Citrus Sinensis ID: 028847

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---
MATKVYIVYYSMYGHVEKLAEEIQKGAASVEGVEAKLWQVPETLSEDVLGKMGAGPKSDVPTITPNELAEADGILLGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGSQGGGQETTPLTAITQLVHHGMIFVPIGYTFGAGMSEMEKVKGGSPYGAGTFAGDGSRQPSELELAQAFHQGKYFAGITKKLKGSA
cccEEEEEEEccccHHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHcccccccccccccHHHHHHccEEEEEccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccccHHHHHHHHHHHHHHHccEEEcccccccccccccccccccccccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHHccc
cccEEEEEEEEcHHHHHHHHHHHHHcccccccEEEEEEEccccccHHHHHHcccccccccccccHHHHHHccEEEEccccccccHHHHHHHHHHHHccHHHccccccccEEEEEEcccccccHHHHHHHHHHHHHHccEEEEEccccccccccccccccccccccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHHccc
MATKVYIVYYSMYGHVEKLAEEIQKGAASVEGVEAKlwqvpetlsedvlgkmgagpksdvptitpnelaeadgillgfptrFGMMAAQFKAFLDATgglwrsqqlagkpagifystgsqgggqettplTAITQLVHHGmifvpigytfgagmsemekvkggspygagtfagdgsrqpSELELAQAFHQGKYFAGITKKLKGSA
MATKVYIVYYSMYGHVEKLAEEIQKGAASVEGVEAKLWQVPETLSEDVLGKMGAGPKSDVPTITPNELAEADGILLGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGSQGGGQETTPLTAITQLVHHGMIFVPIGYTFGAGMSEMEKVKGGSPYGAGTFAGDGSRQPSELELAQAFHQGKYFAGITKKLKGSA
MATKVYIVYYSMYGHVEKLAEEIQKGAASVEGVEAKLWQVPETLSEDVLGKMGAGPKSDVPTITPNELAEADGILLGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYstgsqgggqettPLTAITQLVHHGMIFVPIGYTFGAGMSEMEKVKGGSPYGAGTFAGDGSRQPSELELAQAFHQGKYFAGITKKLKGSA
***KVYIVYYSMYGHVEKLAEEIQKGAASVEGVEAKLWQVPETLS**V*****************NELAEADGILLGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGSQGGGQETTPLTAITQLVHHGMIFVPIGYTFGAGM********************************AFHQGKYFAGI********
MATKVYIVYYSMYGHVEKLAEEIQKGAASVEGVEAKLWQVPETLSEDVLGKMGAGPKSDVPTITPNELAEADGILLGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGSQGGGQETTPLTAITQLVHHGMIFVPIGYTFGAGMSEMEKVKGGSPYGAGTFA**********ELAQAFHQGKYFAGITKKLKG**
MATKVYIVYYSMYGHVEKLAEEIQKGAASVEGVEAKLWQVPETLSEDVLGKMGAGPKSDVPTITPNELAEADGILLGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGSQGGGQETTPLTAITQLVHHGMIFVPIGYTFGAGMSEMEKVKGGSPYGAGTFAGDGSRQPSELELAQAFHQGKYFAGITKKLKGSA
*ATKVYIVYYSMYGHVEKLAEEIQKGAASVEGVEAKLWQVPETLSEDVLGKMGAGPKSDVPTITPNELAEADGILLGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGSQGGGQETTPLTAITQLVHHGMIFVPIGYTFGAGMSEMEKVKGGSPYGAGTFAGDGSRQPSELELAQAFHQGKYFAGITKKLKG**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATKVYIVYYSMYGHVEKLAEEIQKGAASVEGVEAKLWQVPETLSEDVLGKMGAGPKSDVPTITPNELAEADGILLGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGSQGGGQETTPLTAITQLVHHGMIFVPIGYTFGAGMSEMEKVKGGSPYGAGTFAGDGSRQPSELELAQAFHQGKYFAGITKKLKGSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query203 2.2.26 [Sep-21-2011]
C4XGC2203 Flavoprotein WrbA OS=Desu yes no 0.965 0.965 0.524 3e-51
Q0A961199 Flavoprotein WrbA OS=Alka yes no 0.965 0.984 0.507 1e-50
B9M4V3205 Flavoprotein WrbA OS=Geob yes no 0.960 0.951 0.527 1e-50
Q74F05203 Flavoprotein WrbA OS=Geob yes no 0.970 0.970 0.532 1e-49
Q8Z7N9198 Flavoprotein WrbA OS=Salm N/A no 0.960 0.984 0.502 2e-48
Q39XL1203 Flavoprotein WrbA OS=Geob yes no 0.970 0.970 0.532 2e-48
A8GCS6199 Flavoprotein WrbA OS=Serr yes no 0.960 0.979 0.520 3e-48
Q2RXG7202 Flavoprotein WrbA OS=Rhod yes no 0.955 0.960 0.512 3e-48
A4W916198 Flavoprotein WrbA OS=Ente yes no 0.955 0.979 0.525 3e-48
B5YU47198 Flavoprotein WrbA OS=Esch yes no 0.960 0.984 0.512 3e-48
>sp|C4XGC2|WRBA_DESMR Flavoprotein WrbA OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=wrbA PE=3 SV=1 Back     alignment and function desciption
 Score =  201 bits (511), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 135/202 (66%), Gaps = 6/202 (2%)

Query: 4   KVYIVYYSMYGHVEKLAEEIQKGAASVEGVEAKLWQVPETLSEDVLGKMGAGPK----SD 59
            V IVYYS+YGHV  +A+ + +G   V G+ A L +VPETLSE+V+GKMGA       S 
Sbjct: 2   NVLIVYYSLYGHVAAMAQAVAEGVHQVPGMTATLRRVPETLSEEVIGKMGATEAQKALSH 61

Query: 60  VPTITPNELAEADGILLGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGSQ 119
           VP  T  EL +AD I+ G PTRFG M  Q + FLDATG +W    L GKP G+F ST +Q
Sbjct: 62  VPACTLEELEDADAIVFGTPTRFGNMCGQMRQFLDATGQIWMRGGLVGKPGGVFCSTATQ 121

Query: 120 GGGQETTPLTAITQLVHHGMIFVPIGYTFGAGMSEMEKVKGGSPYGAGTFAG-DGSRQPS 178
            GGQETT ++ I  L+HHGMI V + Y+F AG   +++V GGSPYGA T AG DGSR PS
Sbjct: 122 HGGQETTLMSFIQTLLHHGMIVVGLPYSF-AGQMRLDEVTGGSPYGATTIAGGDGSRMPS 180

Query: 179 ELELAQAFHQGKYFAGITKKLK 200
           E EL  A  QG++ A +T++L+
Sbjct: 181 ENELDAARFQGRHIADVTRRLR 202

Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) (taxid: 573370)
>sp|Q0A961|WRBA_ALHEH Flavoprotein WrbA OS=Alkalilimnicola ehrlichei (strain MLHE-1) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|B9M4V3|WRBA_GEOSF Flavoprotein WrbA OS=Geobacter sp. (strain FRC-32) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|Q74F05|WRBA_GEOSL Flavoprotein WrbA OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|Q8Z7N9|WRBA_SALTI Flavoprotein WrbA OS=Salmonella typhi GN=wrbA PE=3 SV=3 Back     alignment and function description
>sp|Q39XL1|WRBA_GEOMG Flavoprotein WrbA OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|A8GCS6|WRBA_SERP5 Flavoprotein WrbA OS=Serratia proteamaculans (strain 568) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|Q2RXG7|WRBA_RHORT Flavoprotein WrbA OS=Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|A4W916|WRBA_ENT38 Flavoprotein WrbA OS=Enterobacter sp. (strain 638) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|B5YU47|WRBA_ECO5E Flavoprotein WrbA OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=wrbA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query203
255587934203 Minor allergen Alt a, putative [Ricinus 1.0 1.0 0.921 1e-103
359807095207 uncharacterized protein LOC100805113 [Gl 0.990 0.971 0.910 1e-101
351720734205 uncharacterized protein LOC100499662 [Gl 0.990 0.980 0.910 1e-101
255555109203 Flavoprotein wrbA, putative [Ricinus com 1.0 1.0 0.891 1e-101
388520279204 unknown [Lotus japonicus] 0.985 0.980 0.91 1e-101
124488474203 benzoquinone reductase [Gossypium hirsut 1.0 1.0 0.901 1e-101
21068664204 putative quinone oxidoreductase [Cicer a 0.985 0.980 0.91 1e-100
351720697203 uncharacterized protein LOC100499870 [Gl 1.0 1.0 0.891 1e-100
297799264205 quinone reductase family protein [Arabid 1.0 0.990 0.891 1e-100
225461209203 PREDICTED: flavoprotein wrbA isoform 1 [ 1.0 1.0 0.901 1e-100
>gi|255587934|ref|XP_002534445.1| Minor allergen Alt a, putative [Ricinus communis] gi|223525276|gb|EEF27937.1| Minor allergen Alt a, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  378 bits (971), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 187/203 (92%), Positives = 194/203 (95%)

Query: 1   MATKVYIVYYSMYGHVEKLAEEIQKGAASVEGVEAKLWQVPETLSEDVLGKMGAGPKSDV 60
           MATKVYIVYYSMYGHVEKLAEEI+KGAASVEGVEAKLWQVPETL E+VLGKM A PKSDV
Sbjct: 1   MATKVYIVYYSMYGHVEKLAEEIKKGAASVEGVEAKLWQVPETLPEEVLGKMSAPPKSDV 60

Query: 61  PTITPNELAEADGILLGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGSQG 120
           P ITPNELAEADG + GFPTRFGMM+AQFKAFLDATGGLWR+QQLAGKPAGIFYSTGSQG
Sbjct: 61  PIITPNELAEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG 120

Query: 121 GGQETTPLTAITQLVHHGMIFVPIGYTFGAGMSEMEKVKGGSPYGAGTFAGDGSRQPSEL 180
           GGQETT LTAITQLVHHGM+FVPIGYTFGAGM EMEKVKGGSPYGAGT+AGDGSRQPSEL
Sbjct: 121 GGQETTALTAITQLVHHGMLFVPIGYTFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSEL 180

Query: 181 ELAQAFHQGKYFAGITKKLKGSA 203
           EL QAFHQGKYFAGITKKLKGSA
Sbjct: 181 ELEQAFHQGKYFAGITKKLKGSA 203

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359807095|ref|NP_001241601.1| uncharacterized protein LOC100805113 [Glycine max] gi|255638875|gb|ACU19740.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|351720734|ref|NP_001237954.1| uncharacterized protein LOC100499662 [Glycine max] gi|255625625|gb|ACU13157.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255555109|ref|XP_002518592.1| Flavoprotein wrbA, putative [Ricinus communis] gi|223542437|gb|EEF43979.1| Flavoprotein wrbA, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|388520279|gb|AFK48201.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|124488474|gb|ABN12321.1| benzoquinone reductase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|21068664|emb|CAD31838.1| putative quinone oxidoreductase [Cicer arietinum] Back     alignment and taxonomy information
>gi|351720697|ref|NP_001237185.1| uncharacterized protein LOC100499870 [Glycine max] gi|255627281|gb|ACU13985.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297799264|ref|XP_002867516.1| quinone reductase family protein [Arabidopsis lyrata subsp. lyrata] gi|297313352|gb|EFH43775.1| quinone reductase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225461209|ref|XP_002283286.1| PREDICTED: flavoprotein wrbA isoform 1 [Vitis vinifera] gi|147788048|emb|CAN78237.1| hypothetical protein VITISV_016391 [Vitis vinifera] gi|302143167|emb|CBI20462.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query203
TAIR|locus:2131749205 AT4G27270 [Arabidopsis thalian 1.0 0.990 0.827 3.7e-87
TAIR|locus:2178868207 AT5G58800 [Arabidopsis thalian 0.975 0.956 0.608 1.1e-62
TAIR|locus:2115405273 AT4G36750 [Arabidopsis thalian 0.965 0.717 0.609 1.3e-61
CGD|CAL0003649199 PST3 [Candida albicans (taxid: 0.940 0.959 0.520 1.5e-44
TIGR_CMR|GSU_0804203 GSU_0804 "trp repressor bindin 0.965 0.965 0.5 5e-44
ASPGD|ASPL0000059021204 AN0297 [Emericella nidulans (t 0.940 0.936 0.502 6.4e-44
CGD|CAL0003651288 YCP4 [Candida albicans (taxid: 0.975 0.687 0.487 4.5e-43
UNIPROTKB|P0A8G6198 wrbA [Escherichia coli K-12 (t 0.960 0.984 0.467 1.2e-42
UNIPROTKB|G4MTI8204 MGG_01569 "Minor allergen Alt 0.935 0.931 0.472 6.8e-40
CGD|CAL0006260198 PST1 [Candida albicans (taxid: 0.921 0.944 0.473 3.7e-39
TAIR|locus:2131749 AT4G27270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 871 (311.7 bits), Expect = 3.7e-87, P = 3.7e-87
 Identities = 168/203 (82%), Positives = 175/203 (86%)

Query:     1 MATKVYIVYYSMYGHVEKLAEEIQKGAASVEGVEAKLWQVPETLSEDVLGKMGAGPKSDV 60
             MATKVYIVYYSMYGHVEKLA+EI+KGAASV+GVEA LWQVPETL EDVL KM A PKSD 
Sbjct:     1 MATKVYIVYYSMYGHVEKLAQEIRKGAASVDGVEAILWQVPETLQEDVLSKMSAPPKSDA 60

Query:    61 PTITPNELAEADGILLGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYXXXXXX 120
             P ITPNELAEADG + GFPTRFGMMAAQFKAFLDATGGLWR+QQLAGKPAGIFY      
Sbjct:    61 PIITPNELAEADGFIFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG 120

Query:   121 XXXXXXPLTAITQLVHHGMIFVPIGYTFGAGMSEMEKVKGGSPYGAGTFAGDGSRQPSEL 180
                    LTAITQLVHHGMIFVPIGYTFGAGM EME VKGGSPYGAGTFAGDGSRQP+EL
Sbjct:   121 GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMENVKGGSPYGAGTFAGDGSRQPTEL 180

Query:   181 ELAQAFHQGKYFAGITKKLKGSA 203
             EL QAFHQGKY A I+KKLKG A
Sbjct:   181 ELGQAFHQGKYIAAISKKLKGPA 203
GO:0005737 "cytoplasm" evidence=ISM
GO:0010181 "FMN binding" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
TAIR|locus:2178868 AT5G58800 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115405 AT4G36750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
CGD|CAL0003649 PST3 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0804 GSU_0804 "trp repressor binding protein WrbA" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
ASPGD|ASPL0000059021 AN0297 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
CGD|CAL0003651 YCP4 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|P0A8G6 wrbA [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|G4MTI8 MGG_01569 "Minor allergen Alt a 7" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
CGD|CAL0006260 PST1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B7N3F9WRBA_ECOLUNo assigned EC number0.50750.96050.9848yesno
Q1CHD6WRBA_YERPNNo assigned EC number0.5250.96050.9798yesno
Q1C8L9WRBA_YERPANo assigned EC number0.5250.96050.9798yesno
Q0T630WRBA_SHIF8No assigned EC number0.50750.96050.9848yesno
Q8ZF61WRBA_YERPENo assigned EC number0.5250.96050.9798yesno
B5YU47WRBA_ECO5ENo assigned EC number0.51250.96050.9848yesno
Q32HQ6WRBA_SHIDSNo assigned EC number0.510.96550.9898yesno
B7M8Y8WRBA_ECO8ANo assigned EC number0.50750.96050.9848yesno
Q1RDL3WRBA_ECOUTNo assigned EC number0.50750.96050.9848yesno
A8GCS6WRBA_SERP5No assigned EC number0.52020.96050.9798yesno
Q2RXG7WRBA_RHORTNo assigned EC number0.51230.95560.9603yesno
B4TSN0WRBA_SALSVNo assigned EC number0.49740.96050.9848yesno
C4ZQD2WRBA_ECOBWNo assigned EC number0.50750.96050.9848yesno
Q8X4B4WRBA_ECO57No assigned EC number0.51250.96050.9848N/Ano
B1X9C5WRBA_ECODHNo assigned EC number0.50750.96050.9848yesno
Q39XL1WRBA_GEOMGNo assigned EC number0.53200.97040.9704yesno
A0LNQ8WRBA_SYNFMNo assigned EC number0.49250.96050.9558yesno
B6I980WRBA_ECOSENo assigned EC number0.50750.96050.9848yesno
P42058ALTA7_ALTALNo assigned EC number0.56120.94080.9362N/Ano
A7FJ02WRBA_YERP3No assigned EC number0.5250.96050.9798yesno
B5F202WRBA_SALA4No assigned EC number0.49740.96050.9848yesno
A4W916WRBA_ENT38No assigned EC number0.5250.95560.9797yesno
A8AI59WRBA_CITK8No assigned EC number0.49740.96050.9848yesno
Q0A961WRBA_ALHEHNo assigned EC number0.50750.96550.9849yesno
Q8ZQ40WRBA_SALTYNo assigned EC number0.49740.96050.9848yesno
A4TK49WRBA_YERPPNo assigned EC number0.5250.96050.9798yesno
B5R6H0WRBA_SALG2No assigned EC number0.49740.96050.9848yesno
P0A8G6WRBA_ECOLINo assigned EC number0.50750.96050.9848N/Ano
P0A8G7WRBA_ECOL6No assigned EC number0.50750.96050.9848yesno
A7ZYV7WRBA_ECOHSNo assigned EC number0.50750.96050.9848yesno
Q0TJ63WRBA_ECOL5No assigned EC number0.50750.96050.9848yesno
B1IV93WRBA_ECOLCNo assigned EC number0.50750.96050.9848yesno
B9M4V3WRBA_GEOSFNo assigned EC number0.52730.96050.9512yesno
P0A8G8WRBA_SHIFLNo assigned EC number0.50750.96050.9848yesno
Q74F05WRBA_GEOSLNo assigned EC number0.53200.97040.9704yesno
C0Q886WRBA_SALPCNo assigned EC number0.49740.96050.9848yesno
B1LJ00WRBA_ECOSMNo assigned EC number0.50750.96050.9848yesno
A1A9Q9WRBA_ECOK1No assigned EC number0.50750.96050.9848yesno
B5R056WRBA_SALEPNo assigned EC number0.49740.96050.9848yesno
C4XGC2WRBA_DESMRNo assigned EC number0.52470.96550.9655yesno
B2K198WRBA_YERPBNo assigned EC number0.5250.96050.9798yesno
B4T2V2WRBA_SALNSNo assigned EC number0.49740.96050.9848yesno
Q8Z7N9WRBA_SALTINo assigned EC number0.50250.96050.9848N/Ano
A9R7R8WRBA_YERPGNo assigned EC number0.5250.96050.9798yesno
Q66BP3WRBA_YERPSNo assigned EC number0.5250.96050.9798yesno
B5XXP0WRBA_KLEP3No assigned EC number0.520.95560.9797yesno
B1JNA9WRBA_YERPYNo assigned EC number0.5250.96050.9798yesno
B5FR47WRBA_SALDCNo assigned EC number0.49740.96050.9848yesno
B4TEP2WRBA_SALHSNo assigned EC number0.49740.96050.9848yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
Qor
SubName- Full=Putative uncharacterized protein (Chromosome chr19 scaffold_4, whole genome shotgun sequence); (203 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query203
PRK03767200 PRK03767, PRK03767, NAD(P)H:quinone oxidoreductase 1e-85
TIGR01755197 TIGR01755, flav_wrbA, NAD(P)H:quinone oxidoreducta 8e-69
COG0655207 COG0655, WrbA, Multimeric flavodoxin WrbA [General 1e-46
pfam03358151 pfam03358, FMN_red, NADPH-dependent FMN reductase 4e-16
pfam00258142 pfam00258, Flavodoxin_1, Flavodoxin 2e-13
pfam02525192 pfam02525, Flavodoxin_2, Flavodoxin-like fold 1e-04
COG0426388 COG0426, FpaA, Uncharacterized flavoproteins [Ener 1e-04
TIGR01753140 TIGR01753, flav_short, flavodoxin, short chain 3e-04
PRK05569141 PRK05569, PRK05569, flavodoxin; Provisional 0.001
COG0716151 COG0716, FldA, Flavodoxins [Energy production and 0.003
COG0431184 COG0431, COG0431, Predicted flavoprotein [General 0.004
>gnl|CDD|179647 PRK03767, PRK03767, NAD(P)H:quinone oxidoreductase; Provisional Back     alignment and domain information 
 Score =  250 bits (642), Expect = 1e-85
 Identities = 104/200 (52%), Positives = 131/200 (65%), Gaps = 2/200 (1%)

Query: 3   TKVYIVYYSMYGHVEKLAEEIQKGAASVEGVEAKLWQVPETLSEDVLGKMGAGPKSDVPT 62
            KV ++YYSMYGH+E +AE + +GA  V G E  + +VPET+ E+V  K G       P 
Sbjct: 2   AKVLVLYYSMYGHIETMAEAVAEGAREVAGAEVTIKRVPETVPEEVAKKAGGKTDQAAPV 61

Query: 63  ITPNELAEADGILLGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGSQGGG 122
            TP+ELA+ D I+ G PTRFG MA Q + FLD TGGLW    L GK   +F STG+Q GG
Sbjct: 62  ATPDELADYDAIIFGTPTRFGNMAGQMRNFLDQTGGLWAKGALVGKVGSVFTSTGTQHGG 121

Query: 123 QETTPLTAITQLVHHGMIFVPIGYTFGAGMSEMEKVKGGSPYGAGTFA-GDGSRQPSELE 181
           QETT  +  T L+HHGM+ V + Y F  G  ++++V GGSPYGA T A GDGSRQPSE E
Sbjct: 122 QETTITSTHTTLLHHGMVIVGLPYAF-QGQMDVDEVTGGSPYGATTIAGGDGSRQPSENE 180

Query: 182 LAQAFHQGKYFAGITKKLKG 201
           LA A +QG++ A I  KL G
Sbjct: 181 LAGARYQGRHVAEIAAKLAG 200

Length = 200
>gnl|CDD|130816 TIGR01755, flav_wrbA, NAD(P)H:quinone oxidoreductase, type IV Back     alignment and domain information
>gnl|CDD|223728 COG0655, WrbA, Multimeric flavodoxin WrbA [General function prediction only] Back     alignment and domain information
>gnl|CDD|217511 pfam03358, FMN_red, NADPH-dependent FMN reductase Back     alignment and domain information
>gnl|CDD|215823 pfam00258, Flavodoxin_1, Flavodoxin Back     alignment and domain information
>gnl|CDD|217085 pfam02525, Flavodoxin_2, Flavodoxin-like fold Back     alignment and domain information
>gnl|CDD|223503 COG0426, FpaA, Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233559 TIGR01753, flav_short, flavodoxin, short chain Back     alignment and domain information
>gnl|CDD|135442 PRK05569, PRK05569, flavodoxin; Provisional Back     alignment and domain information
>gnl|CDD|223788 COG0716, FldA, Flavodoxins [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223508 COG0431, COG0431, Predicted flavoprotein [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 203
PRK03767200 NAD(P)H:quinone oxidoreductase; Provisional 100.0
TIGR01755197 flav_wrbA NAD(P)H:quinone oxidoreductase, type IV. 100.0
KOG3135203 consensus 1,4-benzoquinone reductase-like; Trp rep 100.0
PRK05569141 flavodoxin; Provisional 99.95
COG0655207 WrbA Multimeric flavodoxin WrbA [General function 99.95
PRK05568142 flavodoxin; Provisional 99.95
PRK06756148 flavodoxin; Provisional 99.95
PRK06703151 flavodoxin; Provisional 99.94
PRK06242150 flavodoxin; Provisional 99.93
TIGR01753140 flav_short flavodoxin, short chain. Flavodoxins ar 99.92
PRK11921394 metallo-beta-lactamase/flavodoxin domain-containin 99.92
PF03358152 FMN_red: NADPH-dependent FMN reductase; InterPro: 99.91
PRK07308146 flavodoxin; Validated 99.91
PRK05452479 anaerobic nitric oxide reductase flavorubredoxin; 99.91
PRK09267169 flavodoxin FldA; Validated 99.9
PRK10569191 NAD(P)H-dependent FMN reductase; Provisional 99.9
TIGR03566174 FMN_reduc_MsuE FMN reductase, MsuE subfamily. Memb 99.88
PRK00170201 azoreductase; Reviewed 99.87
TIGR03567171 FMN_reduc_SsuE FMN reductase, SsuE family. Members 99.86
PRK12359172 flavodoxin FldB; Provisional 99.86
PRK01355199 azoreductase; Reviewed 99.86
COG0426388 FpaA Uncharacterized flavoproteins [Energy product 99.85
PRK13556208 azoreductase; Provisional 99.83
TIGR02690219 resist_ArsH arsenical resistance protein ArsH. Mem 99.83
PRK09739199 hypothetical protein; Provisional 99.83
TIGR01752167 flav_long flavodoxin, long chain. Flavodoxins are 99.83
PRK09271160 flavodoxin; Provisional 99.82
PRK06934221 flavodoxin; Provisional 99.8
PF12682156 Flavodoxin_4: Flavodoxin; PDB: 3EDO_B 3KLB_A. 99.8
TIGR01754140 flav_RNR ribonucleotide reductase-associated flavo 99.8
PRK13555208 azoreductase; Provisional 99.78
PRK07116160 flavodoxin; Provisional 99.78
PF02525199 Flavodoxin_2: Flavodoxin-like fold; InterPro: IPR0 99.76
PRK09004146 FMN-binding protein MioC; Provisional 99.75
COG0716151 FldA Flavodoxins [Energy production and conversion 99.75
PRK11104177 hemG protoporphyrinogen oxidase; Provisional 99.74
PRK04930184 glutathione-regulated potassium-efflux system anci 99.7
COG0431184 Predicted flavoprotein [General function predictio 99.69
PF12641160 Flavodoxin_3: Flavodoxin domain 99.69
COG1182202 AcpD Acyl carrier protein phosphodiesterase [Lipid 99.67
PRK08105149 flavodoxin; Provisional 99.66
PF12724143 Flavodoxin_5: Flavodoxin domain 99.65
PF00258143 Flavodoxin_1: Flavodoxin; InterPro: IPR008254 This 99.63
COG2249189 MdaB Putative NADPH-quinone reductase (modulator o 99.63
COG4635175 HemG Flavodoxin [Energy production and conversion 99.59
PRK00871176 glutathione-regulated potassium-efflux system anci 99.56
PRK05723151 flavodoxin; Provisional 99.54
PRK10953 600 cysJ sulfite reductase subunit alpha; Provisional 99.46
KOG4530199 consensus Predicted flavoprotein [General function 99.41
TIGR01931 597 cysJ sulfite reductase [NADPH] flavoprotein, alpha 99.39
PRK03600134 nrdI ribonucleotide reductase stimulatory protein; 99.18
TIGR00333125 nrdI ribonucleoside-diphosphate reductase 2, opero 98.91
PRK02551154 flavoprotein NrdI; Provisional 98.65
KOG1159 574 consensus NADP-dependent flavoprotein reductase [E 98.43
COG1780141 NrdI Protein involved in ribonucleotide reduction 98.01
PF07972122 Flavodoxin_NdrI: NrdI Flavodoxin like ; InterPro: 97.78
COG0369 587 CysJ Sulfite reductase, alpha subunit (flavoprotei 97.1
PRK10427114 putative PTS system fructose-like transporter subu 96.86
PRK1031094 PTS system galactitol-specific transporter subunit 96.69
COG1440102 CelA Phosphotransferase system cellobiose-specific 96.09
TIGR0085395 pts-lac PTS system, lactose/cellobiose family IIB 95.99
COG1445122 FrwB Phosphotransferase system fructose-specific c 95.9
PRK09590104 celB cellobiose phosphotransferase system IIB comp 95.71
PRK07053234 glutamine amidotransferase; Provisional 95.68
PF0230290 PTS_IIB: PTS system, Lactose/Cellobiose specific I 95.16
PRK10499106 PTS system N,N'-diacetylchitobiose-specific transp 95.05
PRK13143200 hisH imidazole glycerol phosphate synthase subunit 94.85
KOG1160 601 consensus Fe-S oxidoreductase [Energy production a 94.42
COG341493 SgaB Phosphotransferase system, galactitol-specifi 94.27
PF06283217 ThuA: Trehalose utilisation; PDB: 4E5V_A 1T0B_A. 93.89
cd0556599 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of en 93.45
cd0556496 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lic 93.13
cd0556689 PTS_IIB_galactitol PTS_IIB_galactitol: subunit IIB 93.03
PRK13146209 hisH imidazole glycerol phosphate synthase subunit 92.15
PRK06490239 glutamine amidotransferase; Provisional 91.72
CHL00188210 hisH imidazole glycerol phosphate synthase subunit 90.91
cd0556787 PTS_IIB_mannitol PTS_IIB_mannitol: subunit IIB of 90.67
PRK11574196 oxidative-stress-resistance chaperone; Provisional 89.22
PRK08250235 glutamine amidotransferase; Provisional 89.19
PF08357150 SEFIR: SEFIR domain; InterPro: IPR013568 This doma 89.06
cd0556996 PTS_IIB_fructose PTS_IIB_fructose: subunit IIB of 88.58
PRK06895190 putative anthranilate synthase component II; Provi 88.58
PRK11404 482 putative PTS system transporter subunits IIBC; Pro 88.04
PRK13608 391 diacylglycerol glucosyltransferase; Provisional 87.89
PRK05637208 anthranilate synthase component II; Provisional 87.89
PRK09065237 glutamine amidotransferase; Provisional 87.74
cd0013384 PTS_IIB PTS_IIB: subunit IIB of enzyme II (EII) is 87.62
cd0556885 PTS_IIB_bgl_like PTS_IIB_bgl_like: the PTS (phosph 87.32
TIGR0082985 FRU PTS system, fructose-specific, IIB component. 87.13
cd0556386 PTS_IIB_ascorbate PTS_IIB_ascorbate: subunit IIB o 86.99
cd01748198 GATase1_IGP_Synthase Type 1 glutamine amidotransfe 86.83
PRK10017 426 colanic acid biosynthesis protein; Provisional 86.74
PRK02261137 methylaspartate mutase subunit S; Provisional 86.65
PRK13170196 hisH imidazole glycerol phosphate synthase subunit 85.67
PRK09548602 PTS system ascorbate-specific transporter subunits 85.28
PRK11780217 isoprenoid biosynthesis protein with amidotransfer 84.73
PRK01175261 phosphoribosylformylglycinamidine synthase I; Prov 84.7
PRK10712 563 PTS system fructose-specific transporter subunits 84.62
PRK13527200 glutamine amidotransferase subunit PdxT; Provision 83.63
PRK11538105 ribosome-associated protein; Provisional 82.95
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 82.95
PRK13055 334 putative lipid kinase; Reviewed 82.05
PRK13525189 glutamine amidotransferase subunit PdxT; Provision 81.52
cd01750194 GATase1_CobQ Type 1 glutamine amidotransferase (GA 81.0
PRK01372304 ddl D-alanine--D-alanine ligase; Reviewed 80.92
>PRK03767 NAD(P)H:quinone oxidoreductase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.2e-37  Score=240.26  Aligned_cols=199  Identities=53%  Similarity=0.856  Sum_probs=166.2

Q ss_pred             CCceEEEEEecCcchHHHHHHHHHHHhhccCCceEEEEEcCCCCchhHhhhcCCCCCCCCCCCChhhhhccCeEEEeccc
Q 028847            1 MATKVYIVYYSMYGHVEKLAEEIQKGAASVEGVEAKLWQVPETLSEDVLGKMGAGPKSDVPTITPNELAEADGILLGFPT   80 (203)
Q Consensus         1 mm~kilIiy~S~~G~T~~la~~i~~~l~~~~g~~v~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~aD~iiigsP~   80 (203)
                      || ||+|||+|++|||++||+.+++++++..|++++++++.+..+.++...+.+......+....+++.+||+||||||+
T Consensus         1 M~-kilIvy~S~~G~T~~lA~~ia~g~~~~~G~ev~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~aD~ii~gsPt   79 (200)
T PRK03767          1 MA-KVLVLYYSMYGHIETMAEAVAEGAREVAGAEVTIKRVPETVPEEVAKKAGGKTDQAAPVATPDELADYDAIIFGTPT   79 (200)
T ss_pred             CC-eEEEEEcCCCCHHHHHHHHHHHHHhhcCCcEEEEEeccccCCHHHHHhcCCCcccCCCccCHHHHHhCCEEEEEecc
Confidence            65 99999999999999999999999986238999999998766666655444333223333347899999999999999


Q ss_pred             CCCCcHHHHHHHHHHhcccccccCCCCCeEEEEEccCCCCCCchhHHHHHHHHHHHcCcEEecCCCCCCCCCCccccccC
Q 028847           81 RFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGSQGGGQETTPLTAITQLVHHGMIFVPIGYTFGAGMSEMEKVKG  160 (203)
Q Consensus        81 y~~~~~~~lk~fld~~~~~~~~~~l~gK~~~~~~t~g~~~~~~~~~~~~~~~~l~~~g~~~v~~~~~~~~~~~~~~~~~~  160 (203)
                      |++++|+++|+|+|++..+|..+.+.||++++|+++||..++...++..+...|..+||.+++.++.+... ......++
T Consensus        80 y~g~~~~~lk~fld~~~~~~~~~~l~gK~~~~f~s~g~~~Gg~~~~l~~l~~~~~~~gm~vv~~~~~~~~~-~~~~~~~~  158 (200)
T PRK03767         80 RFGNMAGQMRNFLDQTGGLWAKGALVGKVGSVFTSTGTQHGGQETTITSTHTTLLHHGMVIVGLPYAFQGQ-MDVDEVTG  158 (200)
T ss_pred             cCCCchHHHHHHHHHhccccccCCccCCEEEEEEeCCCCCCChHHHHHHHHHHHHHcCCEEeCCCCccccc-cccccccC
Confidence            99999999999999998777666899999999999999777777778888899999999999988876532 11223467


Q ss_pred             CCCCccceecC-CCCCCCCHHHHHHHHHHHHHHHHHHHHhhc
Q 028847          161 GSPYGAGTFAG-DGSRQPSELELAQAFHQGKYFAGITKKLKG  201 (203)
Q Consensus       161 ~~~~g~~~~~~-~~~~~p~~~~~~~~~~~g~~l~~~~~~~~~  201 (203)
                      |++||...+.+ +++.+|+++|++.|+.+|+++++.++++++
T Consensus       159 g~~~G~~~~~~~~~~~~p~~~d~~~a~~~g~r~a~~~~~~~~  200 (200)
T PRK03767        159 GSPYGATTIAGGDGSRQPSENELAGARYQGRHVAEIAAKLAG  200 (200)
T ss_pred             CcccceeeecCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHhC
Confidence            89999999986 788899999999999999999999999864

>TIGR01755 flav_wrbA NAD(P)H:quinone oxidoreductase, type IV Back     alignment and domain information
>KOG3135 consensus 1,4-benzoquinone reductase-like; Trp repressor binding protein-like/protoplast-secreted protein [General function prediction only] Back     alignment and domain information
>PRK05569 flavodoxin; Provisional Back     alignment and domain information
>COG0655 WrbA Multimeric flavodoxin WrbA [General function prediction only] Back     alignment and domain information
>PRK05568 flavodoxin; Provisional Back     alignment and domain information
>PRK06756 flavodoxin; Provisional Back     alignment and domain information
>PRK06703 flavodoxin; Provisional Back     alignment and domain information
>PRK06242 flavodoxin; Provisional Back     alignment and domain information
>TIGR01753 flav_short flavodoxin, short chain Back     alignment and domain information
>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional Back     alignment and domain information
>PF03358 FMN_red: NADPH-dependent FMN reductase; InterPro: IPR005025 NADPH-dependent FMN reductase (1 Back     alignment and domain information
>PRK07308 flavodoxin; Validated Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>PRK09267 flavodoxin FldA; Validated Back     alignment and domain information
>PRK10569 NAD(P)H-dependent FMN reductase; Provisional Back     alignment and domain information
>TIGR03566 FMN_reduc_MsuE FMN reductase, MsuE subfamily Back     alignment and domain information
>PRK00170 azoreductase; Reviewed Back     alignment and domain information
>TIGR03567 FMN_reduc_SsuE FMN reductase, SsuE family Back     alignment and domain information
>PRK12359 flavodoxin FldB; Provisional Back     alignment and domain information
>PRK01355 azoreductase; Reviewed Back     alignment and domain information
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>PRK13556 azoreductase; Provisional Back     alignment and domain information
>TIGR02690 resist_ArsH arsenical resistance protein ArsH Back     alignment and domain information
>PRK09739 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01752 flav_long flavodoxin, long chain Back     alignment and domain information
>PRK09271 flavodoxin; Provisional Back     alignment and domain information
>PRK06934 flavodoxin; Provisional Back     alignment and domain information
>PF12682 Flavodoxin_4: Flavodoxin; PDB: 3EDO_B 3KLB_A Back     alignment and domain information
>TIGR01754 flav_RNR ribonucleotide reductase-associated flavodoxin, putative Back     alignment and domain information
>PRK13555 azoreductase; Provisional Back     alignment and domain information
>PRK07116 flavodoxin; Provisional Back     alignment and domain information
>PF02525 Flavodoxin_2: Flavodoxin-like fold; InterPro: IPR003680 This family consists of a domain with a flavodoxin-like fold Back     alignment and domain information
>PRK09004 FMN-binding protein MioC; Provisional Back     alignment and domain information
>COG0716 FldA Flavodoxins [Energy production and conversion] Back     alignment and domain information
>PRK11104 hemG protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK04930 glutathione-regulated potassium-efflux system ancillary protein KefG; Provisional Back     alignment and domain information
>COG0431 Predicted flavoprotein [General function prediction only] Back     alignment and domain information
>PF12641 Flavodoxin_3: Flavodoxin domain Back     alignment and domain information
>COG1182 AcpD Acyl carrier protein phosphodiesterase [Lipid metabolism] Back     alignment and domain information
>PRK08105 flavodoxin; Provisional Back     alignment and domain information
>PF12724 Flavodoxin_5: Flavodoxin domain Back     alignment and domain information
>PF00258 Flavodoxin_1: Flavodoxin; InterPro: IPR008254 This domain is found in a number of proteins including flavodoxin and nitric-oxide synthase Back     alignment and domain information
>COG2249 MdaB Putative NADPH-quinone reductase (modulator of drug activity B) [General function prediction only] Back     alignment and domain information
>COG4635 HemG Flavodoxin [Energy production and conversion / Coenzyme metabolism] Back     alignment and domain information
>PRK00871 glutathione-regulated potassium-efflux system ancillary protein KefF; Provisional Back     alignment and domain information
>PRK05723 flavodoxin; Provisional Back     alignment and domain information
>PRK10953 cysJ sulfite reductase subunit alpha; Provisional Back     alignment and domain information
>KOG4530 consensus Predicted flavoprotein [General function prediction only] Back     alignment and domain information
>TIGR01931 cysJ sulfite reductase [NADPH] flavoprotein, alpha-component Back     alignment and domain information
>PRK03600 nrdI ribonucleotide reductase stimulatory protein; Reviewed Back     alignment and domain information
>TIGR00333 nrdI ribonucleoside-diphosphate reductase 2, operon protein nrdI Back     alignment and domain information
>PRK02551 flavoprotein NrdI; Provisional Back     alignment and domain information
>KOG1159 consensus NADP-dependent flavoprotein reductase [Energy production and conversion] Back     alignment and domain information
>COG1780 NrdI Protein involved in ribonucleotide reduction [Nucleotide transport and metabolism] Back     alignment and domain information
>PF07972 Flavodoxin_NdrI: NrdI Flavodoxin like ; InterPro: IPR004465 Ribonucleotide reductases (RNRs) are enzymes that provide the precursors of DNA synthesis Back     alignment and domain information
>COG0369 CysJ Sulfite reductase, alpha subunit (flavoprotein) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10427 putative PTS system fructose-like transporter subunit EIIB; Provisional Back     alignment and domain information
>PRK10310 PTS system galactitol-specific transporter subunit IIB; Provisional Back     alignment and domain information
>COG1440 CelA Phosphotransferase system cellobiose-specific component IIB [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00853 pts-lac PTS system, lactose/cellobiose family IIB component Back     alignment and domain information
>COG1445 FrwB Phosphotransferase system fructose-specific component IIB [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09590 celB cellobiose phosphotransferase system IIB component; Reviewed Back     alignment and domain information
>PRK07053 glutamine amidotransferase; Provisional Back     alignment and domain information
>PF02302 PTS_IIB: PTS system, Lactose/Cellobiose specific IIB subunit; InterPro: IPR003501 The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes Back     alignment and domain information
>PRK10499 PTS system N,N'-diacetylchitobiose-specific transporter subunit IIB; Provisional Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>KOG1160 consensus Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>COG3414 SgaB Phosphotransferase system, galactitol-specific IIB component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06283 ThuA: Trehalose utilisation; PDB: 4E5V_A 1T0B_A Back     alignment and domain information
>cd05565 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of enzyme II (EII) of the lactose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) found in Firmicutes as well as Actinobacteria Back     alignment and domain information
>cd05564 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>cd05566 PTS_IIB_galactitol PTS_IIB_galactitol: subunit IIB of enzyme II (EII) of the galactitol-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK06490 glutamine amidotransferase; Provisional Back     alignment and domain information
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>cd05567 PTS_IIB_mannitol PTS_IIB_mannitol: subunit IIB of enzyme II (EII) of the mannitol-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>PRK11574 oxidative-stress-resistance chaperone; Provisional Back     alignment and domain information
>PRK08250 glutamine amidotransferase; Provisional Back     alignment and domain information
>PF08357 SEFIR: SEFIR domain; InterPro: IPR013568 This domain is found in IL17 receptors (IL17Rs, e Back     alignment and domain information
>cd05569 PTS_IIB_fructose PTS_IIB_fructose: subunit IIB of enzyme II (EII) of the fructose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>PRK06895 putative anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK11404 putative PTS system transporter subunits IIBC; Provisional Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK09065 glutamine amidotransferase; Provisional Back     alignment and domain information
>cd00133 PTS_IIB PTS_IIB: subunit IIB of enzyme II (EII) is the central energy-coupling domain of the phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>cd05568 PTS_IIB_bgl_like PTS_IIB_bgl_like: the PTS (phosphotransferase system) IIB domain of a family of sensory systems composed of a membrane-bound sugar-sensor (similar to BglF) and a transcription antiterminator (similar to BglG) which regulate expression of genes involved in sugar utilization Back     alignment and domain information
>TIGR00829 FRU PTS system, fructose-specific, IIB component Back     alignment and domain information
>cd05563 PTS_IIB_ascorbate PTS_IIB_ascorbate: subunit IIB of enzyme II (EII) of the L-ascorbate-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>PRK10017 colanic acid biosynthesis protein; Provisional Back     alignment and domain information
>PRK02261 methylaspartate mutase subunit S; Provisional Back     alignment and domain information
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK09548 PTS system ascorbate-specific transporter subunits IICB; Provisional Back     alignment and domain information
>PRK11780 isoprenoid biosynthesis protein with amidotransferase-like domain; Provisional Back     alignment and domain information
>PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>PRK10712 PTS system fructose-specific transporter subunits IIBC; Provisional Back     alignment and domain information
>PRK13527 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK11538 ribosome-associated protein; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK13055 putative lipid kinase; Reviewed Back     alignment and domain information
>PRK13525 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>cd01750 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ) Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query203
3b6i_A198 Wrba From Escherichia Coli, Native Structure Length 1e-42
2zki_A199 Crystal Structure Of Hypothetical Trp Repressor Bin 1e-23
1zwk_A207 Structure Of Wrba From Pseudomonas Aeruginosa Lengt 7e-23
2a5l_A200 The Crystal Structure Of The Trp Repressor Binding 1e-14
1ydg_A211 Crystal Structure Of Trp Repressor Binding Protein 2e-13
1yrh_A211 Crystal Structure Of Trp Repressor Binding Protein 3e-13
2ark_A188 Structure Of A Flavodoxin From Aquifex Aeolicus Len 3e-08
>pdb|3B6I|A Chain A, Wrba From Escherichia Coli, Native Structure Length = 198 Back     alignment and structure 
Iteration: 1

 Score =  169 bits (428), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 93/199 (46%), Positives = 122/199 (61%), Gaps = 4/199 (2%)
Query: 4   KVYIVYYSMYGHVEKLAEEIQKGAASVEGVEAKLWQVPETLSEDVLGKMGAGPKSDVPTI 63
           KV ++YYSMYGH+E +A  + +GA+ V+G E  + +VPET+   +  K G G     P  
Sbjct: 3   KVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAG-GKTQTAPVA 61
Query: 64  TPNELAEADGILLGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYXXXXXXXXX 123
           TP ELA+ D I+ G PTRFG M+ Q + FLD TGGLW S  L GK A +F          
Sbjct: 62  TPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQE 121
Query: 124 XXXPLTAITQLVHHGMIFVPIGYTFGAGMSEMEKVKGGSPYGAGTFA-GDGSRQPSELEL 182
                T  T L HHGM+ VPIGY     + ++ +V+GG+PYGA T A GDGSRQPS+ EL
Sbjct: 122 QTITST-WTTLAHHGMVIVPIGYA-AQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEEL 179
Query: 183 AQAFHQGKYFAGITKKLKG 201
           + A +QG+Y AG+  KL G
Sbjct: 180 SIARYQGEYVAGLAVKLNG 198
>pdb|2ZKI|A Chain A, Crystal Structure Of Hypothetical Trp Repressor Binding Protein From Sul Folobus Tokodaii (St0872) Length = 199 Back     alignment and structure
>pdb|1ZWK|A Chain A, Structure Of Wrba From Pseudomonas Aeruginosa Length = 207 Back     alignment and structure
>pdb|2A5L|A Chain A, The Crystal Structure Of The Trp Repressor Binding Protein Wrba From Pseudomonas Aeruginosa Length = 200 Back     alignment and structure
>pdb|1YDG|A Chain A, Crystal Structure Of Trp Repressor Binding Protein Wrba Length = 211 Back     alignment and structure
>pdb|1YRH|A Chain A, Crystal Structure Of Trp Repressor Binding Protein Wrba In Complex With Fmn Length = 211 Back     alignment and structure
>pdb|2ARK|A Chain A, Structure Of A Flavodoxin From Aquifex Aeolicus Length = 188 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query203
3b6i_A198 Flavoprotein WRBA; flavoproteins, NADH:quinone oxi 1e-92
2a5l_A200 Trp repressor binding protein WRBA; APC5760, PA094 2e-92
1ydg_A211 Trp repressor binding protein WRBA; tetramer, stru 2e-90
2zki_A199 199AA long hypothetical Trp repressor binding prot 2e-90
3d7n_A193 Flavodoxin, WRBA-like protein; structural genomics 4e-77
2ark_A188 Flavodoxin; FMN, structural genomics, PSI, structu 2e-71
3edo_A151 Flavoprotein, putative Trp repressor binding prote 1e-33
1sqs_A242 Conserved hypothetical protein; structural genomic 3e-15
3hly_A161 Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein 4e-14
5nul_A138 Flavodoxin; electron transport, flavoprotein, FMN; 3e-13
3fni_A159 Putative diflavin flavoprotein A 3; alpha-beta pro 2e-12
3klb_A162 Putative flavoprotein; structural genomi center fo 9e-12
2ohh_A404 Type A flavoprotein FPRA; beta-lactamase like doma 3e-11
1ycg_A398 Nitric oxide reductase; DIIRON site, oxidoreductas 1e-10
2fz5_A137 Flavodoxin; alpha/beta doubly-wound topology, non- 2e-10
1e5d_A402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 3e-10
2q9u_A414 A-type flavoprotein; flavodoxin like, beta lactama 4e-10
1vme_A410 Flavoprotein; TM0755, structural genomics, JCSG, p 3e-09
1rli_A184 Trp repressor binding protein; structural genomics 1e-07
2vzf_A197 NADH-dependent FMN reductase; oxidoreductase; 2.50 2e-07
3k1y_A191 Oxidoreductase; structural genomics, PSI-2, protei 9e-07
1obo_A169 Flavodoxin; electron transfer, flavoprotein, elect 5e-06
3gfs_A174 FMN-dependent NADPH-azoreductase; flavoproteins, q 2e-05
2fzv_A279 Putative arsenical resistance protein; flavin bind 2e-04
2bmv_A164 Flavodoxin; electron transport, flavoprotein, FMN, 2e-04
2q62_A247 ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobi 7e-04
>3b6i_A Flavoprotein WRBA; flavoproteins, NADH:quinone oxidoreductase, FMN; HET: FMN 15P; 1.66A {Escherichia coli} PDB: 2r96_A* 2r97_A 2rg1_A* 3b6j_A* 3b6k_A* 3b6m_A* Length = 198 Back     alignment and structure
 Score =  268 bits (686), Expect = 1e-92
 Identities = 100/200 (50%), Positives = 131/200 (65%), Gaps = 4/200 (2%)

Query: 3   TKVYIVYYSMYGHVEKLAEEIQKGAASVEGVEAKLWQVPETLSEDVLGKMGAGPKSDVPT 62
            KV ++YYSMYGH+E +A  + +GA+ V+G E  + +VPET+   +  K G       P 
Sbjct: 2   AKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGG-KTQTAPV 60

Query: 63  ITPNELAEADGILLGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGSQGGG 122
            TP ELA+ D I+ G PTRFG M+ Q + FLD TGGLW S  L GK A +F STG+ GGG
Sbjct: 61  ATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGT-GGG 119

Query: 123 QETTPLTAITQLVHHGMIFVPIGYTFGAGMSEMEKVKGGSPYGAGTFAG-DGSRQPSELE 181
           QE T  +  T L HHGM+ VPIGY     + ++ +V+GG+PYGA T AG DGSRQPS+ E
Sbjct: 120 QEQTITSTWTTLAHHGMVIVPIGYAA-QELFDVSQVRGGTPYGATTIAGGDGSRQPSQEE 178

Query: 182 LAQAFHQGKYFAGITKKLKG 201
           L+ A +QG+Y AG+  KL G
Sbjct: 179 LSIARYQGEYVAGLAVKLNG 198
>2a5l_A Trp repressor binding protein WRBA; APC5760, PA0949, protein structure initiative, PSI, structural genomics; 1.70A {Pseudomonas aeruginosa} SCOP: c.23.5.8 PDB: 1zwk_A 1zwl_A* Length = 200 Back     alignment and structure
>1ydg_A Trp repressor binding protein WRBA; tetramer, structural genomics, PSI, protein structure initiative; 2.00A {Deinococcus radiodurans} SCOP: c.23.5.8 PDB: 1yrh_A* Length = 211 Back     alignment and structure
>2zki_A 199AA long hypothetical Trp repressor binding protein; alpha/beta structure, transcription; 2.90A {Sulfolobus tokodaii} Length = 199 Back     alignment and structure
>3d7n_A Flavodoxin, WRBA-like protein; structural genomics, PSI, MCS protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens} Length = 193 Back     alignment and structure
>2ark_A Flavodoxin; FMN, structural genomics, PSI, structure initiative, midwest center for structural genomic electron transport; 2.40A {Aquifex aeolicus} SCOP: c.23.5.8 Length = 188 Back     alignment and structure
>3edo_A Flavoprotein, putative Trp repressor binding protein; YP_193882.1, flavoprotein in complex with FMN, structural genomics; HET: MSE FMN; 1.20A {Lactobacillus acidophilus ncfm} Length = 151 Back     alignment and structure
>1sqs_A Conserved hypothetical protein; structural genomics, alpha beta protein, PSI, protein struct initiative; HET: TLA; 1.50A {Streptococcus pneumoniae} SCOP: c.23.5.5 PDB: 2oys_A* Length = 242 Back     alignment and structure
>3hly_A Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein, DFA1, SNR135D, NESG, structural genomics, PSI-2; 2.40A {Synechococcus elongatus pcc 6301} Length = 161 Back     alignment and structure
>5nul_A Flavodoxin; electron transport, flavoprotein, FMN; HET: FMN; 1.60A {Clostridium beijerinckii} SCOP: c.23.5.1 PDB: 2flv_A* 2fvx_A* 1fld_A* 3nll_A* 1fvx_A* 1fla_A* 4nll_A* 5nll_A* 2fox_A* 5ull_A* 2fdx_A* 2fax_A* 6nul_A* 1fln_A* 4nul_A* Length = 138 Back     alignment and structure
>3fni_A Putative diflavin flavoprotein A 3; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.30A {Nostoc SP} PDB: 2klb_A Length = 159 Back     alignment and structure
>3klb_A Putative flavoprotein; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: FMN; 1.75A {Bacteroides fragilis nctc 9343} Length = 162 Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Length = 404 Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Length = 398 Back     alignment and structure
>2fz5_A Flavodoxin; alpha/beta doubly-wound topology, non-covalently bound FMN, electron transport; HET: FNR; NMR {Megasphaera elsdenii} SCOP: c.23.5.1 Length = 137 Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Length = 402 Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Length = 414 Back     alignment and structure
>1vme_A Flavoprotein; TM0755, structural genomics, JCSG, protein STR initiative, PSI, joint center for structural genomics, ELEC transport; HET: MSE; 1.80A {Thermotoga maritima} SCOP: c.23.5.1 d.157.1.3 Length = 410 Back     alignment and structure
>1rli_A Trp repressor binding protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.80A {Bacillus subtilis} SCOP: c.23.5.6 Length = 184 Back     alignment and structure
>2vzf_A NADH-dependent FMN reductase; oxidoreductase; 2.50A {Edta-degrading bacterium BNC1} PDB: 2vzh_A* 2vzj_A* Length = 197 Back     alignment and structure
>3k1y_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, CDR100D; 2.50A {Corynebacterium diphtheriae} PDB: 3k20_A Length = 191 Back     alignment and structure
>1obo_A Flavodoxin; electron transfer, flavoprotein, electron transport; HET: FMN; 1.2A {Anabaena SP} SCOP: c.23.5.1 PDB: 2v5v_A* 1dx9_A 1rcf_A* 1flv_A* 1obv_A* 2v5u_A* 1ftg_A 1qhe_A 2kqu_A 3esy_A* 3esz_A* 3esx_A* Length = 169 Back     alignment and structure
>3gfs_A FMN-dependent NADPH-azoreductase; flavoproteins, quinone reductase, flavodoxin, oligomerization, flavoprotein, oxidoreductase; HET: FMN; 2.10A {Bacillus subtilis} PDB: 1nni_1* 2gsw_A* 3gfr_A* 3gfq_A* Length = 174 Back     alignment and structure
>2fzv_A Putative arsenical resistance protein; flavin binding protein, structural genomics, PSI, protein ST initiative; 1.70A {Shigella flexneri 2A} SCOP: c.23.5.4 Length = 279 Back     alignment and structure
>2bmv_A Flavodoxin; electron transport, flavoprotein, FMN, transport protein; 2.11A {Helicobacter pylori} PDB: 2w5u_A* 1fue_A* Length = 164 Back     alignment and structure
>2q62_A ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobium meliloti} Length = 247 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query203
2a5l_A200 Trp repressor binding protein WRBA; APC5760, PA094 100.0
3b6i_A198 Flavoprotein WRBA; flavoproteins, NADH:quinone oxi 100.0
1ydg_A211 Trp repressor binding protein WRBA; tetramer, stru 100.0
2zki_A199 199AA long hypothetical Trp repressor binding prot 100.0
3d7n_A193 Flavodoxin, WRBA-like protein; structural genomics 99.96
2ark_A188 Flavodoxin; FMN, structural genomics, PSI, structu 99.96
3hly_A161 Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein 99.96
3fni_A159 Putative diflavin flavoprotein A 3; alpha-beta pro 99.96
2vzf_A197 NADH-dependent FMN reductase; oxidoreductase; 2.50 99.94
3fvw_A192 Putative NAD(P)H-dependent FMN reductase; Q8DWD8_s 99.94
1sqs_A242 Conserved hypothetical protein; structural genomic 99.94
3f6r_A148 Flavodoxin; FMN binding, oxidized, electron transp 99.94
5nul_A138 Flavodoxin; electron transport, flavoprotein, FMN; 99.93
2q62_A247 ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobi 99.93
3u7r_A190 NADPH-dependent FMN reductase; alpha/beta twisted 99.93
2fzv_A279 Putative arsenical resistance protein; flavin bind 99.93
1rtt_A193 Conserved hypothetical protein; protein structure 99.92
3k1y_A191 Oxidoreductase; structural genomics, PSI-2, protei 99.92
1f4p_A147 Flavodoxin; electron transport, flavoprotein, FMN, 99.92
2q9u_A414 A-type flavoprotein; flavodoxin like, beta lactama 99.92
2fz5_A137 Flavodoxin; alpha/beta doubly-wound topology, non- 99.91
3gfs_A174 FMN-dependent NADPH-azoreductase; flavoproteins, q 99.91
4hs4_A199 Chromate reductase; triple-layered, A/B/A structur 99.91
1rli_A184 Trp repressor binding protein; structural genomics 99.91
2hpv_A208 FMN-dependent NADH-azoreductase; structural genomi 99.9
1t5b_A201 Acyl carrier protein phosphodiesterase; structural 99.9
1czn_A169 Flavodoxin; FMN binding, redox potential, electron 99.89
2ohh_A404 Type A flavoprotein FPRA; beta-lactamase like doma 99.89
3svl_A193 Protein YIEF; E. coli CHRR enzyme, chromate biorem 99.89
1t0i_A191 YLR011WP; FMN binding protein, flavodoxin, azoredu 99.88
3p0r_A211 Azoreductase; structural genomics, center for stru 99.88
1obo_A169 Flavodoxin; electron transfer, flavoprotein, elect 99.88
3s2y_A199 Chromate reductase; uranium reductase, oxidoreduct 99.81
1ag9_A175 Flavodoxin; electron transport, reductive activati 99.88
3r6w_A212 FMN-dependent NADH-azoreductase 1; nitrofurazone, 99.88
1ykg_A167 SIR-FP, sulfite reductase [NADPH] flavoprotein alp 99.88
2wc1_A182 Flavodoxin; electron transport, flavoprotein; HET: 99.88
4dik_A410 Flavoprotein; TM0755, electron transport, DI-iron 99.88
1d4a_A273 DT-diaphorase, quinone reductase; flavoprotein, ro 99.87
1e5d_A402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 99.87
3lcm_A196 SMU.1420, putative oxidoreductase; NADPH:quinone o 99.87
1yob_A179 Flavodoxin 2, flavodoxin II; alpha-beta fold, non- 99.87
1ycg_A398 Nitric oxide reductase; DIIRON site, oxidoreductas 99.87
3u7i_A223 FMN-dependent NADH-azoreductase 1; structural geno 99.86
3f2v_A192 General stress protein 14; alpha-beta protein., st 99.86
2fcr_A173 Flavodoxin; electron transport; HET: FMN; 1.80A {C 99.86
2hna_A147 Protein MIOC, flavodoxin; alpha-beta sandwich, fla 99.85
3klb_A162 Putative flavoprotein; structural genomi center fo 99.85
2amj_A204 Modulator of drug activity B; oxidoreductase, mena 99.84
3tem_A228 Ribosyldihydronicotinamide dehydrogenase [quinone; 99.83
2bmv_A164 Flavodoxin; electron transport, flavoprotein, FMN, 99.83
4ici_A171 Putative flavoprotein; PF12682 family protein, fla 99.82
3rpe_A218 MDAB, modulator of drug activity B; structural gen 99.82
3edo_A151 Flavoprotein, putative Trp repressor binding prote 99.82
4gi5_A280 Quinone reductase; protein structure initiative, F 99.8
1bvy_F191 Protein (cytochrome P450 BM-3); fatty acid monooxy 99.8
3ha2_A177 NADPH-quinone reductase; structural genomics, PSI- 99.76
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 99.74
3hr4_A219 Nitric oxide synthase, inducible; inducible nitric 99.69
2bpo_A 682 CPR, P450R, NADPH-cytochrom P450 reductase; NADPH- 99.65
3qe2_A 618 CPR, P450R, NADPH--cytochrome P450 reductase; cypo 99.5
2xod_A119 NRDI protein, NRDI; flavoprotein, redox protein, r 99.49
1tll_A 688 Nitric-oxide synthase, brain; reductase module, FM 99.44
1rlj_A139 NRDI protein; flavoprotein, FMN, thioredoxin, alph 99.22
3n3a_C153 Protein NRDI; ribonucleotide reductase, four-helix 99.04
2m1z_A106 LMO0427 protein; homolog PTS system IIB component, 97.61
2kyr_A111 Fructose-like phosphotransferase enzyme IIB compo; 97.59
1tvm_A113 PTS system, galactitol-specific IIB component; pho 96.79
1e2b_A106 Enzyme IIB-cellobiose; phosphotransferase system, 96.73
2r48_A106 Phosphotransferase system (PTS) mannose-specific i 95.92
3czc_A110 RMPB; alpha/beta sandwich, phosphotransferase syst 95.89
2r4q_A106 Phosphotransferase system (PTS) fructose-specific 95.74
3nbm_A108 PTS system, lactose-specific IIBC components; PTS_ 95.56
2l2q_A109 PTS system, cellobiose-specific IIB component (CE; 95.37
3rht_A259 (gatase1)-like protein; structural genomics, PSI-b 94.75
3kkl_A244 Probable chaperone protein HSP33; peptidase, heat 94.38
1vkr_A125 Mannitol-specific PTS system enzyme iiabc compone; 93.94
1u9c_A224 APC35852; structural genomics, protein structure i 92.44
4gud_A211 Imidazole glycerol phosphate synthase subunit His; 92.41
4gdh_A194 DJ-1, uncharacterized protein C22E12.03C; unknown 92.24
3l3b_A242 ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, 91.94
4e5v_A281 Putative THUA-like protein; THUA-like proteins, tr 91.77
1ka9_H200 Imidazole glycerol phosphtate synthase; riken stru 91.68
3ot1_A208 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate 90.14
3efe_A212 THIJ/PFPI family protein; structural GEN csgid, ce 88.66
2ab0_A205 YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase 88.63
4e08_A190 DJ-1 beta; flavodoxin-like fold, stress response, 88.57
3m3p_A250 Glutamine amido transferase; structural genomics, 88.54
3n7t_A247 Macrophage binding protein; seattle structural gen 87.25
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 87.21
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 86.93
2rk3_A197 Protein DJ-1; parkinson'S disease, THIJ, PFPI, cha 86.46
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 85.21
2a9v_A212 GMP synthase; structural genomics, joint center fo 85.2
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 85.11
3l4e_A206 Uncharacterized peptidase LMO0363; hypothetical pr 85.01
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; tr 84.75
1qv9_A283 F420-dependent methylenetetrahydromethanopterin de 84.66
2gk3_A256 Putative cytoplasmic protein; STM3548, structural 84.6
2iuf_A688 Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen 84.2
3f5d_A206 Protein YDEA; unknow protein, PSI-II, nysgrc, stru 84.2
1vhq_A232 Enhancing lycopene biosynthesis protein 2; structu 84.15
1rw7_A243 YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI supe 83.59
3ius_A286 Uncharacterized conserved protein; APC63810, silic 83.08
1t0b_A252 THUA-like protein; trehalose metabolism, NCS symme 82.71
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 82.4
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 82.08
1fy2_A229 Aspartyl dipeptidase; serine protease, catalytic t 81.91
2qv7_A 337 Diacylglycerol kinase DGKB; alpha-beta domain 1, b 81.29
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 80.73
3noq_A231 THIJ/PFPI family protein; DJ-1 superfamily, isocya 80.6
>2a5l_A Trp repressor binding protein WRBA; APC5760, PA0949, protein structure initiative, PSI, structural genomics; 1.70A {Pseudomonas aeruginosa} SCOP: c.23.5.8 PDB: 1zwk_A 1zwl_A* Back     alignment and structure
Probab=100.00  E-value=9.7e-34  Score=216.87  Aligned_cols=195  Identities=40%  Similarity=0.624  Sum_probs=143.8

Q ss_pred             CceEEEEEecCcchHHHHHHHHHHHhhccCCceEEEEEcCCCCchhHhhhcCCCCCCCCCCCChhhhhccCeEEEecccC
Q 028847            2 ATKVYIVYYSMYGHVEKLAEEIQKGAASVEGVEAKLWQVPETLSEDVLGKMGAGPKSDVPTITPNELAEADGILLGFPTR   81 (203)
Q Consensus         2 m~kilIiy~S~~G~T~~la~~i~~~l~~~~g~~v~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~aD~iiigsP~y   81 (203)
                      |+||+|||+|++|||+++|+.+++++++ .|++++++++.+. +.+|..+..|.+++..|....+++.+||+|||+||+|
T Consensus         5 M~kilii~~S~~g~T~~la~~i~~~l~~-~g~~v~~~~l~~~-~~~~~~~~~~~~~~~~~~~~~~~l~~aD~ii~gsP~y   82 (200)
T 2a5l_A            5 SPYILVLYYSRHGATAEMARQIARGVEQ-GGFEARVRTVPAV-STECEAVAPDIPAEGALYATLEDLKNCAGLALGSPTR   82 (200)
T ss_dssp             CCEEEEEECCSSSHHHHHHHHHHHHHHH-TTCEEEEEBCCCE-EC-------------CCBCCHHHHHTCSEEEEEEECB
T ss_pred             cceEEEEEeCCCChHHHHHHHHHHHHhh-CCCEEEEEEhhhc-cchhhhhccccccccCchhhHHHHHHCCEEEEEcChh
Confidence            4599999999999999999999999988 4899999999886 4444433233222222333478899999999999999


Q ss_pred             CCCcHHHHHHHHHHhcccccccCCCCCeEEEEEccCCCCCCchhHHHHHHHHHHHcCcEEecCCCCCCCCCCccccccCC
Q 028847           82 FGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGSQGGGQETTPLTAITQLVHHGMIFVPIGYTFGAGMSEMEKVKGG  161 (203)
Q Consensus        82 ~~~~~~~lk~fld~~~~~~~~~~l~gK~~~~~~t~g~~~~~~~~~~~~~~~~l~~~g~~~v~~~~~~~~~~~~~~~~~~~  161 (203)
                      |+++|+++|+|||++...|....++||++++|+++|+..++...++..+...|...|+.+++..+..+..   ...++.+
T Consensus        83 ~~~~~~~lk~~ld~~~~~~~~~~l~~K~~~~~~t~g~~~~~~~~~~~~l~~~l~~~g~~~~~~~~~~~~~---~~~~~~~  159 (200)
T 2a5l_A           83 FGNMASPLKYFLDGTSSLWLTGSLVGKPAAVFTSTASLHGGQETTQLSMLLPLLHHGMLVLGIPYSEPAL---LETRGGG  159 (200)
T ss_dssp             TTBCCHHHHHHHHTCHHHHHHTTTTTCEEEEEEEBSCSSCCHHHHHHHHHHHHHHTTCEECCCCC---------------
T ss_pred             ccCccHHHHHHHHHHHHHhhccccCCCEEEEEEecCCCCCCHHHHHHHHHHHHHHCCCEEECCCCCCccc---cccccCC
Confidence            9999999999999987655445789999999999998766655567788888889999999876542110   0012234


Q ss_pred             CCCccceecC-CCCCCCCHHHHHHHHHHHHHHHHHHHHhhc
Q 028847          162 SPYGAGTFAG-DGSRQPSELELAQAFHQGKYFAGITKKLKG  201 (203)
Q Consensus       162 ~~~g~~~~~~-~~~~~p~~~~~~~~~~~g~~l~~~~~~~~~  201 (203)
                      ..+|.+.+.+ +++..|+++++++|+++|++|++.++++.+
T Consensus       160 ~~~~~~~~~~~~~~~~p~~~~~~~a~~~g~~l~~~~~~~~~  200 (200)
T 2a5l_A          160 TPYGASHFAGADGKRSLDEHELTLCRALGKRLAETAGKLGS  200 (200)
T ss_dssp             CTTSBCCBCCTTSCCCCCHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             CCcceeeeeCCCCCCCCCHHHHHHHHHHHHHHHHHHHHhhC
Confidence            5566666543 455689999999999999999999988753
>3b6i_A Flavoprotein WRBA; flavoproteins, NADH:quinone oxidoreductase, FMN; HET: FMN 15P; 1.66A {Escherichia coli} PDB: 2r96_A* 2r97_A 2rg1_A* 3b6j_A* 3b6k_A* 3b6m_A* Back     alignment and structure
>1ydg_A Trp repressor binding protein WRBA; tetramer, structural genomics, PSI, protein structure initiative; 2.00A {Deinococcus radiodurans} SCOP: c.23.5.8 PDB: 1yrh_A* Back     alignment and structure
>2zki_A 199AA long hypothetical Trp repressor binding protein; alpha/beta structure, transcription; 2.90A {Sulfolobus tokodaii} Back     alignment and structure
>3d7n_A Flavodoxin, WRBA-like protein; structural genomics, PSI, MCS protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens} Back     alignment and structure
>2ark_A Flavodoxin; FMN, structural genomics, PSI, structure initiative, midwest center for structural genomic electron transport; 2.40A {Aquifex aeolicus} SCOP: c.23.5.8 Back     alignment and structure
>3hly_A Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein, DFA1, SNR135D, NESG, structural genomics, PSI-2; 2.40A {Synechococcus elongatus pcc 6301} Back     alignment and structure
>3fni_A Putative diflavin flavoprotein A 3; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.30A {Nostoc SP} PDB: 2klb_A Back     alignment and structure
>2vzf_A NADH-dependent FMN reductase; oxidoreductase; 2.50A {Edta-degrading bacterium BNC1} PDB: 2vzh_A* 2vzj_A* Back     alignment and structure
>3fvw_A Putative NAD(P)H-dependent FMN reductase; Q8DWD8_strmu, SMR99, NESG, structural genomics, PSI-2, protein structure initiative; 2.30A {Streptococcus mutans} Back     alignment and structure
>1sqs_A Conserved hypothetical protein; structural genomics, alpha beta protein, PSI, protein struct initiative; HET: TLA; 1.50A {Streptococcus pneumoniae} SCOP: c.23.5.5 PDB: 2oys_A* Back     alignment and structure
>3f6r_A Flavodoxin; FMN binding, oxidized, electron transport, flavoprotein, FMN, transport; HET: FMN; 2.00A {Desulfovibrio desulfuricans} SCOP: c.23.5.0 PDB: 3f6s_A* 3f90_A* 3kap_A* 3kaq_A* Back     alignment and structure
>5nul_A Flavodoxin; electron transport, flavoprotein, FMN; HET: FMN; 1.60A {Clostridium beijerinckii} SCOP: c.23.5.1 PDB: 2flv_A* 2fvx_A* 1fld_A* 3nll_A* 1fvx_A* 1fla_A* 4nll_A* 5nll_A* 2fox_A* 5ull_A* 2fdx_A* 2fax_A* 6nul_A* 1fln_A* 4nul_A* Back     alignment and structure
>2q62_A ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobium meliloti} Back     alignment and structure
>3u7r_A NADPH-dependent FMN reductase; alpha/beta twisted open-sheet, lavoprotein, quinone reductas oxidoreductase; HET: MSE FNR 2PE; 1.40A {Paracoccus denitrificans} Back     alignment and structure
>2fzv_A Putative arsenical resistance protein; flavin binding protein, structural genomics, PSI, protein ST initiative; 1.70A {Shigella flexneri 2A} SCOP: c.23.5.4 Back     alignment and structure
>1rtt_A Conserved hypothetical protein; protein structure initiative, SAD with sulfur, putative REDU PSI; 1.28A {Pseudomonas aeruginosa} SCOP: c.23.5.4 PDB: 1x77_A* Back     alignment and structure
>3k1y_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, CDR100D; 2.50A {Corynebacterium diphtheriae} PDB: 3k20_A Back     alignment and structure
>1f4p_A Flavodoxin; electron transport, flavoprotein, FMN, 3D-STRCTURE, anisotropic refinement, redox protein; HET: FMN; 1.30A {Desulfovibrio vulgaris} SCOP: c.23.5.1 PDB: 1bu5_A* 1c7f_A* 1c7e_A* 1akr_A* 1fx1_A* 1akt_A* 1akq_A* 1aku_A* 1akv_A* 1azl_A* 1j8q_A* 2fx2_A* 3fx2_A* 4fx2_A* 5fx2_A* 1akw_A* 1i1o_A* 1wsw_A* 1wsb_A* 1xyv_A* ... Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Back     alignment and structure
>2fz5_A Flavodoxin; alpha/beta doubly-wound topology, non-covalently bound FMN, electron transport; HET: FNR; NMR {Megasphaera elsdenii} SCOP: c.23.5.1 Back     alignment and structure
>3gfs_A FMN-dependent NADPH-azoreductase; flavoproteins, quinone reductase, flavodoxin, oligomerization, flavoprotein, oxidoreductase; HET: FMN; 2.10A {Bacillus subtilis} SCOP: c.23.5.4 PDB: 1nni_1* 2gsw_A* 3gfr_A* 3gfq_A* Back     alignment and structure
>4hs4_A Chromate reductase; triple-layered, A/B/A structure, NAD(P)H-dependent FMN reduc oxidoreductase; HET: FMN; 2.10A {Gluconacetobacter hansenii} PDB: 3s2y_A* 4h6p_A* Back     alignment and structure
>1rli_A Trp repressor binding protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.80A {Bacillus subtilis} SCOP: c.23.5.6 Back     alignment and structure
>2hpv_A FMN-dependent NADH-azoreductase; structural genomics, PS protein structure initiative, southeast collaboratory for S genomics, secsg; HET: FMN; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1t5b_A Acyl carrier protein phosphodiesterase; structural genomics, FMN, alpha/beta/alpha sandwich, PSI, protein structure initiative; HET: FMN; 1.40A {Salmonella typhimurium} SCOP: c.23.5.3 PDB: 1tik_A 2z98_A* 2d5i_A* 1v4b_A* 2z9b_A* 2z9c_A* 2z9d_A* Back     alignment and structure
>1czn_A Flavodoxin; FMN binding, redox potential, electron transport; HET: FMN; 1.70A {Synechococcus elongatus} SCOP: c.23.5.1 PDB: 1czl_A* 1czu_A* 1d04_A* 1ofv_A* 1czr_A* 1czk_A* 1czo_A* 1czh_A* 1d03_A* Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Back     alignment and structure
>3svl_A Protein YIEF; E. coli CHRR enzyme, chromate bioremediation, tetramer role, mutant enzymes, oxidoreductase; HET: FMN; 2.20A {Escherichia coli} Back     alignment and structure
>1t0i_A YLR011WP; FMN binding protein, flavodoxin, azoreductase, oxidoreductase; HET: FMN; 2.00A {Saccharomyces cerevisiae} SCOP: c.23.5.4 Back     alignment and structure
>3p0r_A Azoreductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 1.80A {Bacillus anthracis} Back     alignment and structure
>1obo_A Flavodoxin; electron transfer, flavoprotein, electron transport; HET: FMN; 1.2A {Anabaena SP} SCOP: c.23.5.1 PDB: 2v5v_A* 1dx9_A 1rcf_A* 1flv_A* 1obv_A* 2v5u_A* 1ftg_A 1qhe_A 2kqu_A 3esy_A* 3esz_A* 3esx_A* Back     alignment and structure
>3s2y_A Chromate reductase; uranium reductase, oxidoreductase; HET: FMN PG4; 2.24A {Gluconacetobacter hansenii} Back     alignment and structure
>1ag9_A Flavodoxin; electron transport, reductive activation; HET: FMN BTB; 1.80A {Escherichia coli} SCOP: c.23.5.1 PDB: 1ahn_A* Back     alignment and structure
>3r6w_A FMN-dependent NADH-azoreductase 1; nitrofurazone, P. aeruginosa, nitroreductase, flavodoxin, oxidoreductase; HET: FMN NFZ; 2.08A {Pseudomonas aeruginosa} PDB: 3lt5_A* 2v9c_A* 3keg_A* Back     alignment and structure
>1ykg_A SIR-FP, sulfite reductase [NADPH] flavoprotein alpha- component; electron transport; HET: FMN; NMR {Escherichia coli} SCOP: c.23.5.2 Back     alignment and structure
>2wc1_A Flavodoxin; electron transport, flavoprotein; HET: FMN; 2.17A {Rhodobacter capsulatus} Back     alignment and structure
>4dik_A Flavoprotein; TM0755, electron transport, DI-iron protein; 1.75A {Thermotoga maritima} PDB: 4dil_A 1vme_A* Back     alignment and structure
>1d4a_A DT-diaphorase, quinone reductase; flavoprotein, rossman fold, oxidoreductase; HET: FAD; 1.70A {Homo sapiens} SCOP: c.23.5.3 PDB: 1dxo_A* 1gg5_A* 1kbo_A* 1kbq_A* 2f1o_A* 3jsx_A* 1h69_A* 1h66_A* 1qbg_A* 1dxq_A* 1qrd_A* Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>3lcm_A SMU.1420, putative oxidoreductase; NADPH:quinone oxidoreductase, MDAB; HET: FAD NAP; 1.80A {Streptococcus mutans} PDB: 4f8y_A* Back     alignment and structure
>1yob_A Flavodoxin 2, flavodoxin II; alpha-beta fold, non- covalently bound FMN, electron transport; HET: FMN; 2.25A {Azotobacter vinelandii} SCOP: c.23.5.1 Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Back     alignment and structure
>3u7i_A FMN-dependent NADH-azoreductase 1; structural genomics, the center for structural genomics of I diseases, csgid, oxidoreductase; HET: MSE; 1.75A {Bacillus anthracis} Back     alignment and structure
>3f2v_A General stress protein 14; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: FMN; 2.00A {Treponema denticola} Back     alignment and structure
>2fcr_A Flavodoxin; electron transport; HET: FMN; 1.80A {Chondrus crispus} SCOP: c.23.5.1 Back     alignment and structure
>2hna_A Protein MIOC, flavodoxin; alpha-beta sandwich, flavodoxin fold, electron transport; NMR {Escherichia coli} PDB: 2hnb_A Back     alignment and structure
>3klb_A Putative flavoprotein; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: FMN; 1.75A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2amj_A Modulator of drug activity B; oxidoreductase, menadione, DT-diaphorase, montreal-kingston structural genomics initiative, BSGI; 1.80A {Escherichia coli} PDB: 2b3d_A* Back     alignment and structure
>3tem_A Ribosyldihydronicotinamide dehydrogenase [quinone; oxidoreductase-oxidoreductase inhibitor complex; HET: FAD 6A1 IMD; 1.45A {Homo sapiens} SCOP: c.23.5.3 PDB: 3te7_A* 3tzb_A* 3fw1_A* 2qwx_A* 1zx1_A* 3g5m_A* 3gam_A* 3ovm_A* 3owh_A* 3owx_A* 3ox1_A* 3ox2_A* 3ox3_A* 1sg0_A* 1qr2_A* 1xi2_A* 2qmy_A* 2qmz_A* 2qr2_A* 2qx4_A* ... Back     alignment and structure
>2bmv_A Flavodoxin; electron transport, flavoprotein, FMN, transport protein; 2.11A {Helicobacter pylori} PDB: 2w5u_A* 1fue_A* Back     alignment and structure
>4ici_A Putative flavoprotein; PF12682 family protein, flavodoxin_4, structural genomics, J center for structural genomics, JCSG; HET: MSE FMN EPE; 1.40A {Bacteroides eggerthii} Back     alignment and structure
>3rpe_A MDAB, modulator of drug activity B; structural genomics, center for structural genomics of infec diseases, csgid, flavodoxin-like fold; HET: FAD; 1.10A {Yersinia pestis} Back     alignment and structure
>3edo_A Flavoprotein, putative Trp repressor binding protein; YP_193882.1, flavoprotein in complex with FMN, structural genomics; HET: MSE FMN; 1.20A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>4gi5_A Quinone reductase; protein structure initiative, FAD bound, structural genomics, PSI-biology; HET: FAD; 1.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1bvy_F Protein (cytochrome P450 BM-3); fatty acid monooxygenase, hemoprotein, flavoprotein, electron transfer, oxidoreductase; HET: HEM FMN; 2.03A {Bacillus megaterium} SCOP: c.23.5.1 Back     alignment and structure
>3ha2_A NADPH-quinone reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics, consortium, NESG; HET: MSE; 1.80A {Pediococcus pentosaceus atcc 25745} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3hr4_A Nitric oxide synthase, inducible; inducible nitric oxide synthase, NOS, INOS, CALM binding, FAD, FMN, heme, iron, metal-binding, NADP, oxidore phosphoprotein; HET: FMN; 2.50A {Homo sapiens} Back     alignment and structure
>2bpo_A CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytochrome P450 reductase, diflavin reductase, FAD, FMN-binding, electron transfer; HET: FAD FMN NAP; 2.9A {Saccharomyces cerevisiae} PDB: 2bn4_A* 2bf4_A* Back     alignment and structure
>3qe2_A CPR, P450R, NADPH--cytochrome P450 reductase; cypor, antley-bixler syndrome, flavoprotein, FMN, FAD, oxidoreductase; HET: FAD FMN NAP; 1.75A {Homo sapiens} PDB: 3qfc_A* 3qfr_A* 1amo_A* 1j9z_A* 1ja0_A* 1ja1_A* 3es9_A* 3ojw_A* 3ojx_A* 3fjo_A* 1b1c_A* Back     alignment and structure
>2xod_A NRDI protein, NRDI; flavoprotein, redox protein, ribonucleotide reductase; HET: FMN; 0.96A {Bacillus anthracis} PDB: 2xoe_A* 2x2o_A* 2x2p_A* Back     alignment and structure
>1tll_A Nitric-oxide synthase, brain; reductase module, FMN, FAD, NADP+, oxidoreductase; HET: FMN FAD NAP; 2.30A {Rattus norvegicus} SCOP: b.43.4.1 c.23.5.2 c.25.1.4 Back     alignment and structure
>1rlj_A NRDI protein; flavoprotein, FMN, thioredoxin, alpha/beta/alpha sandwich, structural genomics, PSI, protein structure initiative; HET: FMN; 2.00A {Bacillus subtilis} SCOP: c.23.5.7 Back     alignment and structure
>3n3a_C Protein NRDI; ribonucleotide reductase, four-helix bundle, dimanganese CLU flavoprotein, oxidoreductase; HET: FMN; 1.99A {Escherichia coli} PDB: 3n39_C* 3n3b_C* Back     alignment and structure
>2m1z_A LMO0427 protein; homolog PTS system IIB component, transferase; NMR {Listeria monocytogenes egd-e} Back     alignment and structure
>2kyr_A Fructose-like phosphotransferase enzyme IIB compo; ALP protein, structural genomics, PSI-2; NMR {Escherichia coli} Back     alignment and structure
>1tvm_A PTS system, galactitol-specific IIB component; phosphotransferase system (PTS), P-loop; NMR {Escherichia coli} Back     alignment and structure
>1e2b_A Enzyme IIB-cellobiose; phosphotransferase system, transferas transport, phosphorylation; NMR {Escherichia coli} SCOP: c.44.2.1 PDB: 1iib_A 1h9c_A* 2wwv_D 2wy2_D Back     alignment and structure
>2r48_A Phosphotransferase system (PTS) mannose-specific iibca component; PTS system, fructose specific IIB PFAM02379, PSI-2, MCSG; 1.80A {Bacillus subtilis subsp} SCOP: c.44.2.2 Back     alignment and structure
>3czc_A RMPB; alpha/beta sandwich, phosphotransferase system, transferase, transport; 2.02A {Streptococcus mutans} Back     alignment and structure
>2r4q_A Phosphotransferase system (PTS) fructose-specific iiabc component; fructose specific IIB subunit, PF structural genomics, PSI-2; HET: MSE; 1.60A {Bacillus subtilis subsp} SCOP: c.44.2.2 Back     alignment and structure
>3nbm_A PTS system, lactose-specific IIBC components; PTS_IIB_LACTOSE, phosphoenolpyruvate:carbohydrate system, P- phosphorylation; HET: MSE; 1.30A {Streptococcus pneumoniae} Back     alignment and structure
>2l2q_A PTS system, cellobiose-specific IIB component (CE; cellobiose-specific phosphotransferase IIB component, struct genomics; NMR {Borrelia burgdorferi} Back     alignment and structure
>3rht_A (gatase1)-like protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.83A {Planctomyces limnophilus} Back     alignment and structure
>3kkl_A Probable chaperone protein HSP33; peptidase, heat shock protein, hydrolase, protease, stress response; 2.03A {Saccharomyces cerevisiae} PDB: 3mii_A* Back     alignment and structure
>1vkr_A Mannitol-specific PTS system enzyme iiabc compone; phosphotransferase, transferase, kinase, sugar transport; NMR {Escherichia coli} SCOP: c.44.2.1 PDB: 1vrv_A* 2few_B* Back     alignment and structure
>1u9c_A APC35852; structural genomics, protein structure initiative, MCSG, PAR disease, chaperone, cysteine protease, PSI; 1.35A {Geobacillus stearothermophilus} SCOP: c.23.16.2 Back     alignment and structure
>4gud_A Imidazole glycerol phosphate synthase subunit His; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE 1PE; 1.91A {Vibrio cholerae} Back     alignment and structure
>4gdh_A DJ-1, uncharacterized protein C22E12.03C; unknown function, cysteine oxidation; 1.05A {Schizosaccharomyces pombe} PDB: 4ge3_A 4ge0_A Back     alignment and structure
>3l3b_A ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography, isopr biosynthesis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>4e5v_A Putative THUA-like protein; THUA-like proteins, trehalose utilisation, structural genomi center for structural genomics, JCSG; 1.75A {Parabacteroides merdae} Back     alignment and structure
>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 Back     alignment and structure
>3ot1_A 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme; csgid, structural genomics; HET: MSE CSX; 1.16A {Vibrio cholerae o1 biovar el tor} SCOP: c.23.16.0 Back     alignment and structure
>3efe_A THIJ/PFPI family protein; structural GEN csgid, center for structural genomics of infectious disease chaperone; 2.30A {Bacillus anthracis} Back     alignment and structure
>2ab0_A YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase fold, unknown function; 1.10A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>4e08_A DJ-1 beta; flavodoxin-like fold, stress response, motor protein; 2.00A {Drosophila melanogaster} Back     alignment and structure
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Back     alignment and structure
>3n7t_A Macrophage binding protein; seattle structural genomics center for infectious disease, S macrophage, pathogenic fungus, coccidioidomycosis; 2.10A {Coccidioides immitis} SCOP: c.23.16.0 Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2rk3_A Protein DJ-1; parkinson'S disease, THIJ, PFPI, chaperone, cytoplasm, disease mutation, nucleus, oncogene, oxidation, parkinson disease; 1.05A {Homo sapiens} PDB: 1pdv_A 1pdw_A 3cy6_A 1pe0_A 3cza_A 3cyf_A 2rk4_A 3cz9_A* 3ezg_A 3f71_A 3sf8_A 1p5f_A 1ps4_A 1q2u_A 1soa_A 1ucf_A 2or3_A 3bwe_A 3b38_A 3b36_A ... Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3l4e_A Uncharacterized peptidase LMO0363; hypothetical protein LMO0363, csgid, similar to peptidase E, hydrolase, protease, serine protease; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Back     alignment and structure
>1qv9_A F420-dependent methylenetetrahydromethanopterin dehydrogenase; monomer: alpha/beta domain, helix bundle, trimer of dimers, oxidoreductase; HET: MSE; 1.54A {Methanopyrus kandleri} SCOP: c.127.1.1 PDB: 1u6i_A 1u6j_A 1u6k_A* 3iqe_A* 3iqf_A* 3iqz_A* Back     alignment and structure
>2gk3_A Putative cytoplasmic protein; STM3548, structural genomics, PSI, P structure initiative; 2.25A {Salmonella typhimurium} SCOP: c.23.16.9 Back     alignment and structure
>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* Back     alignment and structure
>3f5d_A Protein YDEA; unknow protein, PSI-II, nysgrc, structural genomics, protein structure initiative; 2.06A {Bacillus subtilis} Back     alignment and structure
>1vhq_A Enhancing lycopene biosynthesis protein 2; structural genomics, unknown function; 1.65A {Escherichia coli} SCOP: c.23.16.2 PDB: 1oy1_A Back     alignment and structure
>1rw7_A YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI superfamily, unknown function; 1.80A {Saccharomyces cerevisiae} SCOP: c.23.16.2 PDB: 1qvv_A* 1qvz_A 1qvw_A Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1t0b_A THUA-like protein; trehalose metabolism, NCS symmetry, structural genomics, PSI, protein structure initiative; 1.70A {Geobacillus stearothermophilus} SCOP: c.23.16.6 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1fy2_A Aspartyl dipeptidase; serine protease, catalytic triad, strand-helix MO hydrolase; 1.20A {Salmonella typhimurium} SCOP: c.23.16.4 PDB: 1fye_A Back     alignment and structure
>2qv7_A Diacylglycerol kinase DGKB; alpha-beta domain 1, beta sandwich domain 2, protein-ADP COM transferase; HET: ADP; 2.30A {Staphylococcus aureus} SCOP: e.52.1.2 PDB: 2qvl_A Back     alignment and structure
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Back     alignment and structure
>3noq_A THIJ/PFPI family protein; DJ-1 superfamily, isocyanide hydratase, isonitrIle hydratase; HET: NHE; 1.00A {Pseudomonas fluorescens} PDB: 3noo_A 3non_A 3nor_A* 3nov_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 203
d1ydga_201 c.23.5.8 (A:) Trp repressor binding protein WrbA { 4e-53
d2a5la1196 c.23.5.8 (A:3-198) Trp repressor binding protein W 2e-50
d2arka1184 c.23.5.8 (A:1-184) Flavodoxin FldA {Aquifex aeolic 2e-37
d1e5da1152 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreduct 4e-20
d1sqsa_232 c.23.5.5 (A:) Hypothetical protein SP1951 {(Strept 2e-17
d1ycga1149 c.23.5.1 (A:251-399) Nitric oxide reductase C-term 4e-16
d1vmea1148 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, 4e-15
d1rlia_179 c.23.5.6 (A:) Hypothetical protein YwqN {Bacillus 4e-15
d5nula_138 c.23.5.1 (A:) Flavodoxin {Clostridium beijerinckii 5e-11
d2fz5a1137 c.23.5.1 (A:1-137) Flavodoxin {Megasphaera elsdeni 3e-07
d1f4pa_147 c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [ 2e-05
d1t0ia_185 c.23.5.4 (A:) Hypothetical protein Ylr011wp {Baker 6e-05
d1oboa_169 c.23.5.1 (A:) Flavodoxin {Anabaena, pcc 7119 and 7 0.002
>d1ydga_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]} Length = 201 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Flavoproteins
family: WrbA-like
domain: Trp repressor binding protein WrbA
species: Deinococcus radiodurans [TaxId: 1299]

 Score =  166 bits (422), Expect = 4e-53
 Identities = 70/205 (34%), Positives = 95/205 (46%), Gaps = 13/205 (6%)

Query: 4   KVYIVYYSMYGHVEKLAEEIQKGAASVEGVEAKLWQVPETLSEDVLG-----KMGAGPKS 58
           K+ IV+YS  G    +A+E  +   +  G E +L +V ET  +DV+      K       
Sbjct: 4   KLAIVFYSSTGTGYAMAQEAAEAGRA-AGAEVRLLKVRETAPQDVIDGQDAWKANIEAMK 62

Query: 59  DVPTITPNELAEADGILLGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGS 118
           DVP  TP +L  A+ I+   PTRFG   +Q +AF+D  GGLW S +LA K      S  +
Sbjct: 63  DVPEATPADLEWAEAIVFSSPTRFGGATSQMRAFIDTLGGLWSSGKLANKTFSAMTSAQN 122

Query: 119 QGGGQETTPLTAITQLVHHGMIFVPIGYTFGAGMSEMEKVKGGSPYGAGTFAGDGSRQPS 178
             GGQETT  T     +H G +  P GYT            GG+PYGA   A    +   
Sbjct: 123 VNGGQETTLQTLYMTAMHWGAVLTPPGYTDEVIF-----KSGGNPYGASVTANG--QPLL 175

Query: 179 ELELAQAFHQGKYFAGITKKLKGSA 203
           E + A   HQ +    +T KL    
Sbjct: 176 ENDRASIRHQVRRQVELTAKLLEGG 200
>d2a5la1 c.23.5.8 (A:3-198) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]} Length = 196 Back     information, alignment and structure
>d2arka1 c.23.5.8 (A:1-184) Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]} Length = 184 Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Length = 152 Back     information, alignment and structure
>d1sqsa_ c.23.5.5 (A:) Hypothetical protein SP1951 {(Streptococcus pneumoniae) [TaxId: 1313]} Length = 232 Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Length = 149 Back     information, alignment and structure
>d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 148 Back     information, alignment and structure
>d1rlia_ c.23.5.6 (A:) Hypothetical protein YwqN {Bacillus subtilis [TaxId: 1423]} Length = 179 Back     information, alignment and structure
>d5nula_ c.23.5.1 (A:) Flavodoxin {Clostridium beijerinckii [TaxId: 1520]} Length = 138 Back     information, alignment and structure
>d2fz5a1 c.23.5.1 (A:1-137) Flavodoxin {Megasphaera elsdenii [TaxId: 907]} Length = 137 Back     information, alignment and structure
>d1f4pa_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} Length = 147 Back     information, alignment and structure
>d1t0ia_ c.23.5.4 (A:) Hypothetical protein Ylr011wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 185 Back     information, alignment and structure
>d1oboa_ c.23.5.1 (A:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]} Length = 169 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query203
d1ydga_201 Trp repressor binding protein WrbA {Deinococcus ra 100.0
d2a5la1196 Trp repressor binding protein WrbA {Pseudomonas ae 100.0
d2arka1184 Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]} 100.0
d1e5da1152 Rubredoxin oxygen:oxidoreductase (ROO), C-terminal 99.97
d1ycga1149 Nitric oxide reductase C-terminal domain {Moorella 99.97
d1sqsa_232 Hypothetical protein SP1951 {(Streptococcus pneumo 99.93
d1vmea1148 ROO-like flavoprotein TM0755, C-terminal domain {T 99.92
d1nni1_171 Azobenzene reductase {Bacillus subtilis [TaxId: 14 99.92
d2fzva1233 Putative arsenical resistance protein {Shigella fl 99.91
d2fz5a1137 Flavodoxin {Megasphaera elsdenii [TaxId: 907]} 99.9
d1rlia_179 Hypothetical protein YwqN {Bacillus subtilis [TaxI 99.9
d5nula_138 Flavodoxin {Clostridium beijerinckii [TaxId: 1520] 99.89
d1rtta_174 Hypothetical protein PA1204 {Pseudomonas aeruginos 99.89
d1t0ia_185 Hypothetical protein Ylr011wp {Baker's yeast (Sacc 99.89
d1d4aa_273 NAD(P)H:quinone reductase {Human (Homo sapiens) [T 99.85
d2qwxa1230 Quinone reductase type 2 (menadione reductase) {Hu 99.84
d2z98a1200 ACP phosphodiesterase AcpD {Escherichia coli [TaxI 99.82
d1f4pa_147 Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} 99.82
d1czna_169 Flavodoxin {Synechococcus elongatus PCC 7942 [TaxI 99.79
d1oboa_169 Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 11 99.78
d1yoba1179 Flavodoxin {Azotobacter vinelandii [TaxId: 354]} 99.73
d2fcra_173 Flavodoxin {Chondrus crispus [TaxId: 2769]} 99.72
d1ag9a_175 Flavodoxin {Escherichia coli [TaxId: 562]} 99.72
d1ykga1146 Sulfite reductase alpha-component CysJ N-terminal 99.66
d1fuea_163 Flavodoxin {Helicobacter pylori [TaxId: 210]} 99.65
d1ja1a2177 NADPH-cytochrome p450 reductase, N-terminal domain 99.56
d1bvyf_152 FMN-binding domain of the cytochrome P450bm-3 {Bac 99.48
d1tlla2202 Nitric oxide (NO) synthase FMN domain {Rat (Rattus 99.43
d1rlja_135 Flavoprotein NrdI {Bacillus subtilis [TaxId: 1423] 98.91
d2a9va1196 GMP synthase subunit A, GuaAA {Archaeon Thermoplas 96.37
d2r4qa1103 Fructose-specific enzyme IIABC component FruA, mid 96.08
d2r48a1103 Mannose-specific enzyme IIBCA component ManP, N-te 96.0
d1ka9h_195 GAT subunit, HisH, (or domain) of imidazoleglycero 94.49
d1u9ca_221 GK2698 ortholog {Bacillus stearothermophilus [TaxI 93.96
d1k9vf_200 GAT subunit, HisH, (or domain) of imidazoleglycero 93.13
d1vkra_97 PTS system mannitol-specific EIICBA component {Esc 92.96
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 92.82
d1iloa_77 MTH985, a thioredoxin {Archaeon Methanobacterium t 92.4
d1vhqa_217 Putative sigma cross-reacting protein 27A (SCRP-27 92.14
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 91.73
d3eeqa2207 Cobalamin biosynthesis protein G, CbiG {Sulfolobus 91.21
d2nv0a1195 Hypothetical protein YaaE {Bacillus subtilis [TaxI 91.11
d1jvna2232 GAT subunit, HisH, (or domain) of imidazoleglycero 90.48
d1iiba_103 Enzyme IIB-cellobiose {Escherichia coli [TaxId: 56 90.11
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 88.32
d1iowa196 D-Ala-D-Ala ligase, N-domain {Escherichia coli, ge 87.73
d1o1ya_230 Hypothetical protein TM1158 {Thermotoga maritima [ 85.06
d1p5fa_186 DJ-1 {Human (Homo sapiens) [TaxId: 9606]} 83.11
d2fexa1188 Hypothetical protein Atu0886 {Agrobacterium tumefa 82.88
d1q7ra_202 Hypothetical protein YaaE {Bacillus stearothermoph 82.67
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 81.85
d1wl8a1188 GMP synthase subunit A, GuaAA {Archaeon Pyrococcus 81.31
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 80.65
d1qvwa_236 Hypothetical protein Ydr533Cp {Baker's yeast (Sacc 80.58
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 80.18
>d1ydga_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Flavoproteins
family: WrbA-like
domain: Trp repressor binding protein WrbA
species: Deinococcus radiodurans [TaxId: 1299]

Probab=100.00  E-value=9e-37  Score=232.71  Aligned_cols=191  Identities=37%  Similarity=0.511  Sum_probs=160.1

Q ss_pred             ceEEEEEecCcchHHHHHHHHHHHhhccCCceEEEEEcCCCCchhHhhhcCCC-----CCCCCCCCChhhhhccCeEEEe
Q 028847            3 TKVYIVYYSMYGHVEKLAEEIQKGAASVEGVEAKLWQVPETLSEDVLGKMGAG-----PKSDVPTITPNELAEADGILLG   77 (203)
Q Consensus         3 ~kilIiy~S~~G~T~~la~~i~~~l~~~~g~~v~~~~l~~~~~~~~~~~~~~~-----~~~~~~~~~~~~l~~aD~iiig   77 (203)
                      +||||||+|++|||++||+.|++++++ .|+|++++++.+..+.+|+.++.|.     ..++.+....+++.+||+||||
T Consensus         3 mkilivy~S~~GnT~~la~~ia~g~~~-~G~ev~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~i~~aD~ii~g   81 (201)
T d1ydga_           3 VKLAIVFYSSTGTGYAMAQEAAEAGRA-AGAEVRLLKVRETAPQDVIDGQDAWKANIEAMKDVPEATPADLEWAEAIVFS   81 (201)
T ss_dssp             CEEEEEECCSSSHHHHHHHHHHHHHHH-TTCEEEEEECCCCSCHHHHTTCHHHHHHHHHTTTSCBCCHHHHHHCSEEEEE
T ss_pred             cEEEEEEeCCCcHHHHHHHHHHHHHHh-cCCEEEEEEccccCccchhhhhhHhhcCCCcccCchhhhhhhHhhCCEeEEe
Confidence            399999999999999999999999998 4999999999999988887654332     1244444568999999999999


Q ss_pred             cccCCCCcHHHHHHHHHHhcccccccCCCCCeEEEEEccCCCCCCchhHHHHHHHHHHHcCcEEecCCCCCCCCCCcccc
Q 028847           78 FPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGSQGGGQETTPLTAITQLVHHGMIFVPIGYTFGAGMSEMEK  157 (203)
Q Consensus        78 sP~y~~~~~~~lk~fld~~~~~~~~~~l~gK~~~~~~t~g~~~~~~~~~~~~~~~~l~~~g~~~v~~~~~~~~~~~~~~~  157 (203)
                      ||+||++++++||+||||+..++....+.||+++.|+++++.+++.+.++.++...+..+|+.+++.++....     ..
T Consensus        82 sPvy~~~~s~~~k~flDr~~~~~~~~~l~gK~~~~~~s~g~~~gg~e~~~~~~~~~~~~~g~~~v~~~~~~~~-----~~  156 (201)
T d1ydga_          82 SPTRFGGATSQMRAFIDTLGGLWSSGKLANKTFSAMTSAQNVNGGQETTLQTLYMTAMHWGAVLTPPGYTDEV-----IF  156 (201)
T ss_dssp             EEEETTEECHHHHHHHHTTHHHHHTTTTTTCEEEEEEEESSTTSSTTHHHHHHHHHHHTTTCEECCCTTCSHH-----HH
T ss_pred             cceeeeeccchhHHHHHHhhhHHhccccCCceeeeeeccccCCCchHHHHHhHHHHHHHcCCccccccccchh-----hh
Confidence            9999999999999999998777666789999999999999988888888888889999999999987754211     11


Q ss_pred             ccCCCCCccceecCCCCCCCCHHHHHHHHHHHHHHHHHHHHhhc
Q 028847          158 VKGGSPYGAGTFAGDGSRQPSELELAQAFHQGKYFAGITKKLKG  201 (203)
Q Consensus       158 ~~~~~~~g~~~~~~~~~~~p~~~~~~~~~~~g~~l~~~~~~~~~  201 (203)
                      ...+++||.....+  ...|++++++.|+++|+++++.+++|.+
T Consensus       157 ~~gg~~~G~~~~~~--~~~~~e~~l~~ar~lGk~la~~a~kL~~  198 (201)
T d1ydga_         157 KSGGNPYGASVTAN--GQPLLENDRASIRHQVRRQVELTAKLLE  198 (201)
T ss_dssp             HTTCCSSSCEEECC--SSCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cCCCcccCcceecC--CCCCCHHHHHHHHHHHHHHHHHHHHHHh
Confidence            23567788777654  2468999999999999999999999865
>d2a5la1 c.23.5.8 (A:3-198) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2arka1 c.23.5.8 (A:1-184) Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1sqsa_ c.23.5.5 (A:) Hypothetical protein SP1951 {(Streptococcus pneumoniae) [TaxId: 1313]} Back     information, alignment and structure
>d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nni1_ c.23.5.4 (1:) Azobenzene reductase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fzva1 c.23.5.4 (A:1-233) Putative arsenical resistance protein {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d2fz5a1 c.23.5.1 (A:1-137) Flavodoxin {Megasphaera elsdenii [TaxId: 907]} Back     information, alignment and structure
>d1rlia_ c.23.5.6 (A:) Hypothetical protein YwqN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d5nula_ c.23.5.1 (A:) Flavodoxin {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1rtta_ c.23.5.4 (A:) Hypothetical protein PA1204 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t0ia_ c.23.5.4 (A:) Hypothetical protein Ylr011wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d4aa_ c.23.5.3 (A:) NAD(P)H:quinone reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qwxa1 c.23.5.3 (A:1-230) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z98a1 c.23.5.3 (A:1-200) ACP phosphodiesterase AcpD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f4pa_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1czna_ c.23.5.1 (A:) Flavodoxin {Synechococcus elongatus PCC 7942 [TaxId: 1140]} Back     information, alignment and structure
>d1oboa_ c.23.5.1 (A:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]} Back     information, alignment and structure
>d1yoba1 c.23.5.1 (A:1-179) Flavodoxin {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2fcra_ c.23.5.1 (A:) Flavodoxin {Chondrus crispus [TaxId: 2769]} Back     information, alignment and structure
>d1ag9a_ c.23.5.1 (A:) Flavodoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ykga1 c.23.5.2 (A:63-208) Sulfite reductase alpha-component CysJ N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fuea_ c.23.5.1 (A:) Flavodoxin {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ja1a2 c.23.5.2 (A:63-239) NADPH-cytochrome p450 reductase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bvyf_ c.23.5.1 (F:) FMN-binding domain of the cytochrome P450bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1tlla2 c.23.5.2 (A:750-951) Nitric oxide (NO) synthase FMN domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rlja_ c.23.5.7 (A:) Flavoprotein NrdI {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2r4qa1 c.44.2.2 (A:171-273) Fructose-specific enzyme IIABC component FruA, middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2r48a1 c.44.2.2 (A:2-104) Mannose-specific enzyme IIBCA component ManP, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vkra_ c.44.2.1 (A:) PTS system mannitol-specific EIICBA component {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1vhqa_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d3eeqa2 c.152.1.1 (A:8-214) Cobalamin biosynthesis protein G, CbiG {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1iiba_ c.44.2.1 (A:) Enzyme IIB-cellobiose {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1iowa1 c.30.1.2 (A:1-96) D-Ala-D-Ala ligase, N-domain {Escherichia coli, gene ddlB [TaxId: 562]} Back     information, alignment and structure
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fexa1 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wl8a1 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qvwa_ c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure