Citrus Sinensis ID: 028894
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 202 | ||||||
| 255547596 | 200 | Tyrosine-protein phosphatase SIW14, puta | 0.975 | 0.985 | 0.743 | 6e-84 | |
| 449442673 | 200 | PREDICTED: probable tyrosine-protein pho | 0.965 | 0.975 | 0.755 | 7e-84 | |
| 255647936 | 200 | unknown [Glycine max] | 0.945 | 0.955 | 0.746 | 8e-82 | |
| 356568489 | 200 | PREDICTED: probable tyrosine-protein pho | 0.945 | 0.955 | 0.746 | 1e-81 | |
| 224128928 | 202 | predicted protein [Populus trichocarpa] | 0.995 | 0.995 | 0.724 | 2e-81 | |
| 358248150 | 203 | uncharacterized protein LOC100785746 [Gl | 0.955 | 0.950 | 0.748 | 1e-80 | |
| 357507757 | 202 | Tyrosine specific protein phosphatase fa | 0.960 | 0.960 | 0.728 | 2e-80 | |
| 79387510 | 203 | tyrosine specific protein phosphatase-li | 0.960 | 0.955 | 0.706 | 3e-80 | |
| 225430987 | 202 | PREDICTED: probable tyrosine-protein pho | 0.965 | 0.965 | 0.729 | 4e-80 | |
| 21553927 | 204 | unknown [Arabidopsis thaliana] | 0.985 | 0.975 | 0.694 | 9e-80 |
| >gi|255547596|ref|XP_002514855.1| Tyrosine-protein phosphatase SIW14, putative [Ricinus communis] gi|223545906|gb|EEF47409.1| Tyrosine-protein phosphatase SIW14, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 315 bits (808), Expect = 6e-84, Method: Compositional matrix adjust.
Identities = 148/199 (74%), Positives = 172/199 (86%), Gaps = 2/199 (1%)
Query: 1 MCVITEGDNQSDGVLVPPPNFSMVEEGIYRSSFPQSSNFPFLQTLNLRSIIYLCPEPYPE 60
M +I E +D VL+PP NFSMVE+GI+RS+FPQ +NF FL +LNLRS+IYLC EPYPE
Sbjct: 1 MGLILEAGEGNDDVLIPPANFSMVEDGIFRSAFPQPANFSFLHSLNLRSVIYLCLEPYPE 60
Query: 61 ENLKFLAAQNIRLFHFGIEGKTEPPVSIPKDTIMEALKILIDVRNHPVLIHCKRGKHRTG 120
EN++FL A NI+LF FGIEGKT VSIPKD I+ ALK+L+DVRNHP+LIHCKRGKHRTG
Sbjct: 61 ENMEFLRAHNIQLFQFGIEGKTSS-VSIPKDAILGALKVLLDVRNHPILIHCKRGKHRTG 119
Query: 121 CLVGCLRKLQNWCLSSVFEEYRHFAGLKSRDTDLKFMETFNVMCLRQCLYSIIYQYQGYG 180
LVGC RKLQ+WCLSSVFEEY+HFAG+KSR DLKF+ETF++MCLRQCLYSIIYQY GYG
Sbjct: 120 TLVGCFRKLQHWCLSSVFEEYQHFAGVKSRAADLKFIETFDLMCLRQCLYSIIYQYHGYG 179
Query: 181 SKKRRLLYREENLQKLPQV 199
S KRRLLYREEN+QK PQ+
Sbjct: 180 SNKRRLLYREENIQK-PQI 197
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449442673|ref|XP_004139105.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like [Cucumis sativus] gi|449485351|ref|XP_004157142.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255647936|gb|ACU24425.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356568489|ref|XP_003552443.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224128928|ref|XP_002329001.1| predicted protein [Populus trichocarpa] gi|222839235|gb|EEE77586.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|358248150|ref|NP_001240081.1| uncharacterized protein LOC100785746 [Glycine max] gi|255645646|gb|ACU23317.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357507757|ref|XP_003624167.1| Tyrosine specific protein phosphatase family protein [Medicago truncatula] gi|87162589|gb|ABD28384.1| Tyrosine specific protein phosphatase and dual specificity protein phosphatase; Putative tyrosine phosphatase [Medicago truncatula] gi|355499182|gb|AES80385.1| Tyrosine specific protein phosphatase family protein [Medicago truncatula] gi|388496710|gb|AFK36421.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|79387510|ref|NP_186929.2| tyrosine specific protein phosphatase-like protein [Arabidopsis thaliana] gi|51969092|dbj|BAD43238.1| unknown protein [Arabidopsis thaliana] gi|332640340|gb|AEE73861.1| tyrosine specific protein phosphatase-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|225430987|ref|XP_002278743.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000 [Vitis vinifera] gi|147766881|emb|CAN67527.1| hypothetical protein VITISV_002127 [Vitis vinifera] gi|297735279|emb|CBI17641.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|21553927|gb|AAM63010.1| unknown [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 202 | ||||||
| TAIR|locus:2075527 | 203 | PFA-DSP3 "AT3G02800" [Arabidop | 0.975 | 0.970 | 0.702 | 5.5e-77 | |
| TAIR|locus:2171317 | 204 | PFA-DSP5 "AT5G16480" [Arabidop | 0.985 | 0.975 | 0.689 | 1.9e-76 | |
| TAIR|locus:2205513 | 247 | PFA-DSP1 "AT1G05000" [Arabidop | 0.425 | 0.348 | 0.639 | 9.9e-54 | |
| TAIR|locus:2059349 | 257 | PFA-DSP2 "AT2G32960" [Arabidop | 0.460 | 0.361 | 0.563 | 9.8e-50 | |
| TAIR|locus:2136718 | 198 | PFA-DSP4 "AT4G03960" [Arabidop | 0.757 | 0.772 | 0.588 | 1.8e-48 | |
| DICTYBASE|DDB_G0285909 | 181 | DDB_G0285909 "putative protein | 0.767 | 0.856 | 0.548 | 1.6e-45 | |
| SGD|S000004977 | 281 | SIW14 "Tyrosine phosphatase in | 0.727 | 0.523 | 0.527 | 5.3e-40 | |
| CGD|CAL0001689 | 281 | SIW14 [Candida albicans (taxid | 0.801 | 0.576 | 0.506 | 1.8e-39 | |
| UNIPROTKB|Q59MU0 | 281 | SIW14 "Putative uncharacterize | 0.801 | 0.576 | 0.506 | 1.8e-39 | |
| DICTYBASE|DDB_G0281953 | 166 | DDB_G0281953 "putative tyrosin | 0.722 | 0.879 | 0.445 | 2e-31 |
| TAIR|locus:2075527 PFA-DSP3 "AT3G02800" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 775 (277.9 bits), Expect = 5.5e-77, P = 5.5e-77
Identities = 139/198 (70%), Positives = 166/198 (83%)
Query: 1 MCVITEGDNQSDGVLVPPPNFSMVEEGIYRSSFPQSSNFPFLQTLNLRSIIYLCPEPYPE 60
MC+I E D+ + VL PP NFSMVE+GIYRS FP+ NF FL+TLNLRSIIYLCPEPYPE
Sbjct: 1 MCLIMETDDHNGDVLAPPSNFSMVEDGIYRSGFPRPENFSFLKTLNLRSIIYLCPEPYPE 60
Query: 61 ENLKFLAAQNIRLFHFGIEGKTEPPVSIPKDTIMEALKILIDVRNHPVLIHCKRGKHRTG 120
ENLKFL A NI+L+ FGIEGKT+PP +PKDT+++ALK+L+DVRNHP+LIHCKRGKHRTG
Sbjct: 61 ENLKFLEANNIKLYQFGIEGKTDPPTPMPKDTVLDALKVLVDVRNHPILIHCKRGKHRTG 120
Query: 121 CLVGCLRKLQNWCLSSVFEEYRHFAGLKSRDTDLKFMETFNVMCLRQCLYSIIYQYQGYG 180
CLVGCLRK+Q+WCLSSV EEY+ AGLK R DL F+E F+++ LRQCL SI+YQY GYG
Sbjct: 121 CLVGCLRKVQSWCLSSVLEEYQKNAGLKWRQRDLNFIEAFDIVSLRQCLLSIMYQYHGYG 180
Query: 181 SKKRRLLYREENLQKLPQ 198
K+RRL Y EEN+ K P+
Sbjct: 181 FKRRRLAYEEENV-KTPK 197
|
|
| TAIR|locus:2171317 PFA-DSP5 "AT5G16480" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2205513 PFA-DSP1 "AT1G05000" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2059349 PFA-DSP2 "AT2G32960" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2136718 PFA-DSP4 "AT4G03960" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0285909 DDB_G0285909 "putative protein tyrosine phosphatase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| SGD|S000004977 SIW14 "Tyrosine phosphatase involved in actin organization and endocytosis" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0001689 SIW14 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q59MU0 SIW14 "Putative uncharacterized protein SIW14" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0281953 DDB_G0281953 "putative tyrosine phosphatase family protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pm.C_870018 | SubName- Full=Putative uncharacterized protein; (202 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 202 | |||
| pfam03162 | 150 | pfam03162, Y_phosphatase2, Tyrosine phosphatase fa | 7e-67 | |
| COG2365 | 249 | COG2365, COG2365, Protein tyrosine/serine phosphat | 2e-14 | |
| COG2453 | 180 | COG2453, CDC14, Predicted protein-tyrosine phospha | 8e-06 | |
| cd00127 | 139 | cd00127, DSPc, Dual specificity phosphatases (DSP) | 0.002 | |
| smart00195 | 138 | smart00195, DSPc, Dual specificity phosphatase, ca | 0.002 |
| >gnl|CDD|111998 pfam03162, Y_phosphatase2, Tyrosine phosphatase family | Back alignment and domain information |
|---|
Score = 201 bits (514), Expect = 7e-67
Identities = 81/148 (54%), Positives = 115/148 (77%)
Query: 15 LVPPPNFSMVEEGIYRSSFPQSSNFPFLQTLNLRSIIYLCPEPYPEENLKFLAAQNIRLF 74
LVPP NFS VE G+YRSS+P+++NF FL++L L++II L PEPYP++NL+FL +++I+L+
Sbjct: 1 LVPPLNFSPVESGLYRSSYPRANNFSFLRSLRLKTIISLSPEPYPQDNLQFLESEHIKLY 60
Query: 75 HFGIEGKTEPPVSIPKDTIMEALKILIDVRNHPVLIHCKRGKHRTGCLVGCLRKLQNWCL 134
H +EG +P V+IP + ALK+L++ N+PVLIHC RGKHRTG ++GCLRKLQ W L
Sbjct: 61 HIHMEGNKDPFVNIPSHLLRRALKLLLNKDNYPVLIHCNRGKHRTGLVIGCLRKLQKWSL 120
Query: 135 SSVFEEYRHFAGLKSRDTDLKFMETFNV 162
+S+ EYR F+G K+R D +F+E F+
Sbjct: 121 ASILNEYRRFSGSKARIVDEEFIEIFDS 148
|
This family is closely related to the pfam00102 and pfam00782 families. Length = 150 |
| >gnl|CDD|225240 COG2365, COG2365, Protein tyrosine/serine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| PF03162 | 164 | Y_phosphatase2: Tyrosine phosphatase family; Inter | 100.0 | |
| KOG1572 | 249 | consensus Predicted protein tyrosine phosphatase [ | 100.0 | |
| smart00195 | 138 | DSPc Dual specificity phosphatase, catalytic domai | 99.89 | |
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 99.88 | |
| PF13350 | 164 | Y_phosphatase3: Tyrosine phosphatase family; PDB: | 99.88 | |
| cd00127 | 139 | DSPc Dual specificity phosphatases (DSP); Ser/Thr | 99.87 | |
| PTZ00242 | 166 | protein tyrosine phosphatase; Provisional | 99.84 | |
| PTZ00393 | 241 | protein tyrosine phosphatase; Provisional | 99.82 | |
| PF00782 | 133 | DSPc: Dual specificity phosphatase, catalytic doma | 99.8 | |
| PRK12361 | 547 | hypothetical protein; Provisional | 99.78 | |
| PF04273 | 110 | DUF442: Putative phosphatase (DUF442); InterPro: I | 99.78 | |
| PLN02727 | 986 | NAD kinase | 99.75 | |
| COG2365 | 249 | Protein tyrosine/serine phosphatase [Signal transd | 99.73 | |
| KOG1720 | 225 | consensus Protein tyrosine phosphatase CDC14 [Defe | 99.72 | |
| COG3453 | 130 | Uncharacterized protein conserved in bacteria [Fun | 99.67 | |
| PF05706 | 168 | CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) | 99.65 | |
| KOG1719 | 183 | consensus Dual specificity phosphatase [Defense me | 99.61 | |
| KOG1717 | 343 | consensus Dual specificity phosphatase [Defense me | 99.6 | |
| KOG1716 | 285 | consensus Dual specificity phosphatase [Defense me | 99.56 | |
| KOG1718 | 198 | consensus Dual specificity phosphatase [Defense me | 99.55 | |
| KOG2836 | 173 | consensus Protein tyrosine phosphatase IVA1 [Signa | 99.46 | |
| COG2453 | 180 | CDC14 Predicted protein-tyrosine phosphatase [Sign | 99.33 | |
| smart00404 | 105 | PTPc_motif Protein tyrosine phosphatase, catalytic | 98.92 | |
| smart00012 | 105 | PTPc_DSPc Protein tyrosine phosphatase, catalytic | 98.92 | |
| PF14566 | 149 | PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 | 98.85 | |
| cd00047 | 231 | PTPc Protein tyrosine phosphatases (PTP) catalyze | 98.6 | |
| PRK15375 | 535 | pathogenicity island 1 effector protein StpP; Prov | 98.49 | |
| smart00194 | 258 | PTPc Protein tyrosine phosphatase, catalytic domai | 98.47 | |
| KOG2283 | 434 | consensus Clathrin coat dissociation kinase GAK/PT | 98.27 | |
| PHA02740 | 298 | protein tyrosine phosphatase; Provisional | 98.19 | |
| PHA02742 | 303 | protein tyrosine phosphatase; Provisional | 98.18 | |
| KOG2386 | 393 | consensus mRNA capping enzyme, guanylyltransferase | 98.09 | |
| PHA02747 | 312 | protein tyrosine phosphatase; Provisional | 98.07 | |
| PHA02746 | 323 | protein tyrosine phosphatase; Provisional | 98.06 | |
| COG5599 | 302 | PTP2 Protein tyrosine phosphatase [Signal transduc | 98.04 | |
| PHA02738 | 320 | hypothetical protein; Provisional | 97.95 | |
| PF00102 | 235 | Y_phosphatase: Protein-tyrosine phosphatase; Inter | 97.9 | |
| COG5350 | 172 | Predicted protein tyrosine phosphatase [General fu | 97.76 | |
| KOG0791 | 374 | consensus Protein tyrosine phosphatase, contains f | 97.55 | |
| KOG0792 | 1144 | consensus Protein tyrosine phosphatase PTPMEG, con | 97.53 | |
| KOG0789 | 415 | consensus Protein tyrosine phosphatase [Signal tra | 97.24 | |
| KOG0790 | 600 | consensus Protein tyrosine phosphatase Corkscrew a | 97.1 | |
| KOG4228 | 1087 | consensus Protein tyrosine phosphatase [Signal tra | 96.74 | |
| KOG0793 | 1004 | consensus Protein tyrosine phosphatase [Signal tra | 95.27 | |
| PF04179 | 451 | Init_tRNA_PT: Initiator tRNA phosphoribosyl transf | 95.04 | |
| cd01448 | 122 | TST_Repeat_1 Thiosulfate sulfurtransferase (TST), | 94.8 | |
| KOG4228 | 1087 | consensus Protein tyrosine phosphatase [Signal tra | 94.33 | |
| PF04343 | 122 | DUF488: Protein of unknown function, DUF488; Inter | 94.31 | |
| PF06602 | 353 | Myotub-related: Myotubularin-like phosphatase doma | 94.24 | |
| KOG4471 | 717 | consensus Phosphatidylinositol 3-phosphate 3-phosp | 94.19 | |
| PLN02160 | 136 | thiosulfate sulfurtransferase | 94.09 | |
| cd01518 | 101 | RHOD_YceA Member of the Rhodanese Homology Domain | 93.67 | |
| COG0607 | 110 | PspE Rhodanese-related sulfurtransferase [Inorgani | 93.39 | |
| KOG1089 | 573 | consensus Myotubularin-related phosphatidylinosito | 92.47 | |
| cd01533 | 109 | 4RHOD_Repeat_2 Member of the Rhodanese Homology Do | 92.29 | |
| TIGR02990 | 239 | ectoine_eutA ectoine utilization protein EutA. Mem | 90.32 | |
| smart00450 | 100 | RHOD Rhodanese Homology Domain. An alpha beta fold | 89.72 | |
| KOG1530 | 136 | consensus Rhodanese-related sulfurtransferase [Ino | 89.22 | |
| PRK01415 | 247 | hypothetical protein; Validated | 88.99 | |
| COG3473 | 238 | Maleate cis-trans isomerase [Secondary metabolites | 88.67 | |
| PF00581 | 113 | Rhodanese: Rhodanese-like domain This Prosite entr | 86.68 | |
| PRK00142 | 314 | putative rhodanese-related sulfurtransferase; Prov | 85.54 | |
| PRK11784 | 345 | tRNA 2-selenouridine synthase; Provisional | 84.53 | |
| cd01519 | 106 | RHOD_HSP67B2 Member of the Rhodanese Homology Doma | 84.06 | |
| TIGR02981 | 101 | phageshock_pspE phage shock operon rhodanese PspE. | 83.66 | |
| cd01522 | 117 | RHOD_1 Member of the Rhodanese Homology Domain sup | 83.17 | |
| cd01443 | 113 | Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda | 82.58 | |
| cd01523 | 100 | RHOD_Lact_B Member of the Rhodanese Homology Domai | 82.47 | |
| cd01444 | 96 | GlpE_ST GlpE sulfurtransferase (ST) and homologs a | 81.38 | |
| cd01534 | 95 | 4RHOD_Repeat_3 Member of the Rhodanese Homology Do | 81.36 | |
| PRK10287 | 104 | thiosulfate:cyanide sulfurtransferase; Provisional | 81.33 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 80.85 | |
| PF13292 | 270 | DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate syn | 80.79 | |
| cd01528 | 101 | RHOD_2 Member of the Rhodanese Homology Domain sup | 80.2 |
| >PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
Probab=100.00 E-value=2e-45 Score=290.56 Aligned_cols=152 Identities=52% Similarity=0.922 Sum_probs=110.9
Q ss_pred eeCCCCccccccceeecCCCCCCChhHHhccCCcEEEEcCCCCCCchhHhHhhhCCcEEEEeecCCCCCCCCCCCHHHHH
Q 028894 15 LVPPPNFSMVEEGIYRSSFPQSSNFPFLQTLNLRSIIYLCPEPYPEENLKFLAAQNIRLFHFGIEGKTEPPVSIPKDTIM 94 (202)
Q Consensus 15 ~~pp~nf~~V~~~Lyrs~~p~~~~~~~L~~~giktVI~L~~e~~~~~~~~~~~~~gI~~~~ipi~d~~~p~~~~~~~~i~ 94 (202)
++||.||+.|+++||||++|++.++++|+++|+||||+|++++++.+...|++++||+++|+++.....+++.++.+.+.
T Consensus 1 lvpP~nF~~V~~~vYRS~~P~~~n~~fL~~L~LKTII~L~~e~~~~~~~~f~~~~~I~l~~~~~~~~~~~~~~~~~~~v~ 80 (164)
T PF03162_consen 1 LVPPLNFGMVEPGVYRSAQPTPANFPFLERLGLKTIINLRPEPPSQDFLEFAEENGIKLIHIPMSSSKDPWVPISEEQVA 80 (164)
T ss_dssp B---TT-EEEETTEEEESS--HHHHHHHHHHT-SEEEE--SS---HHHHHHHHHTT-EEEE-------GGG----HHHHH
T ss_pred CcCCccccCCCCCccCCCCCChhhHHHHHHCCCceEEEecCCCCCHHHHHHHhhcCceEEEeccccccCccccCCHHHHH
Confidence 68999999999999999999999999999999999999999987777788999999999999998877666678899999
Q ss_pred HHHHHHHhCCCCcEEEEeCCCCchHHHHHHHHHHHcCCCHHHHHHHHHHhhCCCCCchHHHHHHhccccccc
Q 028894 95 EALKILIDVRNHPVLIHCKRGKHRTGCLVGCLRKLQNWCLSSVFEEYRHFAGLKSRDTDLKFMETFNVMCLR 166 (202)
Q Consensus 95 ~~l~~i~~~~~~pVlVHC~~G~~RTG~vva~~l~~~gws~~~a~~ey~~~~~~~~~~~~~~fie~f~~~~~~ 166 (202)
++|++++++.++||||||.+|+||||+|+||||++|||+.++|++||++|++++.+..+++|||.||.+.+.
T Consensus 81 ~aL~~ild~~n~PvLiHC~~G~~rTG~vvg~lRk~Q~W~~~~i~~Ey~~f~~~~~~~~~~~fIe~f~~~~~~ 152 (164)
T PF03162_consen 81 EALEIILDPRNYPVLIHCNHGKDRTGLVVGCLRKLQGWSLSSIFDEYRRFAGPKIRYLDEQFIELFDVELVV 152 (164)
T ss_dssp HHHHHHH-GGG-SEEEE-SSSSSHHHHHHHHHHHHTTB-HHHHHHHHHHHHGGG--HHHHHHHHT-------
T ss_pred HHHHHHhCCCCCCEEEEeCCCCcchhhHHHHHHHHcCCCHHHHHHHHHHhcCCCCcHHHHHHHHhcCcceec
Confidence 999999999999999999999999999999999999999999999999999998899999999999998764
|
Consequently, maintaining an appropriate level of protein tyrosine phosphorylation is essential for many cellular functions. Tyrosine-specific protein phosphatases (PTPase; 3.1.3.48 from EC) catalyse the removal of a phosphate group attached to a tyrosine residue, using a cysteinyl-phosphate enzyme intermediate. These enzymes are key regulatory components in signal transduction pathways (such as the MAP kinase pathway) and cell cycle control, and are important in the control of cell growth, proliferation, differentiation and transformation [, ]. The PTP superfamily can be divided into four subfamilies []: (1) pTyr-specific phosphatases (2) dual specificity phosphatases (dTyr and dSer/dThr) (3) Cdc25 phosphatases (dTyr and/or dThr) (4) LMW (low molecular weight) phosphatases Based on their cellular localisation, PTPases are also classified as: Receptor-like, which are transmembrane receptors that contain PTPase domains [] Non-receptor (intracellular) PTPases [] All PTPases carry the highly conserved active site motif C(X)5R (PTP signature motif), employ a common catalytic mechanism, and share a similar core structure made of a central parallel beta-sheet with flanking alpha-helices containing a beta-loop-alpha-loop that encompasses the PTP signature motif []. Functional diversity between PTPases is endowed by regulatory domains and subunits. This entry represents protein-tyrosine phosphatases predominantly from fungi, plants and bacteria, several of which are putative enzymes. These proteins are closely related to the Y-phosphatase and DSPc families. This entry includes the PTPase SIW14 from Saccharomyces cerevisiae (Baker's yeast), which plays a role in actin filament organisation and endocytosis.; PDB: 2Q47_A 1XRI_A. |
| >KOG1572 consensus Predicted protein tyrosine phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >smart00195 DSPc Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
| >PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B | Back alignment and domain information |
|---|
| >cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >PTZ00242 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00393 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PRK12361 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function | Back alignment and domain information |
|---|
| >PLN02727 NAD kinase | Back alignment and domain information |
|---|
| >COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1720 consensus Protein tyrosine phosphatase CDC14 [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG3453 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species | Back alignment and domain information |
|---|
| >KOG1719 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1716 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1718 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG2836 consensus Protein tyrosine phosphatase IVA1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B | Back alignment and domain information |
|---|
| >cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >PRK15375 pathogenicity island 1 effector protein StpP; Provisional | Back alignment and domain information |
|---|
| >smart00194 PTPc Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >KOG2283 consensus Clathrin coat dissociation kinase GAK/PTEN/Auxilin and related tyrosine phosphatases [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >PHA02740 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02742 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG2386 consensus mRNA capping enzyme, guanylyltransferase (alpha) subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >PHA02747 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02746 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02738 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >COG5350 Predicted protein tyrosine phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0791 consensus Protein tyrosine phosphatase, contains fn3 domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0792 consensus Protein tyrosine phosphatase PTPMEG, contains FERM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0789 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0790 consensus Protein tyrosine phosphatase Corkscrew and related SH2 domain enzymes [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0793 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 | Back alignment and domain information |
|---|
| >cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain | Back alignment and domain information |
|---|
| >KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04343 DUF488: Protein of unknown function, DUF488; InterPro: IPR007438 This family includes several proteins of uncharacterised function | Back alignment and domain information |
|---|
| >PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO | Back alignment and domain information |
|---|
| >KOG4471 consensus Phosphatidylinositol 3-phosphate 3-phosphatase myotubularin MTM1 [Lipid transport and metabolism; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN02160 thiosulfate sulfurtransferase | Back alignment and domain information |
|---|
| >cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1089 consensus Myotubularin-related phosphatidylinositol 3-phosphate 3-phosphatase MTM6 [General function prediction only] | Back alignment and domain information |
|---|
| >cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 | Back alignment and domain information |
|---|
| >TIGR02990 ectoine_eutA ectoine utilization protein EutA | Back alignment and domain information |
|---|
| >smart00450 RHOD Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK01415 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG3473 Maleate cis-trans isomerase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family | Back alignment and domain information |
|---|
| >PRK00142 putative rhodanese-related sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11784 tRNA 2-selenouridine synthase; Provisional | Back alignment and domain information |
|---|
| >cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >TIGR02981 phageshock_pspE phage shock operon rhodanese PspE | Back alignment and domain information |
|---|
| >cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 | Back alignment and domain information |
|---|
| >cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily | Back alignment and domain information |
|---|
| >cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 | Back alignment and domain information |
|---|
| >PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >PF13292 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate synthase; PDB: 2O1X_C 2O1S_B | Back alignment and domain information |
|---|
| >cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 202 | ||||
| 1xri_A | 151 | X-ray Structure Of A Putative Phosphoprotein Phosph | 5e-58 | ||
| 1d5r_A | 324 | Crystal Structure Of The Pten Tumor Suppressor Leng | 2e-04 |
| >pdb|1XRI|A Chain A, X-ray Structure Of A Putative Phosphoprotein Phosphatase From Arabidopsis Thaliana Gene At1g05000 Length = 151 | Back alignment and structure |
|
| >pdb|1D5R|A Chain A, Crystal Structure Of The Pten Tumor Suppressor Length = 324 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 202 | |||
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 1e-62 | |
| 3gxh_A | 157 | Putative phosphatase (DUF442); YP_001181608.1, str | 2e-20 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 2e-15 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 4e-10 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 2e-09 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 6e-08 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 8e-08 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 9e-08 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 9e-08 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 3e-07 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 8e-07 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 5e-06 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 5e-05 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 9e-04 |
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Length = 151 | Back alignment and structure |
|---|
Score = 190 bits (484), Expect = 1e-62
Identities = 103/148 (69%), Positives = 121/148 (81%)
Query: 15 LVPPPNFSMVEEGIYRSSFPQSSNFPFLQTLNLRSIIYLCPEPYPEENLKFLAAQNIRLF 74
L+PP NFSMV+ GI+RS FP S+NF FLQTL LRSIIYLCPEPYPE NL+FL + IRLF
Sbjct: 2 LIPPLNFSMVDNGIFRSGFPDSANFSFLQTLGLRSIIYLCPEPYPESNLQFLKSNGIRLF 61
Query: 75 HFGIEGKTEPPVSIPKDTIMEALKILIDVRNHPVLIHCKRGKHRTGCLVGCLRKLQNWCL 134
FGIEG EP V+IP I ALK+L+D +NHPVLIHCKRGKHRTGCLVGCLRKLQ WCL
Sbjct: 62 QFGIEGNKEPFVNIPDHKIRMALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKLQKWCL 121
Query: 135 SSVFEEYRHFAGLKSRDTDLKFMETFNV 162
+S+F+EY+ FA K+R +D +FME F+V
Sbjct: 122 TSIFDEYQRFAAAKARVSDQRFMEIFDV 149
|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Length = 157 | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Length = 156 | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 100.0 | |
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 99.95 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 99.94 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 99.94 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 99.92 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 99.92 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 99.92 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 99.91 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 99.91 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 99.9 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 99.89 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 99.89 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 99.89 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 99.89 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 99.89 | |
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 99.89 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 99.88 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 99.88 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 99.88 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 99.88 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 99.88 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 99.88 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 99.88 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 99.88 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 99.87 | |
| 1ywf_A | 296 | Phosphotyrosine protein phosphatase PTPB; four str | 99.87 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 99.87 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 99.87 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 99.85 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 99.85 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 99.85 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 99.84 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 99.83 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 99.8 | |
| 3gxh_A | 157 | Putative phosphatase (DUF442); YP_001181608.1, str | 99.77 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 99.75 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 99.74 | |
| 1d5r_A | 324 | Phosphoinositide phosphotase PTEN; C2 domain, phos | 99.7 | |
| 3n0a_A | 361 | Tyrosine-protein phosphatase auxilin; phosphatase- | 99.44 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 99.44 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 99.38 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 99.17 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 99.14 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 98.76 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 98.75 | |
| 3b7o_A | 316 | Tyrosine-protein phosphatase non-receptor type 11; | 98.69 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 98.68 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 98.68 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 98.67 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 98.65 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 98.63 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 98.62 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 98.61 | |
| 4az1_A | 302 | Tyrosine specific protein phosphatase; hydrolase, | 98.6 | |
| 3m4u_A | 306 | Tyrosine specific protein phosphatase, putative; p | 98.6 | |
| 2i75_A | 320 | Tyrosine-protein phosphatase non-receptor type 4; | 98.59 | |
| 2cm2_A | 304 | Tyrosine-protein phosphatase non-receptor type 1; | 98.59 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 98.59 | |
| 4grz_A | 288 | Tyrosine-protein phosphatase non-receptor type 6; | 98.58 | |
| 2p6x_A | 309 | Tyrosine-protein phosphatase non-receptor type 22; | 98.56 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 98.55 | |
| 2oc3_A | 303 | Tyrosine-protein phosphatase non-receptor type 18; | 98.54 | |
| 1yfo_A | 302 | D1, receptor protein tyrosine phosphatase alpha; h | 98.53 | |
| 2bzl_A | 325 | Tyrosine-protein phosphatase, non-receptor type 14 | 98.5 | |
| 2i1y_A | 301 | Receptor-type tyrosine-protein phosphatase; recept | 98.5 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 98.44 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 98.42 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 98.41 | |
| 4i8n_A | 354 | Tyrosine-protein phosphatase non-receptor type 1; | 98.4 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 98.39 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 98.39 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 98.36 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 98.35 | |
| 4ge6_A | 314 | Tyrosine-protein phosphatase non-receptor type 9; | 98.33 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 98.29 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 98.27 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 98.22 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 98.2 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 98.16 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 98.16 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 98.15 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 97.99 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 97.96 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 93.1 | |
| 2yf0_A | 512 | Myotubularin-related protein 6; hydrolase; 2.65A { | 92.94 | |
| 1zsq_A | 528 | Myotubularin-related protein 2; protein-phospholip | 92.82 | |
| 1vee_A | 134 | Proline-rich protein family; hypothetical protein, | 92.23 | |
| 1lw3_A | 657 | Myotubularin-related protein 2; protein-phosphate | 91.93 | |
| 3d1p_A | 139 | Putative thiosulfate sulfurtransferase YOR285W; at | 90.37 | |
| 2jtq_A | 85 | Phage shock protein E; solution structure rhodanes | 89.49 | |
| 1urh_A | 280 | 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 | 86.34 | |
| 1tq1_A | 129 | AT5G66040, senescence-associated family protein; C | 85.89 | |
| 3flh_A | 124 | Uncharacterized protein LP_1913; alpha-beta protei | 83.76 | |
| 1gmx_A | 108 | GLPE protein; transferase, rhodanese, sulfurtransf | 83.62 | |
| 3gk5_A | 108 | Uncharacterized rhodanese-related protein TVG08686 | 81.83 | |
| 2fsx_A | 148 | RV0390, COG0607: rhodanese-related sulfurtransfera | 81.76 | |
| 3iwh_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 81.69 | |
| 3olh_A | 302 | MST, 3-mercaptopyruvate sulfurtransferase; structu | 81.27 | |
| 3aay_A | 277 | Putative thiosulfate sulfurtransferase; sulfurtran | 80.37 |
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A | Back alignment and structure |
|---|
Probab=100.00 E-value=3.3e-37 Score=237.65 Aligned_cols=150 Identities=69% Similarity=1.254 Sum_probs=133.6
Q ss_pred eeeCCCCccccccceeecCCCCCCChhHHhccCCcEEEEcCCCCCCchhHhHhhhCCcEEEEeecCCCCCCCCCCCHHHH
Q 028894 14 VLVPPPNFSMVEEGIYRSSFPQSSNFPFLQTLNLRSIIYLCPEPYPEENLKFLAAQNIRLFHFGIEGKTEPPVSIPKDTI 93 (202)
Q Consensus 14 ~~~pp~nf~~V~~~Lyrs~~p~~~~~~~L~~~giktVI~L~~e~~~~~~~~~~~~~gI~~~~ipi~d~~~p~~~~~~~~i 93 (202)
|++||.||++|.++||||++|.+.++++|+++||++||||+++.......++++..|++|+++|+.|...|...++.+.+
T Consensus 1 ~~~pp~n~~~v~~~l~~s~~~~~~d~~~L~~~gi~~Vi~l~~~~e~~~~~~~~~~~gi~~~~ipi~d~~~~~~~~~~~~~ 80 (151)
T 1xri_A 1 HLIPPLNFSMVDNGIFRSGFPDSANFSFLQTLGLRSIIYLCPEPYPESNLQFLKSNGIRLFQFGIEGNKEPFVNIPDHKI 80 (151)
T ss_dssp CBCCCTTCEEEETTEEEESCCCHHHHHHHHHHTCSEEEECCSSCCCHHHHHHHHHHTCEEEECCCCCCCGGGCCCCHHHH
T ss_pred CccCCcCcCeeCCCeEECCCcCccCHHHHHHCCCCEEEECCCCCcChhHHHHHHhcCCeEEecccccccCccccCCHHHH
Confidence 68999999999999999999999999999999999999999875544556677888999999999887555444567888
Q ss_pred HHHHHHHHhCCCCcEEEEeCCCCchHHHHHHHHHHHcCCCHHHHHHHHHHhhCCCCCchHHHHHHhcccc
Q 028894 94 MEALKILIDVRNHPVLIHCKRGKHRTGCLVGCLRKLQNWCLSSVFEEYRHFAGLKSRDTDLKFMETFNVM 163 (202)
Q Consensus 94 ~~~l~~i~~~~~~pVlVHC~~G~~RTG~vva~~l~~~gws~~~a~~ey~~~~~~~~~~~~~~fie~f~~~ 163 (202)
.++++.+.+..++||+|||++|+||||+++|+|++.+||+.++|+++|++++..+.+..+++|++.|+.+
T Consensus 81 ~~~~~~i~~~~~~~vlvHC~aG~~RTg~~~a~~l~~~g~~~~~a~~~~~~~~~~~~~~~~~qfi~~~~~~ 150 (151)
T 1xri_A 81 RMALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLTSIFDEYQRFAAAKARVSDQRFMEIFDVS 150 (151)
T ss_dssp HHHHHHHHCGGGCSEEEECSSSSSHHHHHHHHHHHHTTBCHHHHHHHHHHHHGGGCCHHHHHHHHTCCCC
T ss_pred HHHHHHHHcCCCCCEEEECCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHhcCCCccchHHHHHHHhcCC
Confidence 8999998876789999999999999999999999999999999999999998776777899999999875
|
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A | Back alignment and structure |
|---|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} | Back alignment and structure |
|---|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 | Back alignment and structure |
|---|
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A | Back alignment and structure |
|---|
| >4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A | Back alignment and structure |
|---|
| >4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* | Back alignment and structure |
|---|
| >1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A | Back alignment and structure |
|---|
| >1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A | Back alignment and structure |
|---|
| >3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A | Back alignment and structure |
|---|
| >1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A | Back alignment and structure |
|---|
| >1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A | Back alignment and structure |
|---|
| >3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} | Back alignment and structure |
|---|
| >2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A | Back alignment and structure |
|---|
| >3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 202 | ||||
| d1xria_ | 151 | c.45.1.1 (A:) Putative phosphatase At1g05000 {Thal | 2e-50 | |
| d1vhra_ | 178 | c.45.1.1 (A:) VH1-related dual-specificity phospha | 3e-10 | |
| d1ohea2 | 182 | c.45.1.1 (A:199-380) Proline directed phosphatase | 5e-09 | |
| d1rxda_ | 152 | c.45.1.1 (A:) Protein tyrosine phosphatase type IV | 1e-06 | |
| d1i9sa_ | 194 | c.45.1.1 (A:) mRNA capping enzyme, triphosphatase | 3e-06 | |
| d1d5ra2 | 174 | c.45.1.1 (A:14-187) Phoshphoinositide phosphatase | 4e-05 | |
| d1fpza_ | 176 | c.45.1.1 (A:) Kinase associated phosphatase (kap) | 7e-05 | |
| d1m3ga_ | 145 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 5e-04 | |
| d1ywfa1 | 272 | c.45.1.5 (A:4-275) Phosphotyrosine protein phospha | 0.001 |
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 151 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: Putative phosphatase At1g05000 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 158 bits (400), Expect = 2e-50
Identities = 103/148 (69%), Positives = 121/148 (81%)
Query: 15 LVPPPNFSMVEEGIYRSSFPQSSNFPFLQTLNLRSIIYLCPEPYPEENLKFLAAQNIRLF 74
L+PP NFSMV+ GI+RS FP S+NF FLQTL LRSIIYLCPEPYPE NL+FL + IRLF
Sbjct: 2 LIPPLNFSMVDNGIFRSGFPDSANFSFLQTLGLRSIIYLCPEPYPESNLQFLKSNGIRLF 61
Query: 75 HFGIEGKTEPPVSIPKDTIMEALKILIDVRNHPVLIHCKRGKHRTGCLVGCLRKLQNWCL 134
FGIEG EP V+IP I ALK+L+D +NHPVLIHCKRGKHRTGCLVGCLRKLQ WCL
Sbjct: 62 QFGIEGNKEPFVNIPDHKIRMALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKLQKWCL 121
Query: 135 SSVFEEYRHFAGLKSRDTDLKFMETFNV 162
+S+F+EY+ FA K+R +D +FME F+V
Sbjct: 122 TSIFDEYQRFAAAKARVSDQRFMEIFDV 149
|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 | Back information, alignment and structure |
|---|
| >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 272 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| d1xria_ | 151 | Putative phosphatase At1g05000 {Thale cress (Arabi | 100.0 | |
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 99.9 | |
| d1vhra_ | 178 | VH1-related dual-specificity phosphatase, VHR {Hum | 99.89 | |
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 99.85 | |
| d1fpza_ | 176 | Kinase associated phosphatase (kap) {Human (Homo s | 99.84 | |
| d1mkpa_ | 144 | Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp | 99.84 | |
| d1ywfa1 | 272 | Phosphotyrosine protein phosphatase PtpB {Mycobact | 99.81 | |
| d1m3ga_ | 145 | Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax | 99.8 | |
| d1i9sa_ | 194 | mRNA capping enzyme, triphosphatase domain {Mouse | 99.67 | |
| d1d5ra2 | 174 | Phoshphoinositide phosphatase Pten (Pten tumor sup | 99.56 | |
| d2pt0a1 | 313 | Myo-inositol hexaphosphate phosphohydrolase (phyta | 99.18 | |
| d1g4us2 | 243 | SptP tyrosine phosphatase, catalytic domain {Salmo | 98.59 | |
| d1lyva_ | 283 | Protein-tyrosine phosphatase YopH, catalytic domai | 98.39 | |
| d1wcha_ | 308 | Tyrosine-protein phosphatase, non-receptor type 13 | 98.32 | |
| d1jlna_ | 297 | Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl | 98.14 | |
| d2shpa1 | 307 | Tyrosine phosphatase {Human (Homo sapiens), shp-2 | 98.14 | |
| d1l8ka_ | 273 | Tyrosine phosphatase {Human (Homo sapiens), T-cell | 98.13 | |
| d1lara1 | 317 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 98.06 | |
| d1fpra_ | 284 | Tyrosine phosphatase {Human (Homo sapiens), shp-1 | 98.05 | |
| d1p15a_ | 245 | Protein-tyrosine phosphatase alpha {Mouse (Mus mus | 98.03 | |
| d2f71a1 | 297 | Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta | 98.03 | |
| d1yfoa_ | 288 | Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: | 98.02 | |
| d1rpma_ | 278 | Tyrosine phosphatase {Human (Homo sapiens), mu [Ta | 98.02 | |
| d1lara2 | 249 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 97.95 | |
| d1tq1a_ | 119 | Thiosulfate sulfurtransferase/Senescence-associate | 94.13 | |
| d1zsqa2 | 387 | Myotubularin-related protein 2, C-terminal domain | 93.77 | |
| d1urha2 | 120 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 92.91 | |
| d1uara2 | 141 | Sulfurtransferase {Thermus thermophilus [TaxId: 27 | 89.0 | |
| d1ohea1 | 157 | Proline directed phosphatase CDC14b2 {Human (Homo | 87.27 | |
| d1gmxa_ | 108 | Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 | 85.98 | |
| d1yt8a4 | 130 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 84.94 | |
| d1rhsa2 | 144 | Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | 84.56 | |
| d1t3ka_ | 132 | Dual specificity phosphatase Cdc25 {Thale cress (A | 82.87 | |
| d1yt8a1 | 136 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 80.21 |
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: Putative phosphatase At1g05000 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=100.00 E-value=3.3e-42 Score=265.20 Aligned_cols=150 Identities=69% Similarity=1.254 Sum_probs=138.2
Q ss_pred eeeCCCCccccccceeecCCCCCCChhHHhccCCcEEEEcCCCCCCchhHhHhhhCCcEEEEeecCCCCCCCCCCCHHHH
Q 028894 14 VLVPPPNFSMVEEGIYRSSFPQSSNFPFLQTLNLRSIIYLCPEPYPEENLKFLAAQNIRLFHFGIEGKTEPPVSIPKDTI 93 (202)
Q Consensus 14 ~~~pp~nf~~V~~~Lyrs~~p~~~~~~~L~~~giktVI~L~~e~~~~~~~~~~~~~gI~~~~ipi~d~~~p~~~~~~~~i 93 (202)
+++||.||++|+++||||++|++.++++|+++|||+|||||++........++...||+++++|+.+...+......+.+
T Consensus 1 ~~~pp~nF~~V~~~lyRs~~~t~~~~~~L~~lgIktIidLr~~~e~~~~~~~~~~~gi~~~~ip~~~~~~~~~~~~~~~~ 80 (151)
T d1xria_ 1 HLIPPLNFSMVDNGIFRSGFPDSANFSFLQTLGLRSIIYLCPEPYPESNLQFLKSNGIRLFQFGIEGNKEPFVNIPDHKI 80 (151)
T ss_dssp CBCCCTTCEEEETTEEEESCCCHHHHHHHHHHTCSEEEECCSSCCCHHHHHHHHHHTCEEEECCCCCCCGGGCCCCHHHH
T ss_pred CCCCCcccceecCCceecCCCCHHHHHHHHHCCCCEEEECCCcchhhcccchhhhcCceEeecCccccccccccccHHHH
Confidence 47999999999999999999999999999999999999999886666777889999999999999987765555678899
Q ss_pred HHHHHHHHhCCCCcEEEEeCCCCchHHHHHHHHHHHcCCCHHHHHHHHHHhhCCCCCchHHHHHHhcccc
Q 028894 94 MEALKILIDVRNHPVLIHCKRGKHRTGCLVGCLRKLQNWCLSSVFEEYRHFAGLKSRDTDLKFMETFNVM 163 (202)
Q Consensus 94 ~~~l~~i~~~~~~pVlVHC~~G~~RTG~vva~~l~~~gws~~~a~~ey~~~~~~~~~~~~~~fie~f~~~ 163 (202)
..+++.+.+..++||||||++|+||||+++||||+++||+.++|++||++++.+..+..+++|||.||+.
T Consensus 81 ~~~~~~~~~~~~~pvlvHC~~GkdRTG~v~a~~l~~~g~~~~~i~~dy~~~~~~~~~~~~~~fiE~f~~~ 150 (151)
T d1xria_ 81 RMALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLTSIFDEYQRFAAAKARVSDQRFMEIFDVS 150 (151)
T ss_dssp HHHHHHHHCGGGCSEEEECSSSSSHHHHHHHHHHHHTTBCHHHHHHHHHHHHGGGCCHHHHHHHHTCCCC
T ss_pred HHHHHHHhcCCCCCEEEEcCCCchHHHHHHHHHHHHcCCCHHHHHHHHHHhccCcccHHHHHHHHHhCCC
Confidence 9999999988899999999999999999999999999999999999999999877888899999999975
|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|