Citrus Sinensis ID: 028748

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MASSKKRKEEKAKLKNAETRKKAKPSPKKPKQSNKKTAIQNGTVSESKDEVVVTPASSSINDSQQDSETEQEGRSQEQEATNEKKKKPNKNGKKIERDDDDEVSKVCNFPMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECCAKDRKKSLAYKHLAVVSEQSKYDFLSDYVPEKIKAEDALAQRELAEGGEG
cccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccccccccccccHHHHHHHHHHHccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccHHHHHHHHHccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEHHHHHHHHcccHHHHHHHHccccccHHHHHHHHHHHccccc
MASSKKRKEEKAKLKNAetrkkakpspkkpkqsnkktaiqngtvseskdevvvtpasssindsqqdseteqegrsqeqeatnekkkkpnkngkkierddddevskvcnfpmgrIKRIFKtqssdigitgEAVFLVNKATDKFLEQFCEDAYECCAKDRKKSLAYKHLAVVSEqskydflsdyvpekIKAEDALAQRELAEGGEG
masskkrkeekaklknaetrkkakpspkkpkqsnkktaiqngtvseskdevvvtpasssindsqqdseteqegrsqeqeatnekkkkpnkngkkierddddevskvcnfpmgrikrifktqssdigiTGEAVFLVNKATDKFLEQFCEDAYECCAKDRKKSLAYKHLAvvseqskydflsDYVPEKIKAEDALAQRELAEGGEG
MasskkrkeekaklknaeTRkkakpspkkpkqsnkkTAIQNGTVSESKDEVVVTPASSSINDSQQDSETEQEGRSQEQEATnekkkkpnkngkkIERDDDDEVSKVCNFPMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECCAKDRKKSLAYKHLAVVSEQSKYDFLSDYVPEKIKAEDALAQRELAEGGEG
********************************************************************************************************KVCNFPMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECCAKDRKKSLAYKHLAVVSEQSKYDFLSDYVP********************
************************************************************************************************************FPMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCED***************KHLAVVSEQSKYDFLSDYVPEK******************
*****************************************************************************************************EVSKVCNFPMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECCAKDRKKSLAYKHLAVVSEQSKYDFLSDYVPEKIKAEDALAQRELAEGGEG
**********************************************************************************************************CNFPMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECCAKDRKKSLAYKHLAVVSEQSKYDFLSDYVPEKIKAEDALAQREL******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSKKRKEEKAKLKNAETRKKAKPSPKKPKQSNKKTAIQNGTVSESKDEVVVTPASSSINDSQQDSETEQEGRSQEQEATNEKKKKPNKNGKKIERDDDDEVSKVCNFPMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECCAKDRKKSLAYKHLAVVSEQSKYDFLSDYVPEKIKAEDALAQRELAEGGEG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query204 2.2.26 [Sep-21-2011]
Q6BX14277 DNA polymerase epsilon su yes no 0.382 0.281 0.329 4e-07
Q9NRG0131 Chromatin accessibility c yes no 0.436 0.679 0.333 7e-06
P79007 415 Transcriptional activator yes no 0.416 0.204 0.311 8e-06
Q9JKP8129 Chromatin accessibility c yes no 0.436 0.689 0.333 1e-05
>sp|Q6BX14|DPB3_DEBHA DNA polymerase epsilon subunit C OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DPB3 PE=3 SV=1 Back     alignment and function desciption
 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 107 CNFPMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECCAKDRKKSLAYKH 166
            + P+ +IK+IFK     +  +  AV+    AT+ F++ F E +      D++K L YK 
Sbjct: 90  LSLPLSKIKKIFKMDPDYLAASQSAVYATGLATELFIQYFTEQSLVLAKMDKRKKLQYKD 149

Query: 167 LA-VVSEQSKYDFLSDYVP 184
            +  V+ Q   +FLSD VP
Sbjct: 150 FSNAVASQDSLNFLSDTVP 168
DNA polymerase II participates in chromosomal DNA replication.
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (taxid: 284592)
EC: 2EC: .EC: 7EC: .EC: 7EC: .EC: 7
>sp|Q9NRG0|CHRC1_HUMAN Chromatin accessibility complex protein 1 OS=Homo sapiens GN=CHRAC1 PE=1 SV=1 Back     alignment and function description
>sp|P79007|HAP5_SCHPO Transcriptional activator hap5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hap5 PE=2 SV=1 Back     alignment and function description
>sp|Q9JKP8|CHRC1_MOUSE Chromatin accessibility complex protein 1 OS=Mus musculus GN=Chrac1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
449463639221 PREDICTED: uncharacterized protein LOC10 0.970 0.895 0.426 1e-32
449526059222 PREDICTED: uncharacterized protein LOC10 0.970 0.891 0.424 2e-32
357472241179 DNA polymerase epsilon subunit [Medicago 0.558 0.636 0.532 1e-28
255583719232 DNA polymerase epsilon subunit, putative 0.519 0.456 0.566 2e-28
224104657212 predicted protein [Populus trichocarpa] 0.593 0.570 0.515 5e-28
225435283 425 PREDICTED: uncharacterized protein LOC10 0.436 0.209 0.544 1e-23
363807854234 uncharacterized protein LOC100793738 [Gl 0.495 0.431 0.509 8e-23
110737921206 hypothetical protein [Arabidopsis thalia 0.539 0.533 0.495 2e-21
18390837206 DNA polymerase epsilon subunit 4 [Arabid 0.539 0.533 0.495 3e-21
295913524181 transcription factor [Lycoris longituba] 0.490 0.552 0.456 3e-20
>gi|449463639|ref|XP_004149539.1| PREDICTED: uncharacterized protein LOC101211039 [Cucumis sativus] Back     alignment and taxonomy information
 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 95/223 (42%), Positives = 133/223 (59%), Gaps = 25/223 (11%)

Query: 1   MASSKKRKEEKAKLKNAETRKKAKPSPKKPKQSNKKTA------------------IQNG 42
           MASSKK   E AK K   T   +KPSPK    +N + +                    NG
Sbjct: 1   MASSKKSSTE-AKSKEVGT---SKPSPKAKTHNNARNSDKDISKKKKKKKISISISTNNG 56

Query: 43  TVSESKDEVVVTPASSSINDSQQDSETEQEGRSQEQEATNEKKKKPNKNGKKIER--DDD 100
           +V ++    V  P +S+  D+    E + E  S++   +  KK K N   ++  R   ++
Sbjct: 57  SVKDNHALAVSAPGASASEDADAADEDKAETTSRKSNTSKSKKVKRNHAKEEDNRYAAEE 116

Query: 101 DEVSKVCNFPMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECCAKDRKK 160
           +   K+  FPM RIK+I + ++SD+ I  EA+FLVNKA++ FL QFC+DAY CCA+DRKK
Sbjct: 117 EAEEKIYKFPMHRIKKIMRDENSDLRINQEALFLVNKASEMFLVQFCKDAYACCAQDRKK 176

Query: 161 SLAYKHL-AVVSEQSKYDFLSDYVPEKIKAEDALAQRELAEGG 202
           SLAYKHL +VVS++ +YDFLSD+VPEK+K EDAL +R +AE G
Sbjct: 177 SLAYKHLSSVVSKRKRYDFLSDFVPEKLKFEDALKERSMAESG 219

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449526059|ref|XP_004170032.1| PREDICTED: uncharacterized protein LOC101228076 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357472241|ref|XP_003606405.1| DNA polymerase epsilon subunit [Medicago truncatula] gi|355507460|gb|AES88602.1| DNA polymerase epsilon subunit [Medicago truncatula] gi|388523247|gb|AFK49676.1| nuclear transcription factor Y subunit C7 [Medicago truncatula] Back     alignment and taxonomy information
>gi|255583719|ref|XP_002532613.1| DNA polymerase epsilon subunit, putative [Ricinus communis] gi|223527669|gb|EEF29779.1| DNA polymerase epsilon subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224104657|ref|XP_002313518.1| predicted protein [Populus trichocarpa] gi|222849926|gb|EEE87473.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225435283|ref|XP_002282257.1| PREDICTED: uncharacterized protein LOC100243337 [Vitis vinifera] gi|297746240|emb|CBI16296.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|363807854|ref|NP_001242442.1| uncharacterized protein LOC100793738 [Glycine max] gi|255635803|gb|ACU18250.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|110737921|dbj|BAF00898.1| hypothetical protein [Arabidopsis thaliana] gi|110738408|dbj|BAF01130.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18390837|ref|NP_563803.1| DNA polymerase epsilon subunit 4 [Arabidopsis thaliana] gi|8778845|gb|AAF79844.1|AC026875_24 T6D22.7 [Arabidopsis thaliana] gi|21555461|gb|AAM63864.1| unknown [Arabidopsis thaliana] gi|94442463|gb|ABF19019.1| At1g07980 [Arabidopsis thaliana] gi|332190101|gb|AEE28222.1| DNA polymerase epsilon subunit 4 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|295913524|gb|ADG58010.1| transcription factor [Lycoris longituba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
TAIR|locus:2205170206 NF-YC10 ""nuclear factor Y, su 0.725 0.718 0.375 5.5e-22
CGD|CAL0001456237 HFL1 [Candida albicans (taxid: 0.490 0.421 0.267 1.2e-10
DICTYBASE|DDB_G0272740158 DDB_G0272740 "putative histone 0.612 0.791 0.296 4.1e-10
ZFIN|ZDB-GENE-050227-18114 chrac1 "chromatin accessibilit 0.509 0.912 0.336 3.6e-09
UNIPROTKB|Q0P5E8130 CHRAC1 "Chromatin accessibilit 0.436 0.684 0.322 8.7e-08
UNIPROTKB|Q9NRG0131 CHRAC1 "Chromatin accessibilit 0.480 0.748 0.32 8.7e-08
FB|FBgn0029905 601 Nf-YC "Nuclear factor Y-box C" 0.406 0.138 0.329 9e-08
MGI|MGI:2135796129 Chrac1 "chromatin accessibilit 0.436 0.689 0.333 1.8e-07
RGD|1309321128 Chrac1 "chromatin accessibilit 0.436 0.695 0.333 1.8e-07
FB|FBgn0043001140 Chrac-16 "Chromatin accessibil 0.382 0.557 0.365 2.3e-07
TAIR|locus:2205170 NF-YC10 ""nuclear factor Y, subunit C10"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 256 (95.2 bits), Expect = 5.5e-22, P = 5.5e-22
 Identities = 56/149 (37%), Positives = 84/149 (56%)

Query:    50 EVVVTPASSSINDSQQDSETEQEGRSQEQEATXXXXXXXXXXXXXIERDDDDEVSKVCNF 109
             E+  + +S S+ ++ +  E ++      +                 E DD         F
Sbjct:    51 EISESSSSDSVEEAIRGDEAKKSNGVVSKRGNGKSVGIPTKTSKNREEDDGGAEDAKIKF 110

Query:   110 PMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECCAKDRKKSLAYKHLA- 168
             PM RI+RI ++ +S   I  +AVFLVNKAT+ F+E+F E+AY+   KD+KK + YKHL+ 
Sbjct:   111 PMNRIRRIMRSDNSAPQIMQDAVFLVNKATEMFIERFSEEAYDSSVKDKKKFIHYKHLSS 170

Query:   169 VVSEQSKYDFLSDYVPEKIKAEDALAQRE 197
             VVS   +Y+FL+D VPEK+KAE AL + E
Sbjct:   171 VVSNDQRYEFLADSVPEKLKAEAALEEWE 199
GO:0003677 "DNA binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA;TAS
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
CGD|CAL0001456 HFL1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0272740 DDB_G0272740 "putative histone-like transcription factor" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050227-18 chrac1 "chromatin accessibility complex 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q0P5E8 CHRAC1 "Chromatin accessibility complex 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NRG0 CHRAC1 "Chromatin accessibility complex protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0029905 Nf-YC "Nuclear factor Y-box C" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:2135796 Chrac1 "chromatin accessibility complex 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309321 Chrac1 "chromatin accessibility complex 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0043001 Chrac-16 "Chromatin accessibility complex 16kD protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
pfam0080865 pfam00808, CBFD_NFYB_HMF, Histone-like transcripti 4e-09
COG5208286 COG5208, HAP5, CCAAT-binding factor, subunit C [Tr 2e-06
pfam0012575 pfam00125, Histone, Core histone H2A/H2B/H3/H4 9e-04
>gnl|CDD|201453 pfam00808, CBFD_NFYB_HMF, Histone-like transcription factor (CBF/NF-Y) and archaeal histone Back     alignment and domain information 
 Score = 50.7 bits (122), Expect = 4e-09
 Identities = 17/60 (28%), Positives = 35/60 (58%)

Query: 109 FPMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECCAKDRKKSLAYKHLA 168
            P+ R+KRI K+      I+ +A  L+ +  ++F+E    +A E C K+++K++  +H+ 
Sbjct: 3   LPIARVKRIMKSDPDAGRISQDAKELIAECVEEFIEFIASEAAEICKKEKRKTINAEHIK 62

This family includes archaebacterial histones and histone like transcription factors from eukaryotes. Length = 65
>gnl|CDD|227533 COG5208, HAP5, CCAAT-binding factor, subunit C [Transcription] Back     alignment and domain information
>gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 204
KOG1657236 consensus CCAAT-binding factor, subunit C (HAP5) [ 99.86
COG5208286 HAP5 CCAAT-binding factor, subunit C [Transcriptio 99.83
PF0080865 CBFD_NFYB_HMF: Histone-like transcription factor ( 99.8
KOG1659 224 consensus Class 2 transcription repressor NC2, alp 99.73
COG5247113 BUR6 Class 2 transcription repressor NC2, alpha su 99.68
KOG1658162 consensus DNA polymerase epsilon, subunit C [Repli 99.39
KOG0869168 consensus CCAAT-binding factor, subunit A (HAP3) [ 98.93
cd00074115 H2A Histone 2A; H2A is a subunit of the nucleosome 98.83
COG5262132 HTA1 Histone H2A [Chromatin structure and dynamics 98.72
KOG0870172 consensus DNA polymerase epsilon, subunit D [Trans 98.64
smart00414106 H2A Histone 2A. 98.44
COG203691 HHT1 Histones H3 and H4 [Chromatin structure and d 98.39
PLN00154136 histone H2A; Provisional 98.35
PTZ00017134 histone H2A; Provisional 98.34
PF0012575 Histone: Core histone H2A/H2B/H3/H4 histone h2a si 98.25
KOG1756131 consensus Histone 2A [Chromatin structure and dyna 98.21
PLN00153129 histone H2A; Provisional 98.11
PLN00157132 histone H2A; Provisional 98.09
PLN00156139 histone H2AX; Provisional 98.09
cd0007685 H4 Histone H4, one of the four histones, along wit 98.05
smart0080365 TAF TATA box binding protein associated factor. TA 98.0
PLN00035103 histone H4; Provisional 97.96
PTZ00252134 histone H2A; Provisional 97.96
smart0041774 H4 Histone H4. 97.71
PTZ00015102 histone H4; Provisional 97.7
cd0798172 TAF12 TATA Binding Protein (TBP) Associated Factor 97.61
KOG1658162 consensus DNA polymerase epsilon, subunit C [Repli 97.58
KOG0871156 consensus Class 2 transcription repressor NC2, bet 97.55
smart00428105 H3 Histone H3. 97.31
cd0804885 TAF11 TATA Binding Protein (TBP) Associated Factor 96.92
PLN00121136 histone H3; Provisional 96.71
COG5150148 Class 2 transcription repressor NC2, beta subunit 96.65
PTZ00018136 histone H3; Provisional 96.58
PLN00161135 histone H3; Provisional 96.34
PLN0016097 histone H3; Provisional 96.21
PF15511414 CENP-T: Centromere kinetochore component CENP-T; P 96.04
cd07979117 TAF9 TATA Binding Protein (TBP) Associated Factor 95.82
PF0226993 TFIID-18kDa: Transcription initiation factor IID, 95.62
KOG1757131 consensus Histone 2A [Chromatin structure and dyna 95.49
PF0296966 TAF: TATA box binding protein associated factor (T 95.21
PF0941572 CENP-X: CENP-S associating Centromere protein X; I 95.18
smart0057677 BTP Bromodomain transcription factors and PHD doma 94.99
PF0471990 TAFII28: hTAFII28-like protein conserved region; I 94.81
cd08050 343 TAF6 TATA Binding Protein (TBP) Associated Factor 94.44
cd0797892 TAF13 The TATA Binding Protein (TBP) Associated Fa 94.26
PF0384768 TFIID_20kDa: Transcription initiation factor TFIID 93.81
PF1563076 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 93.63
PF05236 264 TAF4: Transcription initiation factor TFIID compon 91.88
KOG1745137 consensus Histones H3 and H4 [Chromatin structure 91.66
KOG3219195 consensus Transcription initiation factor TFIID, s 90.62
PF15510102 CENP-W: Centromere kinetochore component W 89.42
KOG1142258 consensus Transcription initiation factor TFIID, s 89.11
smart0042789 H2B Histone H2B. 88.41
PLN0015558 histone H2A; Provisional 86.85
PLN00158116 histone H2B; Provisional 85.08
PF0752477 Bromo_TP: Bromodomain associated; InterPro: IPR006 83.9
PF0354051 TFIID_30kDa: Transcription initiation factor TFIID 83.75
PTZ00463117 histone H2B; Provisional 83.57
KOG1744127 consensus Histone H2B [Chromatin structure and dyn 80.68
>KOG1657 consensus CCAAT-binding factor, subunit C (HAP5) [Transcription] Back     alignment and domain information 
Probab=99.86  E-value=9.2e-23  Score=178.17  Aligned_cols=94  Identities=30%  Similarity=0.456  Sum_probs=89.8

Q ss_pred             CccccccCCCCChHHHHHHHhcCCCcccchhHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCcccccccc-hhccccccc
Q 028748           99 DDDEVSKVCNFPMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECCAKDRKKSLAYKHLA-VVSEQSKYD  177 (204)
Q Consensus        99 ~~~~~~~~~~LPlaRIKrIMK~DpDV~~IS~EA~~lIaKAtELFIe~La~~A~~~A~~~kRKTLqy~DLa-aV~~~e~fd  177 (204)
                      .+..++....|||+|||+|||.|+|+.+|+.||++++++|||+||..|+..||.++..++|++|++.||+ +|.+.+.|+
T Consensus        65 e~~~d~~~~~lPlaRiKkimK~dedv~mI~~Eapvl~aka~E~Fi~elt~~sw~~Tee~~rrtl~~sdia~av~~s~~fd  144 (236)
T KOG1657|consen   65 EGQLDFKNHILPLARIKKIMKSDEDVSMITAEAPVLFAKACELFITELTLRSWVHTEENKRRTLQKSDIAAAVTQSETFD  144 (236)
T ss_pred             ccccchhhccCcHhhccccccccccccccchhHHHHHHHHHHHHHHHHHHHhhhhhcccccccchHHHHHHHhccCCCcc
Confidence            4567889999999999999999999999999999999999999999999999999999999999999999 999999999


Q ss_pred             cccccCCCcccHHHH
Q 028748          178 FLSDYVPEKIKAEDA  192 (204)
Q Consensus       178 FL~DiVP~kI~l~d~  192 (204)
                      ||.||||+++.++.+
T Consensus       145 FL~DivP~~~~~~~~  159 (236)
T KOG1657|consen  145 FLRDIVPRKILAEKY  159 (236)
T ss_pred             ceeccccchhccccc
Confidence            999999999877654

>COG5208 HAP5 CCAAT-binding factor, subunit C [Transcription] Back     alignment and domain information
>PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin Back     alignment and domain information
>KOG1659 consensus Class 2 transcription repressor NC2, alpha subunit (DRAP1) [Transcription] Back     alignment and domain information
>COG5247 BUR6 Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] Back     alignment and domain information
>KOG1658 consensus DNA polymerase epsilon, subunit C [Replication, recombination and repair] Back     alignment and domain information
>KOG0869 consensus CCAAT-binding factor, subunit A (HAP3) [Transcription] Back     alignment and domain information
>cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>COG5262 HTA1 Histone H2A [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0870 consensus DNA polymerase epsilon, subunit D [Transcription] Back     alignment and domain information
>smart00414 H2A Histone 2A Back     alignment and domain information
>COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN00154 histone H2A; Provisional Back     alignment and domain information
>PTZ00017 histone H2A; Provisional Back     alignment and domain information
>PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] Back     alignment and domain information
>KOG1756 consensus Histone 2A [Chromatin structure and dynamics] Back     alignment and domain information
>PLN00153 histone H2A; Provisional Back     alignment and domain information
>PLN00157 histone H2A; Provisional Back     alignment and domain information
>PLN00156 histone H2AX; Provisional Back     alignment and domain information
>cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution Back     alignment and domain information
>smart00803 TAF TATA box binding protein associated factor Back     alignment and domain information
>PLN00035 histone H4; Provisional Back     alignment and domain information
>PTZ00252 histone H2A; Provisional Back     alignment and domain information
>smart00417 H4 Histone H4 Back     alignment and domain information
>PTZ00015 histone H4; Provisional Back     alignment and domain information
>cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>KOG1658 consensus DNA polymerase epsilon, subunit C [Replication, recombination and repair] Back     alignment and domain information
>KOG0871 consensus Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] Back     alignment and domain information
>smart00428 H3 Histone H3 Back     alignment and domain information
>cd08048 TAF11 TATA Binding Protein (TBP) Associated Factor 11 (TAF11) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PLN00121 histone H3; Provisional Back     alignment and domain information
>COG5150 Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] Back     alignment and domain information
>PTZ00018 histone H3; Provisional Back     alignment and domain information
>PLN00161 histone H3; Provisional Back     alignment and domain information
>PLN00160 histone H3; Provisional Back     alignment and domain information
>PF15511 CENP-T: Centromere kinetochore component CENP-T; PDB: 3B0D_T 3B0C_T 3VH5_T 3VH6_T Back     alignment and domain information
>cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PF02269 TFIID-18kDa: Transcription initiation factor IID, 18kD subunit; InterPro: IPR003195 This family includes the Spt3 yeast transcription factors and the 18 kDa subunit from human transcription initiation factor IID (TFIID-18) Back     alignment and domain information
>KOG1757 consensus Histone 2A [Chromatin structure and dynamics] Back     alignment and domain information
>PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex Back     alignment and domain information
>PF09415 CENP-X: CENP-S associating Centromere protein X; InterPro: IPR018552 Centromere protein X (CENP-X) is a component of the CENP-S complex Back     alignment and domain information
>smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins Back     alignment and domain information
>PF04719 TAFII28: hTAFII28-like protein conserved region; InterPro: IPR006809 The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>cd07978 TAF13 The TATA Binding Protein (TBP) Associated Factor 13 (TAF13) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PF03847 TFIID_20kDa: Transcription initiation factor TFIID subunit A; InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] Back     alignment and domain information
>PF15630 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C Back     alignment and domain information
>PF05236 TAF4: Transcription initiation factor TFIID component TAF4 family; InterPro: IPR007900 Accurate transcription initiation at protein-coding genes by RNA polymerase II requires the assembly of a multiprotein complex around the mRNA start site Back     alignment and domain information
>KOG1745 consensus Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3219 consensus Transcription initiation factor TFIID, subunit TAF11 [Transcription] Back     alignment and domain information
>PF15510 CENP-W: Centromere kinetochore component W Back     alignment and domain information
>KOG1142 consensus Transcription initiation factor TFIID, subunit TAF12 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>smart00427 H2B Histone H2B Back     alignment and domain information
>PLN00155 histone H2A; Provisional Back     alignment and domain information
>PLN00158 histone H2B; Provisional Back     alignment and domain information
>PF07524 Bromo_TP: Bromodomain associated; InterPro: IPR006565 This bromodomain is found in eukaryotic transcription factors and PHD domain containing proteins (IPR001965 from INTERPRO) Back     alignment and domain information
>PF03540 TFIID_30kDa: Transcription initiation factor TFIID 23-30kDa subunit; InterPro: IPR003923 Transcription initiation factor TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors Back     alignment and domain information
>PTZ00463 histone H2B; Provisional Back     alignment and domain information
>KOG1744 consensus Histone H2B [Chromatin structure and dynamics] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
2byk_A140 Histone Fold Heterodimer Of The Chromatin Accessibi 8e-07
4g91_C119 Ccaat-Binding Complex From Aspergillus Nidulans Len 8e-05
>pdb|2BYK|A Chain A, Histone Fold Heterodimer Of The Chromatin Accessibility Complex Length = 140 Back     alignment and structure 
Iteration: 1

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 4/85 (4%)
Query: 109 FPMGRIKRIFKTQSSDIG-ITGEAVFLVNKATDKFLEQFCEDAY-ECCAKDRKKSLAYKH 166
            P+ R++ I K+ S D G IT E +FL+ K T+ F+      AY E   +   ++L Y+H
Sbjct: 20  LPLSRVRTIMKS-SMDTGLITNEVLFLMTKCTELFVRHLAGAAYTEEFGQRPGEALKYEH 78
Query: 167 LA-VVSEQSKYDFLSDYVPEKIKAE 190
           L+ VV++    +FL   VP+KI+  
Sbjct: 79  LSQVVNKNKNLEFLLQIVPQKIRVH 103
>pdb|4G91|C Chain C, Ccaat-Binding Complex From Aspergillus Nidulans Length = 119 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 6e-17
2byk_A140 Chrac-16; nucleosome sliding, histone fold, DNA-bi 2e-14
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 3e-11
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Length = 97 Back     alignment and structure
 Score = 71.9 bits (176), Expect = 6e-17
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 1/81 (1%)

Query: 105 KVCNFPMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECCAKDRKKSLAY 164
           +V   P+ RIK+I K       I+ EA  L  KA   F+ +    A+     +++++L  
Sbjct: 16  RVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQR 75

Query: 165 KHLA-VVSEQSKYDFLSDYVP 184
             +A  +++  ++DFL D VP
Sbjct: 76  NDIAMAITKFDQFDFLIDIVP 96
>2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Length = 140 Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Length = 98 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 204
d1n1jb_78 a.22.1.3 (B:) Nuclear transcription factor Y subun 3e-15
d2byka172 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophil 7e-12
d1jfia_66 a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chai 6e-10
d1n1ja_87 a.22.1.3 (A:) Nuclear transcription factor Y subun 1e-08
d2bykb189 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila 3e-08
d1ku5a_66 a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococc 3e-08
d1jfib_135 a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain 8e-07
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 4e-05
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure

class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: TBP-associated factors, TAFs
domain: Nuclear transcription factor Y subunit gamma (Nf-Yc2)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 65.6 bits (160), Expect = 3e-15
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 110 PMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECCAKDRKKSLAYKHLA- 168
           P+ RIK+I K       I+ EA  L  KA   F+ +    A+     +++++L    +A 
Sbjct: 2   PLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAM 61

Query: 169 VVSEQSKYDFLSDYVP 184
            +++  ++DFL D VP
Sbjct: 62  AITKFDQFDFLIDIVP 77
>d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 72 Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 89 Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Length = 66 Back     information, alignment and structure
>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query204
d1n1jb_78 Nuclear transcription factor Y subunit gamma (Nf-Y 99.92
d2byka172 Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax 99.86
d1jfib_135 Negative cofactor 2, NC2, beta chain {Human (Homo 99.84
d1n1ja_87 Nuclear transcription factor Y subunit beta (Nf-Yb 99.8
d1jfia_66 Negative cofactor 2, NC2, alpha chain {Human (Homo 99.78
d2bykb189 Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax 99.75
d1ku5a_66 Archaeal histone {Archaeon (Pyrococcus horikoshii) 99.56
d1htaa_68 Archaeal histone {Archaeon Methanothermus fervidus 99.41
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 99.39
d1q9ca_172 Histone domain of Son of sevenless protein {Human 98.43
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 98.42
d1u35c1106 macro-H2A.1, histone domain {Human (Homo sapiens) 98.12
d1f66c_103 Histone H2A {Human (Homo sapiens), variant H2A.Z [ 98.04
d1tzya_106 Histone H2A {Chicken (Gallus gallus), erythrocytes 98.03
d2huec182 Histone H4 {African clawed frog (Xenopus laevis) [ 97.7
d1tzyc_95 Histone H3 {Chicken (Gallus gallus), erythrocytes 97.08
d1bh9b_89 TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} 94.8
d1tafb_70 TAF(II)62 {Fruit fly (Drosophila melanogaster) [Ta 93.76
d1tzyb_92 Histone H2B {Chicken (Gallus gallus), erythrocytes 91.5
d1h3ob_74 TAF(II)-20, (TAF(II)-15, hTAF12), histone fold dom 88.41
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: TBP-associated factors, TAFs
domain: Nuclear transcription factor Y subunit gamma (Nf-Yc2)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.92  E-value=1.1e-25  Score=162.59  Aligned_cols=77  Identities=29%  Similarity=0.518  Sum_probs=76.1

Q ss_pred             CCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC-HHCCCCCCCCCCCCCCC
Q ss_conf             983899999831998654026799999999999999999999999983487744333300-00234522332113788
Q 028748          109 FPMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECCAKDRKKSLAYKHLA-VVSEQSKYDFLSDYVPE  185 (204)
Q Consensus       109 LPlARIKrIMK~DpDv~~ISkEA~~lIsKAtELFIq~La~~A~~~A~~~kRKTI~y~DIa-aV~~~e~feFL~DiVP~  185 (204)
                      ||++|||||||.+||++.||+||++++++|+|+||++|+..|+.+|.+++|+||+|+||+ ||.+.+.|+||.|+||+
T Consensus         1 LP~srVkrImK~~~~~~~is~ea~~~i~~a~E~Fi~~l~~~A~~~a~~~~rkti~~~dl~~av~~~~~~~FL~d~vPk   78 (78)
T d1n1jb_           1 LPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR   78 (78)
T ss_dssp             CCHHHHHHHHTTSTTCCCBCTHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHTTCGGGGGGTTTSCC
T ss_pred             CCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHCCCHHHHHHHHCCC
T ss_conf             977899999866974333006799999999999999999999999997488817899999999648766788872789
>d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Back     information, alignment and structure
>d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1bh9b_ a.22.1.3 (B:) TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure