988887 689999999999988 8
Q ss_pred cccccc
Q 028697 199 TDYALQ 204 (205)
Q Consensus 199 ~d~~~~ 204 (205)
+|.++.
T Consensus 214 ~~~~l~ 219 (284)
T d2astb2 214 IPETLL 219 (284)
T ss_dssp CGGGGG
T ss_pred ChHHHH
Confidence 888764
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|