Citrus Sinensis ID: 028744

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MATKEYVTQAFQEFQAVPFATSIALGTLSVFFFLFFIRGFISRQRMELAVNLPPVPEVPGRLPLIGNLLQLKEKKPHMTFTRWAEMYGPIYSIKTGASSMIVLNSADVAKEKQWENPEEWQPERFLDGQNDPADLYKTMAFGAGKRVCAGSLQASLIACTAIGRLVQEFKWNLREGEEESVDTVGLTTHKLNPFHAIIRPRPRN
ccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHcccccccccccccHHHHHccEEEEEEccccEEEEEEEEEEccccccccccccccccccccccccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEEcccc
cccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHccHccHHccHHHHHHHHHHHHccccccccccccccEEEEccEEccccccEEEEEEEEEEccccccccHHHccHHHHccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEccccEEEEEcccccc
MATKEYVTQAFQEfqavpfatsialGTLSVFFFLFFIRGFISRQRMELavnlppvpevpgrlplignllqlkekkphmtFTRWAemygpiysiktgassMIVLNSAdvakekqwenpeewqperfldgqndpadlyktmafgagkrVCAGSLQASLIACTAIGRLVQEFKWNlregeeesvdtvgltthklnpfhaiirprprn
MATKEYVTQAFQEFQAVPFATSIALGTLSVFFFLFFIRGFISRQRMELAVNLPPVPEVPGRLPLIGNLLQLKEKKPHMTFTRWAEMYGPIYSIKTGASSMIVLNSADVAKEKQWENPEEWQPERFLDGQNDPADLYKTMAFGAGKRVCAGSLQASLIACTAIGRLVQEFKWNLREGEEESvdtvgltthklnpfhaiirprprn
MATKEYVTQAFQEFQAVPFATSIALgtlsvffflffirgfisrQRMELAVNLPPVPEVPGRLPLIGNLLQLKEKKPHMTFTRWAEMYGPIYSIKTGASSMIVLNSADVAKEKQWENPEEWQPERFLDGQNDPADLYKTMAFGAGKRVCAGSLQASLIACTAIGRLVQEFKWNLREGEEESVDTVGLTTHKLNPFHAIIRPRPRN
*****YVTQAFQEFQAVPFATSIALGTLSVFFFLFFIRGFISRQRMELAVNLPPVPEVPGRLPLIGNLLQLKEKKPHMTFTRWAEMYGPIYSIKTGASSMIVLNSADVA**********************PADLYKTMAFGAGKRVCAGSLQASLIACTAIGRLVQEFKWNLREGEEESVDTVGLTTHKLNPFHAII******
********QAFQEFQAVPFATSIALGTLSVFFFLFFIRGFISRQRM*****LPPVPEVPGRLPLIGNLLQLKEKKPHMTFTRWAEMYGPIYSIKTGASSMIVLNSADVAKEKQWENPEEWQPERFLDGQNDPADLYKTMAFGAGKRVCAGSLQASLIACTAIGRLVQEFKWNLREGEEESVDTVGLTTHKLNPFHAIIRPRP**
MATKEYVTQAFQEFQAVPFATSIALGTLSVFFFLFFIRGFISRQRMELAVNLPPVPEVPGRLPLIGNLLQLKEKKPHMTFTRWAEMYGPIYSIKTGASSMIVLNSADVAKEKQWENPEEWQPERFLDGQNDPADLYKTMAFGAGKRVCAGSLQASLIACTAIGRLVQEFKWNLREGEEESVDTVGLTTHKLNPFHAIIRPRPRN
*ATKEYVTQAFQEFQAVPFATSIALGTLSVFFFLFFIRGFISRQRMELAVNLPPVPEVPGRLPLIGNLLQLKEKKPHMTFTRWAEMYGPIYSIKTGASSMIVLNSADVAKEKQWENPEEWQPERFLDGQNDPADLYKTMAFGAGKRVCAGSLQASLIACTAIGRLVQEFKWNLREGEEESVDTVGLTTHKLNPFHAIIRP****
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATKEYVTQAFQEFQAVPFATSIALGTLSVFFFLFFIRGFISRQRMELAVNLPPVPEVPGRLPLIGNLLQLKEKKPHMTFTRWAEMYGPIYSIKTGASSMIVLNSADVAKEKQWENPEEWQPERFLDGQNDPADLYKTMAFGAGKRVCAGSLQASLIACTAIGRLVQEFKWNLREGEEESVDTVGLTTHKLNPFHAIIRPRPRN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query204 2.2.26 [Sep-21-2011]
Q93ZB2509 Ent-kaurene oxidase, chlo yes no 0.539 0.216 0.616 4e-33
O65790500 Cytochrome P450 81F1 OS=A no no 0.563 0.23 0.327 1e-14
Q9LJY7510 Cytochrome P450 705A20 OS no no 0.691 0.276 0.350 8e-13
O48956512 Cytochrome P450 98A1 OS=S N/A no 0.534 0.212 0.376 2e-12
P37118505 Cytochrome P450 71A2 OS=S N/A no 0.509 0.205 0.363 5e-12
Q947B7493 (+)-menthofuran synthase N/A no 0.578 0.239 0.343 4e-11
Q96581516 Flavonoid 3',5'-hydroxyla N/A no 0.426 0.168 0.408 8e-11
P48418506 Flavonoid 3',5'-hydroxyla N/A no 0.431 0.173 0.382 1e-10
O64636512 Cytochrome P450 76C1 OS=A no no 0.568 0.226 0.327 2e-10
P48419508 Flavonoid 3',5'-hydroxyla N/A no 0.431 0.173 0.382 2e-10
>sp|Q93ZB2|KO1_ARATH Ent-kaurene oxidase, chloroplastic OS=Arabidopsis thaliana GN=KO1 PE=1 SV=2 Back     alignment and function desciption
 Score =  140 bits (354), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 69/112 (61%), Positives = 86/112 (76%), Gaps = 2/112 (1%)

Query: 91  YSIKTGASSMIVLNSADVAKEKQWENPEEWQPERFLD-GQNDPADLYKTMAFGAGKRVCA 149
           Y +  G+   I +   ++ K K+WE PE+W PERFLD G+ + +DL+KTMAFGAGKRVCA
Sbjct: 397 YHVPAGSEIAINIYGCNMDK-KRWERPEDWWPERFLDDGKYETSDLHKTMAFGAGKRVCA 455

Query: 150 GSLQASLIACTAIGRLVQEFKWNLREGEEESVDTVGLTTHKLNPFHAIIRPR 201
           G+LQASL+A  AIGRLVQEF+W LR+GEEE+VDT GLT+ KL P  AII PR
Sbjct: 456 GALQASLMAGIAIGRLVQEFEWKLRDGEEENVDTYGLTSQKLYPLMAIINPR 507
Catalyzes three successive oxidations of the 4-methyl group of ent-kaurene giving kaurenoic acid, a key step in gibberellins (GAs) biosynthesis. GAs, which are involved many processes, including stem elongation, play a central role in plant development.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: 7EC: 8
>sp|O65790|C81F1_ARATH Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 Back     alignment and function description
>sp|Q9LJY7|C75AK_ARATH Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=1 SV=1 Back     alignment and function description
>sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 Back     alignment and function description
>sp|P37118|C71A2_SOLME Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 Back     alignment and function description
>sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 Back     alignment and function description
>sp|Q96581|C75A4_GENTR Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1 Back     alignment and function description
>sp|P48418|C75A1_PETHY Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 Back     alignment and function description
>sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 Back     alignment and function description
>sp|P48419|C75A3_PETHY Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
339765718 514 ent-kaurene oxidase [Pyrus communis] 0.539 0.214 0.684 5e-39
29468361269 ent-kaurene oxidase [Prunus persica] 0.514 0.390 0.716 6e-38
46811123 511 ent-kaurene oxidase [Fragaria grandiflor 0.539 0.215 0.657 2e-36
293792354 515 ent-kaurene oxidase [Pyrus pyrifolia] 0.539 0.213 0.657 3e-36
333394169 514 ent-kaurene oxidase [Castanea mollissima 0.539 0.214 0.630 3e-36
29468363269 ent-kaurene oxidase [Fragaria grandiflor 0.539 0.408 0.648 2e-35
289623205 565 ent-kaurene oxidase [Malus x domestica] 0.539 0.194 0.648 3e-35
449446957 519 PREDICTED: ent-kaurene oxidase, chloropl 0.539 0.211 0.603 4e-35
388509342 502 unknown [Medicago truncatula] 0.544 0.221 0.605 4e-34
358346435 502 Ent-kaurene oxidase [Medicago truncatula 0.544 0.221 0.605 4e-34
>gi|339765718|gb|AEK01241.1| ent-kaurene oxidase [Pyrus communis] Back     alignment and taxonomy information
 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 89/111 (80%), Gaps = 1/111 (0%)

Query: 91  YSIKTGASSMIVLNSADVAKEKQWENPEEWQPERFLDGQNDPADLYKTMAFGAGKRVCAG 150
           Y +  G    I +   ++ K  QWE+PEEW+PERFLD + DP DLYKTMAFG GKRVCAG
Sbjct: 404 YYVPVGTEIAINIYGCNMDK-NQWESPEEWKPERFLDPKYDPMDLYKTMAFGTGKRVCAG 462

Query: 151 SLQASLIACTAIGRLVQEFKWNLREGEEESVDTVGLTTHKLNPFHAIIRPR 201
           SLQA LIACT IGRLVQEF+W LR+GEEE+VDTVGLTTHKL+P HAI++PR
Sbjct: 463 SLQAMLIACTTIGRLVQEFEWKLRDGEEENVDTVGLTTHKLHPMHAILKPR 513

Source: Pyrus communis

Species: Pyrus communis

Genus: Pyrus

Family: Rosaceae

Order: Rosales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|29468361|gb|AAO85520.1| ent-kaurene oxidase [Prunus persica] Back     alignment and taxonomy information
>gi|46811123|gb|AAR18407.2| ent-kaurene oxidase [Fragaria grandiflora] Back     alignment and taxonomy information
>gi|293792354|gb|ADE61678.1| ent-kaurene oxidase [Pyrus pyrifolia] Back     alignment and taxonomy information
>gi|333394169|gb|AEF32084.1| ent-kaurene oxidase [Castanea mollissima] Back     alignment and taxonomy information
>gi|29468363|gb|AAO85521.1| ent-kaurene oxidase [Fragaria grandiflora] Back     alignment and taxonomy information
>gi|289623205|gb|AAS68017.2| ent-kaurene oxidase [Malus x domestica] Back     alignment and taxonomy information
>gi|449446957|ref|XP_004141236.1| PREDICTED: ent-kaurene oxidase, chloroplastic-like [Cucumis sativus] gi|449498669|ref|XP_004160600.1| PREDICTED: ent-kaurene oxidase, chloroplastic-like [Cucumis sativus] gi|383290047|gb|AFH03045.1| ent-kaurene oxidase [Cucumis sativus] gi|402169625|gb|AFQ32799.1| ent-kaurene oxidase [Cucumis sativus] Back     alignment and taxonomy information
>gi|388509342|gb|AFK42737.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|358346435|ref|XP_003637273.1| Ent-kaurene oxidase [Medicago truncatula] gi|355503208|gb|AES84411.1| Ent-kaurene oxidase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
TAIR|locus:2180572509 GA3 "GA requiring 3" [Arabidop 0.539 0.216 0.616 1.1e-31
UNIPROTKB|Q5Z5S0493 OSJNBa0062E01.27 "Putative ent 0.549 0.227 0.530 1.4e-26
TAIR|locus:2126402500 CYP91A2 ""cytochrome P450, fam 0.509 0.208 0.349 3.5e-23
TAIR|locus:2126382501 CYP81F4 ""cytochrome P450, fam 0.509 0.207 0.311 1.1e-18
TAIR|locus:2179270496 CYP71B11 ""ytochrome p450, fam 0.406 0.167 0.388 9.7e-18
TAIR|locus:2139129518 CYP706A7 ""cytochrome P450, fa 0.406 0.160 0.364 2e-17
TAIR|locus:2093516502 CYP71B20 ""cytochrome P450, fa 0.397 0.161 0.352 8.6e-17
TAIR|locus:2179280 496 CYP71B12 ""cytochrome P450, fa 0.279 0.114 0.475 2e-16
UNIPROTKB|D1MI46495 CYP76B10 "Geraniol 8-hydroxyla 0.504 0.208 0.266 3e-16
TAIR|locus:2139114518 CYP706A6 ""cytochrome P450, fa 0.524 0.206 0.297 5.4e-16
TAIR|locus:2180572 GA3 "GA requiring 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 348 (127.6 bits), Expect = 1.1e-31, P = 1.1e-31
 Identities = 69/112 (61%), Positives = 86/112 (76%)

Query:    91 YSIKTGASSMIVLNSADVAKEKQWENPEEWQPERFLD-GQNDPADLYKTMAFGAGKRVCA 149
             Y +  G+   I +   ++ K K+WE PE+W PERFLD G+ + +DL+KTMAFGAGKRVCA
Sbjct:   397 YHVPAGSEIAINIYGCNMDK-KRWERPEDWWPERFLDDGKYETSDLHKTMAFGAGKRVCA 455

Query:   150 GSLQASLIACTAIGRLVQEFKWNLREGEEESVDTVGLTTHKLNPFHAIIRPR 201
             G+LQASL+A  AIGRLVQEF+W LR+GEEE+VDT GLT+ KL P  AII PR
Sbjct:   456 GALQASLMAGIAIGRLVQEFEWKLRDGEEENVDTYGLTSQKLYPLMAIINPR 507
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009707 "chloroplast outer membrane" evidence=IDA
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0009686 "gibberellin biosynthetic process" evidence=IDA;RCA;TAS
GO:0009740 "gibberellic acid mediated signaling pathway" evidence=RCA;TAS
GO:0010241 "ent-kaurene oxidation to kaurenoic acid" evidence=IMP
GO:0019825 "oxygen binding" evidence=IMP
UNIPROTKB|Q5Z5S0 OSJNBa0062E01.27 "Putative ent-kaurene oxidase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2126402 CYP91A2 ""cytochrome P450, family 91, subfamily A, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2126382 CYP81F4 ""cytochrome P450, family 81, subfamily F, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179270 CYP71B11 ""ytochrome p450, family 71, subfamily B, polypeptide 11"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139129 CYP706A7 ""cytochrome P450, family 706, subfamily A, polypeptide 7"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093516 CYP71B20 ""cytochrome P450, family 71, subfamily B, polypeptide 20"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179280 CYP71B12 ""cytochrome P450, family 71, subfamily B, polypeptide 12"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|D1MI46 CYP76B10 "Geraniol 8-hydroxylase" [Swertia mussotii (taxid:137888)] Back     alignment and assigned GO terms
TAIR|locus:2139114 CYP706A6 ""cytochrome P450, family 706, subfamily A, polypeptide 6"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 2e-51
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 2e-30
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 7e-16
pfam00067461 pfam00067, p450, Cytochrome P450 2e-11
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 2e-10
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 3e-10
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 5e-10
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 6e-10
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 6e-10
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 7e-10
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 3e-09
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 2e-08
pfam00067 461 pfam00067, p450, Cytochrome P450 8e-08
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 1e-07
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 3e-07
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 3e-06
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 6e-06
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 8e-06
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 9e-06
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 1e-05
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 2e-05
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 3e-05
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 6e-05
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 8e-05
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 1e-04
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 3e-04
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 0.001
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 0.003
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information 
 Score =  171 bits (436), Expect = 2e-51
 Identities = 66/93 (70%), Positives = 76/93 (81%)

Query: 111 EKQWENPEEWQPERFLDGQNDPADLYKTMAFGAGKRVCAGSLQASLIACTAIGRLVQEFK 170
           +K+WENPEEW PERFL  + + AD+YKTMAFGAGKRVCAGSLQA LIAC AI RLVQEF+
Sbjct: 373 KKRWENPEEWDPERFLGEKYESADMYKTMAFGAGKRVCAGSLQAMLIACMAIARLVQEFE 432

Query: 171 WNLREGEEESVDTVGLTTHKLNPFHAIIRPRPR 203
           W LREG+EE  DTV LTT KL+P HA ++PR  
Sbjct: 433 WRLREGDEEKEDTVQLTTQKLHPLHAHLKPRGS 465

Length = 466
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 204
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 100.0
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PLN02738633 carotene beta-ring hydroxylase 99.98
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.98
PTZ00404482 cytochrome P450; Provisional 99.98
PLN02655466 ent-kaurene oxidase 99.97
PLN02394503 trans-cinnamate 4-monooxygenase 99.97
PLN02290516 cytokinin trans-hydroxylase 99.97
PLN02500490 cytochrome P450 90B1 99.97
PLN02971543 tryptophan N-hydroxylase 99.97
PLN02426502 cytochrome P450, family 94, subfamily C protein 99.97
PLN00168519 Cytochrome P450; Provisional 99.97
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.97
PLN02183516 ferulate 5-hydroxylase 99.97
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 99.97
PLN03234499 cytochrome P450 83B1; Provisional 99.97
PLN02774463 brassinosteroid-6-oxidase 99.97
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 99.97
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.97
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.97
PLN02687517 flavonoid 3'-monooxygenase 99.97
PLN03018534 homomethionine N-hydroxylase 99.97
PLN03112514 cytochrome P450 family protein; Provisional 99.97
PLN02936489 epsilon-ring hydroxylase 99.97
PLN02302490 ent-kaurenoic acid oxidase 99.97
PLN02966502 cytochrome P450 83A1 99.97
PLN02196463 abscisic acid 8'-hydroxylase 99.96
PLN02987472 Cytochrome P450, family 90, subfamily A 99.96
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.92
PLN02648480 allene oxide synthase 99.9
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 98.77
PLN02196 463 abscisic acid 8'-hydroxylase 97.41
PLN02971 543 tryptophan N-hydroxylase 97.32
PLN03234 499 cytochrome P450 83B1; Provisional 97.13
PLN02655 466 ent-kaurene oxidase 97.09
PLN03112 514 cytochrome P450 family protein; Provisional 96.98
PLN02290 516 cytokinin trans-hydroxylase 96.98
PLN02687 517 flavonoid 3'-monooxygenase 96.87
PTZ00404 482 cytochrome P450; Provisional 96.85
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 96.84
PLN02183 516 ferulate 5-hydroxylase 96.66
PLN02500 490 cytochrome P450 90B1 96.55
PLN02394 503 trans-cinnamate 4-monooxygenase 96.53
PLN02774 463 brassinosteroid-6-oxidase 96.5
PLN02966 502 cytochrome P450 83A1 96.5
PLN02987 472 Cytochrome P450, family 90, subfamily A 96.43
PLN00168 519 Cytochrome P450; Provisional 96.27
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 96.25
PLN02302 490 ent-kaurenoic acid oxidase 96.14
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 96.11
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 95.4
PLN03018 534 homomethionine N-hydroxylase 94.58
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 93.61
PLN03195 516 fatty acid omega-hydroxylase; Provisional 93.39
PLN02936 489 epsilon-ring hydroxylase 90.86
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 88.96
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 86.81
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.4e-36  Score=240.11  Aligned_cols=195  Identities=21%  Similarity=0.247  Sum_probs=156.8

Q ss_pred             HHHHHHHhcccccchhhhHH-HHHHHHHH-HHHHHHHHHHHHhhhhcCCC----CCCCCCCCCccccccccccc--cCCc
Q 028744            6 YVTQAFQEFQAVPFATSIAL-GTLSVFFF-LFFIRGFISRQRMELAVNLP----PVPEVPGRLPLIGNLLQLKE--KKPH   77 (204)
Q Consensus         6 ~~~~~~~~~~~~~~a~~~~~-~~~~~~~~-l~~~~~~~~~l~~E~~~~~~----~~~~~~~~~p~l~~~~~~~~--~~~~   77 (204)
                      ..++++.+++.++.||.+|+ ++++.++| |+.||++|+|+|+|++.+.+    .+.+...+|+|++.|++|.+  .++.
T Consensus       291 t~dei~aQafvFl~AGfeTts~tlsf~lYeLA~~PdvQ~kLreEI~~~~~~~~~ltyd~l~~L~YLd~Vi~ETLR~yP~~  370 (499)
T KOG0158|consen  291 TDDEIAAQAFVFLLAGFETTASTLSFALYELAKNPDVQDKLREEIDEVLEEKEGLTYDSLSKLKYLDMVIKETLRLYPPA  370 (499)
T ss_pred             CHHHHHHHHHHHHHhhhHhHHHHHHHHHHHHhcChHHHHHHHHHHHHHhcccCCCCHHHHhCCcHHHHHHHHHHhhCCCc
Confidence            36788999999999999998 55554445 99999999999999998733    34455689999999999644  4444


Q ss_pred             hhhHHHhh-hcC-C-eEEEecCCeEEEEechHhhhhhhccCCCCCccccccccCCCCCCCcccccccCCccccCcchHHH
Q 028744           78 MTFTRWAE-MYG-P-IYSIKTGASSMIVLNSADVAKEKQWENPEEWQPERFLDGQNDPADLYKTMAFGAGKRVCAGSLQA  154 (204)
Q Consensus        78 ~~~~~~~~-~~g-~-~~~i~~g~~~~v~~~~~~~~~~~~~~~~~~F~P~R~~~~~~~~~~~~~~~~fg~G~~~C~g~~~a  154 (204)
                      ....+.+. .+. + ++.|++|+.+.|...+. |+||++|+||++|+||||.+++.+..++.+++|||.|+|.|+|.+||
T Consensus       371 ~~~~R~C~k~~~i~~~~~i~kG~~V~Ip~~al-H~Dp~~~p~Pe~F~PERF~~~~~~~~~~~~ylPFG~GPR~CIGmRfa  449 (499)
T KOG0158|consen  371 PFLNRECTKDYEIPGGFVIPKGTPVMIPTYAL-HHDPEYWPEPEKFKPERFEEENNKSRHPGAYLPFGVGPRNCIGMRFA  449 (499)
T ss_pred             ccccceecCceecCCCeEeCCCCEEEeecccc-cCCcccCCCcccCCCccCCCCcccccCCccccCCCCCccccHHHHHH
Confidence            44444443 332 3 79999999655555555 59999999999999999998876667788999999999999999999


Q ss_pred             HHHHHHHHHHhhhhceeeecCCCcccccee---cceecccCCeEEEEeeCC
Q 028744          155 SLIACTAIGRLVQEFKWNLREGEEESVDTV---GLTTHKLNPFHAIIRPRP  202 (204)
Q Consensus       155 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~r~  202 (204)
                      ++|+|+.++.++++|+++..+..... ...   +..+.|.+++.+++++|.
T Consensus       450 ~mq~K~~L~~lL~~f~~~~~~~t~~~-~~~~~~~~~l~pk~gi~Lkl~~r~  499 (499)
T KOG0158|consen  450 LMEAKLALAHLLRNFSFEVCPTTIIP-LEGDPKGFTLSPKGGIWLKLEPRD  499 (499)
T ss_pred             HHHHHHHHHHHHhhCEEecCCcccCc-ccCCccceeeecCCceEEEEEeCC
Confidence            99999999999999999988743333 333   677889999999999984

>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 3e-08
1pq2_A 476 Crystal Structure Of Human Drug Metabolizing Cytoch 9e-08
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 5e-05
3e4e_A 476 Human Cytochrome P450 2e1 In Complex With The Inhib 2e-07
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 8e-04
4gqs_A 477 Structure Of Human Microsomal Cytochrome P450 (cyp) 8e-07
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 7e-04
2p85_A 476 Structure Of Human Lung Cytochrome P450 2a13 With I 1e-06
1dt6_A 473 Structure Of Mammalian Cytochrome P450 2c5 Length = 2e-06
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 5e-04
1z10_A 476 Crystal Structure Of Human Microsomal P450 2a6 With 2e-06
2pg7_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 2e-06
2pg6_A 476 Crystal Structure Of Human Microsomal P450 2a6 L240 2e-06
2pg5_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 2e-06
3ebs_A 476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 2e-06
4h1n_A 479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 1e-05
1suo_A 476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 1e-05
1po5_A 476 Structure Of Mammalian Cytochrome P450 2b4 Length = 1e-05
3tk3_A 476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 1e-05
2q6n_A 478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 1e-05
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 1e-05
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 1e-05
1r9o_A 477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 2e-05
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 3e-05
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 3e-05
1og2_A 475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 3e-05
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 3e-05
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 3e-05
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 6e-05
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 6e-05
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 6e-05
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 1e-04
4i8v_A 491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 2e-04
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 2e-04
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 4e-04
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 7e-04
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure 
Iteration: 1

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 59/118 (50%), Gaps = 16/118 (13%)
Query: 60  GRLPL----IGNLLQLKE----KKPHMTFTRWAEMYGPIYSIKTGASSMIVLNSADVAKE 111
            RLPL    I  +L+L+       PH T TR + ++G  Y I  G   +  L  A +  E
Sbjct: 339 ARLPLLNATIAEVLRLRPVVPLALPHRT-TRPSSIFG--YDIPEGMVVIPNLQGAHL-DE 394
Query: 112 KQWENPEEWQPERFLDGQNDPADLYKTMAFGAGKRVCAGSLQASLIACTAIGRLVQEF 169
             WE P E++P+RFL+   +P+ L    AFG G RVC G   A L     + RL+Q F
Sbjct: 395 TVWEQPHEFRPDRFLEPGANPSAL----AFGCGARVCLGESLARLELFVVLARLLQAF 448
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 4e-17
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 1e-09
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 6e-17
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 1e-10
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 7e-17
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 8e-12
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 8e-17
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 1e-13
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-16
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 7e-13
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 2e-16
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 3e-10
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 4e-16
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 1e-11
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 4e-16
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 2e-14
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 5e-16
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-09
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 8e-16
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 7e-15
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 4e-15
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 1e-12
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 1e-14
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 1e-09
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 2e-14
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 2e-12
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 2e-13
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 6e-11
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 4e-13
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 7e-13
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 1e-12
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 8e-09
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 4e-12
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 9e-09
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 1e-10
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 1e-05
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 2e-10
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 4e-06
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 2e-10
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 9e-04
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 1e-09
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 1e-07
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 2e-09
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 1e-05
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 4e-09
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 2e-06
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 1e-08
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 3e-04
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 1e-08
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 1e-08
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 3e-05
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 3e-05
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 9e-05
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
 Score = 77.6 bits (192), Expect = 4e-17
 Identities = 21/71 (29%), Positives = 40/71 (56%), Gaps = 3/71 (4%)

Query: 41  ISRQRMELAVNLPPVPEVPGRLPLIGNLLQLKEKKPHMTFTRWAEMYGPIYSIKTGASSM 100
           ++++       LPP P     LP+IGN+LQ+  K    + T  +++YGP++++  G   +
Sbjct: 1   MAKKTSSGRGKLPPGP---TPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPI 57

Query: 101 IVLNSADVAKE 111
           +VL+  +  KE
Sbjct: 58  VVLHGYEAVKE 68
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 204
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 5e-18
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 3e-11
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 7e-18
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 2e-11
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 4e-17
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 7e-13
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 5e-16
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 1e-13
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 6e-16
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 2e-14
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 2e-14
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 5e-14
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 2e-12
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 3e-05
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 7e-11
d1n97a_ 385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 4e-04
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 5e-09
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 2e-08
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 2e-08
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 2e-08
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 6e-08
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 1e-07
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 5e-07
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 7e-07
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 8e-07
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 8e-07
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 2e-06
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 2e-06
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 9e-06
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 79.0 bits (193), Expect = 5e-18
 Identities = 29/128 (22%), Positives = 51/128 (39%), Gaps = 2/128 (1%)

Query: 76  PHMTFTRWAEMYGPIYSIKTGASSMIVLNSADVAK-EKQWENPEEWQPERFLDGQNDPAD 134
             M   R  +    I  +      ++++ S  + +  K W  PE++ PERF     D  D
Sbjct: 342 IAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNID 401

Query: 135 LYKTMAFGAGKRVCAGSLQASLIACTAIGRLVQEFKWNLREGEEESVD-TVGLTTHKLNP 193
            Y    FG+G R C G   A +    A+ R++Q F +   +  +  +  ++G       P
Sbjct: 402 PYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKP 461

Query: 194 FHAIIRPR 201
               +  R
Sbjct: 462 VVLKVESR 469
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query204
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.96
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.96
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.96
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.95
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.95
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.95
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.94
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.94
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.94
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.94
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.93
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.91
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.9
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.9
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 98.65
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 98.44
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 98.16
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 98.07
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 98.05
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 97.69
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=7.9e-41  Score=204.01  Aligned_cols=197  Identities=19%  Similarity=0.236  Sum_probs=147.9

Q ss_pred             HHHHHHHCCCCCCHHHHHH-HHHHHHHH-HHHHHHHHHHHHHHHHCCCCCCCCC----CCCCCCCCCCCCCCCC--CCCH
Q ss_conf             9999874101332035679-99999999-9999999998876662289999999----9888631300012124--8830
Q 028744            7 VTQAFQEFQAVPFATSIAL-GTLSVFFF-LFFIRGFISRQRMELAVNLPPVPEV----PGRLPLIGNLLQLKEK--KPHM   78 (204)
Q Consensus         7 ~~~~~~~~~~~~~a~~~~~-~~~~~~~~-l~~~~~~~~~~~~e~~~~~~~~~~~----~~~~p~l~~~~~~~~~--~~~~   78 (204)
                      .+++...++.+++||.+++ .++.++++ ++.+|++|.++++|++.........    ..++||+.+|++|.++  ++..
T Consensus       265 ~~ei~~~~l~l~~Ag~~tta~~l~~~l~~L~~~Pe~~~klr~Ei~~~~~~~~~~~~~~l~~~~~l~a~i~E~lRl~p~~~  344 (472)
T d1tqna_         265 DLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAM  344 (472)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHSTTTCCCCHHHHHHCHHHHHHHHHHHHHCCTTC
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCEEHEECCCCCCCHHHHHHCCCCCCCEEEECCCCCCCCC
T ss_conf             46777665422102454443322121123456853223431100100365320057776135220301444012477522


Q ss_pred             HHHHHHH--HCCCEEEEECCCEEEEEECHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             2677866--50890899519967999440766542203799873455434689999885334545776346732389999
Q 028744           79 TFTRWAE--MYGPIYSIKTGASSMIVLNSADVAKEKQWENPEEWQPERFLDGQNDPADLYKTMAFGAGKRVCAGSLQASL  156 (204)
Q Consensus        79 ~~~~~~~--~~~~~~~i~~g~~~~v~~~~~~~~~~~~~~~~~~f~P~R~~~~~~~~~~~~~~~~fg~G~~~c~g~~~a~~  156 (204)
                      ...+.+.  ...++|.||+|+. +++.....++|+.+|+||++|+|+||++.+........++|||.|.|.|+|+++|..
T Consensus       345 ~~~r~~~~d~~~~g~~ipkGt~-v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~~~~~~~~~~FG~G~r~C~G~~~A~~  423 (472)
T d1tqna_         345 RLERVCKKDVEINGMFIPKGVV-VMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALM  423 (472)
T ss_dssp             CEEEECCSCEEETTEEECTTCE-EEECHHHHHTCTTTSSSTTSCCGGGGSTTTGGGCCTTTSCTTCCSTTSCTTHHHHHH
T ss_pred             CCCCCCCCCCCCCCCEECCCCE-EEEECHHHHCCCHHCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCHHHHHHHH
T ss_conf             4332125675556851589998-998401510581107981124854358877455898624077898846846999999


Q ss_pred             HHHHHHHHHHHHCEEEECCCCCCCCC-EECCEECCCCCEEEEEEECCCC
Q ss_conf             99999998434014461589866310-0032102568737998547999
Q 028744          157 IACTAIGRLVQEFKWNLREGEEESVD-TVGLTTHKLNPFHAIIRPRPRN  204 (204)
Q Consensus       157 ~~~~~~~~l~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~r~~~  204 (204)
                      +++++++.++++||++++++...... .......|..++++++++|.++
T Consensus       424 ~~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~R~~~  472 (472)
T d1tqna_         424 NMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGT  472 (472)
T ss_dssp             HHHHHHHHHHTTEEEECCTTCCSSCCBCSSSSCCBSSCCEEEEEETTCC
T ss_pred             HHHHHHHHHHHHCEEEECCCCCCCCEECCCEEEEECCCEEEEEEECCCC
T ss_conf             9999999999858999699987886221224884389879999979899
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure