Citrus Sinensis ID: 028917

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
MATKIYIVYYSLYGHVETMAREVQRGANSVLGVEATLWQVPETLSSVILQKMKAPPKTNDVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFAADGSRQPTDLELQQAFHQGKYVAEIAKKLKR
cccEEEEEEEccccHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHccccccccccccccHHHHHHccEEEEEccccccccHHHHHHHHHHcHHHHHHccccccccEEEEccccccccHHHHHHHHHHHHHHHccEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHc
cccEEEEEEEEcHHHHHHHHHHHHHcccccccEEEEEEEccccccHHHHHHccccccccccccccHHHHHHccEEEEccccccccHHHHHHHHHHHHccHHHccccccccEEEEEEcccccccHHHHHHHHHHHHHHccEEEEEccccccccccccccccccccccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHcc
MATKIYIVYYSLYGHVETMAREVQRGANSVLGVEATLWQVPETLSSVILQKmkappktndvpvirphqlkeadgflfgfpsrfgVMAAQCKAFFDATYELWASQAlagkpagifwstgfhgggqeLTALTAVTQLAHhgmlfvplgytfgsgmfemnevkggssygagtfaadgsrqptDLELQQAFHQGKYVAEIAKKLKR
MATKIYIVYYSLYGHVETMAREVQRGANSVLGVEATLWQVPETLSSVILQKMKAPPKTNDVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFAADGSRQPTDLELQQAFHQGKYVAEIAKKLKR
MATKIYIVYYSLYGHVETMAREVQRGANSVLGVEATLWQVPETLSSVILQKMKAPPKTNDVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFAADGSRQPTDLELQQAFHQGKYVAEIAKKLKR
***KIYIVYYSLYGHVETMAREVQRGANSVLGVEATLWQVPETLSSVILQKM*******DVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVK******************************************
MATKIYIVYYSLYGHVETMAREVQRGANSVLGVEATLWQVPETLSSVILQKMKAPPKTNDVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFA**********ELQQAFHQGKYVAEIAKKLKR
MATKIYIVYYSLYGHVETMAREVQRGANSVLGVEATLWQVPETLSSVILQKMKAPPKTNDVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFAADGSRQPTDLELQQAFHQGKYVAEIAKKLKR
*ATKIYIVYYSLYGHVETMAREVQRGANSVLGVEATLWQVPETLSSVILQKMKAPPKTNDVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFAADGSRQPTDLELQQAFHQGKYVAEIAKKLKR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATKIYIVYYSLYGHVETMAREVQRGANSVLGVEATLWQVPETLSSVILQKMKAPPKTNDVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFAADGSRQPTDLELQQAFHQGKYVAEIAKKLKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query202 2.2.26 [Sep-21-2011]
A8AI59198 Flavoprotein WrbA OS=Citr yes no 0.960 0.979 0.502 2e-45
Q32HQ6198 Flavoprotein WrbA OS=Shig yes no 0.965 0.984 0.495 2e-45
B5YU47198 Flavoprotein WrbA OS=Esch yes no 0.960 0.979 0.497 2e-45
Q8X4B4198 Putative flavoprotein Wrb N/A no 0.960 0.979 0.497 2e-45
B5XXP0198 Flavoprotein WrbA OS=Kleb yes no 0.955 0.974 0.5 3e-45
Q8Z7N9198 Flavoprotein WrbA OS=Salm N/A no 0.960 0.979 0.497 5e-45
Q3Z3B7201 Flavoprotein WrbA OS=Shig yes no 0.960 0.965 0.492 6e-45
P0A8G8198 Flavoprotein WrbA OS=Shig yes no 0.960 0.979 0.492 7e-45
Q0T630198 Flavoprotein WrbA OS=Shig yes no 0.960 0.979 0.492 7e-45
Q1RDL3198 Flavoprotein WrbA OS=Esch yes no 0.960 0.979 0.492 7e-45
>sp|A8AI59|WRBA_CITK8 Flavoprotein WrbA OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=wrbA PE=3 SV=1 Back     alignment and function desciption
 Score =  182 bits (461), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 129/199 (64%), Gaps = 5/199 (2%)

Query: 4   KIYIVYYSLYGHVETMAREVQRGANSVLGVEATLWQVPETLSSVILQKMKAPPKTNDVPV 63
           KI ++YYS+YGH+ETMA  V  GAN V G E  + +VPET+   I    KA  KT + PV
Sbjct: 3   KILVLYYSMYGHIETMAHAVAEGANKVDGAEVVIKRVPETMQPEIF--AKAGGKTQNAPV 60

Query: 64  IRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGG 123
             P +L + D  +FG P+RFG M+ Q + F D T  LWAS AL GK A +F STG  GGG
Sbjct: 61  ATPQELPDYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTG-TGGG 119

Query: 124 QELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFA-ADGSRQPTDLE 182
           QE T  +  T LAHHGM+ VP+GY     +F++++V+GG+ YGA T A  DGSRQP+  E
Sbjct: 120 QEQTITSTWTTLAHHGMVIVPIGYA-AQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEE 178

Query: 183 LQQAFHQGKYVAEIAKKLK 201
           L  A +QG+YVA +A KL 
Sbjct: 179 LSIARYQGEYVAGLAVKLN 197
Seems to enhance the formation and/or stability of noncovalent complexes between the trp repressor protein and operator-bearing DNA.
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) (taxid: 290338)
>sp|Q32HQ6|WRBA_SHIDS Flavoprotein WrbA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|B5YU47|WRBA_ECO5E Flavoprotein WrbA OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|Q8X4B4|WRBA_ECO57 Putative flavoprotein WrbA OS=Escherichia coli O157:H7 GN=wrbA PE=5 SV=3 Back     alignment and function description
>sp|B5XXP0|WRBA_KLEP3 Flavoprotein WrbA OS=Klebsiella pneumoniae (strain 342) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|Q8Z7N9|WRBA_SALTI Flavoprotein WrbA OS=Salmonella typhi GN=wrbA PE=3 SV=3 Back     alignment and function description
>sp|Q3Z3B7|WRBA_SHISS Flavoprotein WrbA OS=Shigella sonnei (strain Ss046) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|P0A8G8|WRBA_SHIFL Flavoprotein WrbA OS=Shigella flexneri GN=wrbA PE=3 SV=2 Back     alignment and function description
>sp|Q0T630|WRBA_SHIF8 Flavoprotein WrbA OS=Shigella flexneri serotype 5b (strain 8401) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|Q1RDL3|WRBA_ECOUT Flavoprotein WrbA OS=Escherichia coli (strain UTI89 / UPEC) GN=wrbA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query202
255569313203 Flavoprotein wrbA, putative [Ricinus com 0.985 0.980 0.899 1e-102
224106287203 predicted protein [Populus trichocarpa] 0.985 0.980 0.844 1e-94
449450804203 PREDICTED: flavoprotein WrbA-like [Cucum 0.990 0.985 0.84 5e-94
225434636211 PREDICTED: flavoprotein wrbA isoform 1 [ 0.990 0.947 0.825 2e-93
356553062203 PREDICTED: flavoprotein wrbA-like [Glyci 0.985 0.980 0.819 9e-93
388499250204 unknown [Lotus japonicus] 0.990 0.980 0.8 2e-91
357490641203 Flavoprotein wrbA [Medicago truncatula] 0.985 0.980 0.804 2e-90
22327957207 quinone reductase-like protein [Arabidop 0.990 0.966 0.77 2e-86
297789297207 quinone reductase family protein [Arabid 0.990 0.966 0.77 4e-86
116785818203 unknown [Picea sitchensis] 0.990 0.985 0.736 1e-84
>gi|255569313|ref|XP_002525624.1| Flavoprotein wrbA, putative [Ricinus communis] gi|223535060|gb|EEF36742.1| Flavoprotein wrbA, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 179/199 (89%), Positives = 193/199 (96%)

Query: 3   TKIYIVYYSLYGHVETMAREVQRGANSVLGVEATLWQVPETLSSVILQKMKAPPKTNDVP 62
           TK+YIVYYSLYGHVETMAREVQRGANSV GVEAT+WQVPETLS++I++KMKAPPK +DVP
Sbjct: 4   TKVYIVYYSLYGHVETMAREVQRGANSVQGVEATIWQVPETLSNLIVEKMKAPPKADDVP 63

Query: 63  VIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGG 122
           VI+P QL EADGF+FGFPSRFGVMAAQ KAFFDAT ELWASQALAGKPAGIFWSTGFHGG
Sbjct: 64  VIQPEQLLEADGFIFGFPSRFGVMAAQFKAFFDATGELWASQALAGKPAGIFWSTGFHGG 123

Query: 123 GQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFAADGSRQPTDLE 182
           GQELTALTA+TQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGT+AADG+R+PT+LE
Sbjct: 124 GQELTALTAITQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTYAADGTREPTELE 183

Query: 183 LQQAFHQGKYVAEIAKKLK 201
           LQQAFHQGKYVAEIAKKLK
Sbjct: 184 LQQAFHQGKYVAEIAKKLK 202

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224106287|ref|XP_002314113.1| predicted protein [Populus trichocarpa] gi|222850521|gb|EEE88068.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449450804|ref|XP_004143152.1| PREDICTED: flavoprotein WrbA-like [Cucumis sativus] gi|449520663|ref|XP_004167353.1| PREDICTED: flavoprotein WrbA-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225434636|ref|XP_002279668.1| PREDICTED: flavoprotein wrbA isoform 1 [Vitis vinifera] gi|297745921|emb|CBI15977.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356553062|ref|XP_003544877.1| PREDICTED: flavoprotein wrbA-like [Glycine max] Back     alignment and taxonomy information
>gi|388499250|gb|AFK37691.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|357490641|ref|XP_003615608.1| Flavoprotein wrbA [Medicago truncatula] gi|355516943|gb|AES98566.1| Flavoprotein wrbA [Medicago truncatula] gi|388503242|gb|AFK39687.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|22327957|ref|NP_200688.2| quinone reductase-like protein [Arabidopsis thaliana] gi|79331364|ref|NP_001032099.1| quinone reductase-like protein [Arabidopsis thaliana] gi|8843802|dbj|BAA97350.1| 1,4-benzoquinone reductase-like [Arabidopsis thaliana] gi|17381198|gb|AAL36411.1| putative light harvesting pigment protein [Arabidopsis thaliana] gi|20465807|gb|AAM20008.1| putative light harvesting pigment protein [Arabidopsis thaliana] gi|332009722|gb|AED97105.1| quinone reductase-like protein [Arabidopsis thaliana] gi|332009723|gb|AED97106.1| quinone reductase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297789297|ref|XP_002862630.1| quinone reductase family protein [Arabidopsis lyrata subsp. lyrata] gi|297796817|ref|XP_002866293.1| quinone reductase family protein [Arabidopsis lyrata subsp. lyrata] gi|297308269|gb|EFH38888.1| quinone reductase family protein [Arabidopsis lyrata subsp. lyrata] gi|297312128|gb|EFH42552.1| quinone reductase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|116785818|gb|ABK23874.1| unknown [Picea sitchensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query202
TAIR|locus:2178868207 AT5G58800 [Arabidopsis thalian 0.990 0.966 0.77 1.5e-81
TAIR|locus:2131749205 AT4G27270 [Arabidopsis thalian 0.990 0.975 0.736 4.2e-79
TAIR|locus:2115405273 AT4G36750 [Arabidopsis thalian 0.975 0.721 0.624 5.8e-66
ASPGD|ASPL0000059021204 AN0297 [Emericella nidulans (t 0.935 0.926 0.525 4.4e-45
CGD|CAL0003649199 PST3 [Candida albicans (taxid: 0.975 0.989 0.517 5.6e-45
CGD|CAL0003651288 YCP4 [Candida albicans (taxid: 0.970 0.680 0.502 1.5e-44
UNIPROTKB|P0A8G6198 wrbA [Escherichia coli K-12 (t 0.955 0.974 0.494 1.9e-44
CGD|CAL0000303201 PST2 [Candida albicans (taxid: 0.910 0.915 0.510 1.9e-42
UNIPROTKB|G4MTI8204 MGG_01569 "Minor allergen Alt 0.940 0.931 0.494 1.9e-42
UNIPROTKB|Q59Y37201 PST2 "Putative uncharacterized 0.910 0.915 0.510 1.9e-42
TAIR|locus:2178868 AT5G58800 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 818 (293.0 bits), Expect = 1.5e-81, P = 1.5e-81
 Identities = 154/200 (77%), Positives = 174/200 (87%)

Query:     3 TKIYIVYYSLYGHVETMAREVQRGANSVLGVEATLWQVPETLSSVILQKMKAPPKTNDVP 62
             TKIYIVYYSL+GHVETMAREV RG NSV  VEATLWQVPETL   IL+K+KA P+ +DVP
Sbjct:     4 TKIYIVYYSLHGHVETMAREVLRGVNSVPDVEATLWQVPETLPEKILEKVKAVPRPDDVP 63

Query:    63 VIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGG 122
              IRP QL EADGF+FGFPSRFGVMA+Q   FFD T +LW +QALAGKPAGIFWSTGFHGG
Sbjct:    64 DIRPEQLAEADGFMFGFPSRFGVMASQVMTFFDNTNDLWTTQALAGKPAGIFWSTGFHGG 123

Query:   123 GQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFAADGSRQPTDLE 182
             GQELTALTAVT+LAHHGM+FVP+GYTFG  M+EM EVKGGS YG+GT+AADGSR+PT+LE
Sbjct:   124 GQELTALTAVTKLAHHGMIFVPVGYTFGKSMYEMGEVKGGSPYGSGTYAADGSREPTELE 183

Query:   183 LQQAFHQGKYVAEIAKKLKR 202
             +QQA + GKY A IAKKLK+
Sbjct:   184 IQQANYHGKYFAGIAKKLKK 203
GO:0005737 "cytoplasm" evidence=ISM
GO:0010181 "FMN binding" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2131749 AT4G27270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115405 AT4G36750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000059021 AN0297 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
CGD|CAL0003649 PST3 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
CGD|CAL0003651 YCP4 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|P0A8G6 wrbA [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
CGD|CAL0000303 PST2 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|G4MTI8 MGG_01569 "Minor allergen Alt a 7" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|Q59Y37 PST2 "Putative uncharacterized protein CQR2" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B7N3F9WRBA_ECOLUNo assigned EC number0.49240.96030.9797yesno
A9N6R4WRBA_SALPBNo assigned EC number0.49240.96030.9797yesno
Q1CHD6WRBA_YERPNNo assigned EC number0.490.96030.9748yesno
B7UNY7WRBA_ECO27No assigned EC number0.49240.96030.9797yesno
Q0T630WRBA_SHIF8No assigned EC number0.49240.96030.9797yesno
B5BBG6WRBA_SALPKNo assigned EC number0.49240.96030.9797yesno
B7LFB3WRBA_ECO55No assigned EC number0.49240.96030.9797yesno
B7LP27WRBA_ESCF3No assigned EC number0.49240.96030.9797yesno
B5YU47WRBA_ECO5ENo assigned EC number0.49740.96030.9797yesno
Q32HQ6WRBA_SHIDSNo assigned EC number0.4950.96530.9848yesno
B5F202WRBA_SALA4No assigned EC number0.49240.96030.9797yesno
Q1RDL3WRBA_ECOUTNo assigned EC number0.49240.96030.9797yesno
A8GCS6WRBA_SERP5No assigned EC number0.48740.96530.9798yesno
B4TSN0WRBA_SALSVNo assigned EC number0.49240.96030.9797yesno
C4ZQD2WRBA_ECOBWNo assigned EC number0.49240.96030.9797yesno
B6I980WRBA_ECOSENo assigned EC number0.49240.96030.9797yesno
P42058ALTA7_ALTALNo assigned EC number0.50990.98010.9705N/Ano
B7NLC1WRBA_ECO7INo assigned EC number0.49240.96030.9797yesno
B7M8Y8WRBA_ECO8ANo assigned EC number0.49240.96030.9797yesno
A4W916WRBA_ENT38No assigned EC number0.48240.96030.9797yesno
A8AI59WRBA_CITK8No assigned EC number0.50250.96030.9797yesno
A7ZKA9WRBA_ECO24No assigned EC number0.49240.96030.9797yesno
B1X9C5WRBA_ECODHNo assigned EC number0.49240.96030.9797yesno
Q8ZQ40WRBA_SALTYNo assigned EC number0.48740.96030.9797yesno
B7MIE9WRBA_ECO45No assigned EC number0.49240.96030.9797yesno
P0A8G7WRBA_ECOL6No assigned EC number0.49240.96030.9797yesno
A7ZYV7WRBA_ECOHSNo assigned EC number0.49240.96030.9797yesno
Q0TJ63WRBA_ECOL5No assigned EC number0.49240.96030.9797yesno
B1IV93WRBA_ECOLCNo assigned EC number0.49240.96030.9797yesno
Q5PG91WRBA_SALPANo assigned EC number0.49240.96030.9797yesno
A4TK49WRBA_YERPPNo assigned EC number0.490.96030.9748yesno
P0A8G8WRBA_SHIFLNo assigned EC number0.49240.96030.9797yesno
C0Q886WRBA_SALPCNo assigned EC number0.48740.96030.9797yesno
B1LJ00WRBA_ECOSMNo assigned EC number0.49240.96030.9797yesno
A1A9Q9WRBA_ECOK1No assigned EC number0.49240.96030.9797yesno
B5R056WRBA_SALEPNo assigned EC number0.49240.96030.9797yesno
C4XGC2WRBA_DESMRNo assigned EC number0.45040.97520.9704yesno
B5R6H0WRBA_SALG2No assigned EC number0.49240.96030.9797yesno
B4T2V2WRBA_SALNSNo assigned EC number0.49240.96030.9797yesno
Q3Z3B7WRBA_SHISSNo assigned EC number0.49240.96030.9651yesno
A9R7R8WRBA_YERPGNo assigned EC number0.490.96030.9748yesno
Q66BP3WRBA_YERPSNo assigned EC number0.490.96030.9748yesno
B5XXP0WRBA_KLEP3No assigned EC number0.50.95540.9747yesno
B1JNA9WRBA_YERPYNo assigned EC number0.490.96030.9748yesno
B5FR47WRBA_SALDCNo assigned EC number0.49240.96030.9797yesno
B4TEP2WRBA_SALHSNo assigned EC number0.49240.96030.9797yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
PRK03767200 PRK03767, PRK03767, NAD(P)H:quinone oxidoreductase 2e-74
TIGR01755197 TIGR01755, flav_wrbA, NAD(P)H:quinone oxidoreducta 2e-61
COG0655207 COG0655, WrbA, Multimeric flavodoxin WrbA [General 1e-39
pfam00258142 pfam00258, Flavodoxin_1, Flavodoxin 2e-14
pfam03358151 pfam03358, FMN_red, NADPH-dependent FMN reductase 2e-11
TIGR01753140 TIGR01753, flav_short, flavodoxin, short chain 4e-04
>gnl|CDD|179647 PRK03767, PRK03767, NAD(P)H:quinone oxidoreductase; Provisional Back     alignment and domain information 
 Score =  222 bits (568), Expect = 2e-74
 Identities = 97/202 (48%), Positives = 124/202 (61%), Gaps = 5/202 (2%)

Query: 3   TKIYIVYYSLYGHVETMAREVQRGANSVLGVEATLWQVPETLSSVILQKMKAPPKTN-DV 61
            K+ ++YYS+YGH+ETMA  V  GA  V G E T+ +VPET+   + +K     KT+   
Sbjct: 2   AKVLVLYYSMYGHIETMAEAVAEGAREVAGAEVTIKRVPETVPEEVAKKAGG--KTDQAA 59

Query: 62  PVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHG 121
           PV  P +L + D  +FG P+RFG MA Q + F D T  LWA  AL GK   +F STG   
Sbjct: 60  PVATPDELADYDAIIFGTPTRFGNMAGQMRNFLDQTGGLWAKGALVGKVGSVFTSTGTQH 119

Query: 122 GGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFA-ADGSRQPTD 180
           GGQE T  +  T L HHGM+ V L Y F  G  +++EV GGS YGA T A  DGSRQP++
Sbjct: 120 GGQETTITSTHTTLLHHGMVIVGLPYAF-QGQMDVDEVTGGSPYGATTIAGGDGSRQPSE 178

Query: 181 LELQQAFHQGKYVAEIAKKLKR 202
            EL  A +QG++VAEIA KL  
Sbjct: 179 NELAGARYQGRHVAEIAAKLAG 200

Length = 200
>gnl|CDD|130816 TIGR01755, flav_wrbA, NAD(P)H:quinone oxidoreductase, type IV Back     alignment and domain information
>gnl|CDD|223728 COG0655, WrbA, Multimeric flavodoxin WrbA [General function prediction only] Back     alignment and domain information
>gnl|CDD|215823 pfam00258, Flavodoxin_1, Flavodoxin Back     alignment and domain information
>gnl|CDD|217511 pfam03358, FMN_red, NADPH-dependent FMN reductase Back     alignment and domain information
>gnl|CDD|233559 TIGR01753, flav_short, flavodoxin, short chain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 202
PRK03767200 NAD(P)H:quinone oxidoreductase; Provisional 100.0
TIGR01755197 flav_wrbA NAD(P)H:quinone oxidoreductase, type IV. 100.0
KOG3135203 consensus 1,4-benzoquinone reductase-like; Trp rep 100.0
COG0655207 WrbA Multimeric flavodoxin WrbA [General function 99.97
PRK06756148 flavodoxin; Provisional 99.96
PRK05569141 flavodoxin; Provisional 99.96
PRK05568142 flavodoxin; Provisional 99.95
PRK06703151 flavodoxin; Provisional 99.94
PRK06242150 flavodoxin; Provisional 99.94
TIGR01753140 flav_short flavodoxin, short chain. Flavodoxins ar 99.93
PRK07308146 flavodoxin; Validated 99.93
PF03358152 FMN_red: NADPH-dependent FMN reductase; InterPro: 99.92
PRK11921394 metallo-beta-lactamase/flavodoxin domain-containin 99.92
PRK05452479 anaerobic nitric oxide reductase flavorubredoxin; 99.91
PRK09267169 flavodoxin FldA; Validated 99.91
PRK10569191 NAD(P)H-dependent FMN reductase; Provisional 99.9
TIGR03566174 FMN_reduc_MsuE FMN reductase, MsuE subfamily. Memb 99.87
TIGR03567171 FMN_reduc_SsuE FMN reductase, SsuE family. Members 99.87
PRK12359172 flavodoxin FldB; Provisional 99.86
COG0426388 FpaA Uncharacterized flavoproteins [Energy product 99.86
PRK00170201 azoreductase; Reviewed 99.86
TIGR01752167 flav_long flavodoxin, long chain. Flavodoxins are 99.84
PRK01355199 azoreductase; Reviewed 99.84
PRK09271160 flavodoxin; Provisional 99.83
PRK09739199 hypothetical protein; Provisional 99.82
TIGR02690219 resist_ArsH arsenical resistance protein ArsH. Mem 99.81
TIGR01754140 flav_RNR ribonucleotide reductase-associated flavo 99.8
PF12682156 Flavodoxin_4: Flavodoxin; PDB: 3EDO_B 3KLB_A. 99.79
PRK07116160 flavodoxin; Provisional 99.78
PRK13556208 azoreductase; Provisional 99.78
PRK11104177 hemG protoporphyrinogen oxidase; Provisional 99.76
PRK06934221 flavodoxin; Provisional 99.76
PF12641160 Flavodoxin_3: Flavodoxin domain 99.75
PRK09004146 FMN-binding protein MioC; Provisional 99.74
COG0716151 FldA Flavodoxins [Energy production and conversion 99.74
PRK13555208 azoreductase; Provisional 99.72
PF02525199 Flavodoxin_2: Flavodoxin-like fold; InterPro: IPR0 99.72
PF12724143 Flavodoxin_5: Flavodoxin domain 99.7
PF00258143 Flavodoxin_1: Flavodoxin; InterPro: IPR008254 This 99.68
PRK08105149 flavodoxin; Provisional 99.68
PRK04930184 glutathione-regulated potassium-efflux system anci 99.67
COG0431184 Predicted flavoprotein [General function predictio 99.67
COG4635175 HemG Flavodoxin [Energy production and conversion 99.64
PRK00871176 glutathione-regulated potassium-efflux system anci 99.58
COG2249189 MdaB Putative NADPH-quinone reductase (modulator o 99.56
PRK05723151 flavodoxin; Provisional 99.5
COG1182202 AcpD Acyl carrier protein phosphodiesterase [Lipid 99.47
PRK10953 600 cysJ sulfite reductase subunit alpha; Provisional 99.41
TIGR01931 597 cysJ sulfite reductase [NADPH] flavoprotein, alpha 99.34
KOG4530199 consensus Predicted flavoprotein [General function 99.32
PRK03600134 nrdI ribonucleotide reductase stimulatory protein; 99.11
TIGR00333125 nrdI ribonucleoside-diphosphate reductase 2, opero 98.95
PRK02551154 flavoprotein NrdI; Provisional 98.57
KOG1159 574 consensus NADP-dependent flavoprotein reductase [E 98.45
PF07972122 Flavodoxin_NdrI: NrdI Flavodoxin like ; InterPro: 97.67
COG1780141 NrdI Protein involved in ribonucleotide reduction 97.63
PRK1031094 PTS system galactitol-specific transporter subunit 97.06
COG0369 587 CysJ Sulfite reductase, alpha subunit (flavoprotei 96.84
PRK10427114 putative PTS system fructose-like transporter subu 96.81
PRK10499106 PTS system N,N'-diacetylchitobiose-specific transp 96.16
TIGR0085395 pts-lac PTS system, lactose/cellobiose family IIB 96.11
COG1440102 CelA Phosphotransferase system cellobiose-specific 96.03
PRK07053234 glutamine amidotransferase; Provisional 95.82
PF0230290 PTS_IIB: PTS system, Lactose/Cellobiose specific I 95.7
cd0556599 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of en 95.47
COG1445122 FrwB Phosphotransferase system fructose-specific c 95.43
PRK09590104 celB cellobiose phosphotransferase system IIB comp 95.28
KOG1160 601 consensus Fe-S oxidoreductase [Energy production a 95.09
cd0556689 PTS_IIB_galactitol PTS_IIB_galactitol: subunit IIB 94.38
cd0556496 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lic 94.36
COG341493 SgaB Phosphotransferase system, galactitol-specifi 93.49
PRK13143200 hisH imidazole glycerol phosphate synthase subunit 93.1
PRK06490239 glutamine amidotransferase; Provisional 92.41
PF06283217 ThuA: Trehalose utilisation; PDB: 4E5V_A 1T0B_A. 92.26
cd0556787 PTS_IIB_mannitol PTS_IIB_mannitol: subunit IIB of 91.8
PRK08250235 glutamine amidotransferase; Provisional 90.91
cd0556996 PTS_IIB_fructose PTS_IIB_fructose: subunit IIB of 90.71
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 90.66
KOG3179245 consensus Predicted glutamine synthetase [Nucleoti 90.35
PRK01175261 phosphoribosylformylglycinamidine synthase I; Prov 90.04
PRK05665240 amidotransferase; Provisional 89.93
PRK09065237 glutamine amidotransferase; Provisional 89.75
PRK11574196 oxidative-stress-resistance chaperone; Provisional 89.15
cd0013384 PTS_IIB PTS_IIB: subunit IIB of enzyme II (EII) is 88.83
PRK06895190 putative anthranilate synthase component II; Provi 88.64
PRK09548602 PTS system ascorbate-specific transporter subunits 88.32
TIGR0082985 FRU PTS system, fructose-specific, IIB component. 88.29
cd0556386 PTS_IIB_ascorbate PTS_IIB_ascorbate: subunit IIB o 88.08
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 88.05
PRK11404 482 putative PTS system transporter subunits IIBC; Pro 87.6
PRK01372304 ddl D-alanine--D-alanine ligase; Reviewed 87.59
cd0556885 PTS_IIB_bgl_like PTS_IIB_bgl_like: the PTS (phosph 86.8
PRK05928249 hemD uroporphyrinogen-III synthase; Reviewed 86.18
PRK10712 563 PTS system fructose-specific transporter subunits 85.5
COG1927277 Mtd Coenzyme F420-dependent N(5),N(10)-methenyltet 84.88
PRK13146209 hisH imidazole glycerol phosphate synthase subunit 84.87
PF00289110 CPSase_L_chain: Carbamoyl-phosphate synthase L cha 84.73
PRK13170196 hisH imidazole glycerol phosphate synthase subunit 83.84
CHL00188210 hisH imidazole glycerol phosphate synthase subunit 83.01
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 82.53
PRK00994277 F420-dependent methylenetetrahydromethanopterin de 82.43
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 82.22
PRK13608 391 diacylglycerol glucosyltransferase; Provisional 82.21
COG2910211 Putative NADH-flavin reductase [General function p 81.06
PRK10017 426 colanic acid biosynthesis protein; Provisional 80.94
PF08357150 SEFIR: SEFIR domain; InterPro: IPR013568 This doma 80.55
PRK14571299 D-alanyl-alanine synthetase A; Provisional 80.38
>PRK03767 NAD(P)H:quinone oxidoreductase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.8e-40  Score=252.85  Aligned_cols=199  Identities=48%  Similarity=0.753  Sum_probs=168.3

Q ss_pred             CCceEEEEEecCCChHHHHHHHHHHHhhccCCceEEEEEccCCCcHHHHhhcCCCCCCCCCCcCChhhhccCCeeEEecc
Q 028917            1 MATKIYIVYYSLYGHVETMAREVQRGANSVLGVEATLWQVPETLSSVILQKMKAPPKTNDVPVIRPHQLKEADGFLFGFP   80 (202)
Q Consensus         1 M~~kiliiy~S~~G~T~~la~~i~~~~~~~~g~~v~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~ad~ii~gsP   80 (202)
                      || ||+|||+|++|||++||++++++++++.|++++++++.+..|.++.....|....+ .+....+++.+||+||||||
T Consensus         1 M~-kilIvy~S~~G~T~~lA~~ia~g~~~~~G~ev~~~~l~~~~~~~~~~~~~~~~~~~-~~~~~~~~l~~aD~ii~gsP   78 (200)
T PRK03767          1 MA-KVLVLYYSMYGHIETMAEAVAEGAREVAGAEVTIKRVPETVPEEVAKKAGGKTDQA-APVATPDELADYDAIIFGTP   78 (200)
T ss_pred             CC-eEEEEEcCCCCHHHHHHHHHHHHHhhcCCcEEEEEeccccCCHHHHHhcCCCcccC-CCccCHHHHHhCCEEEEEec
Confidence            65 99999999999999999999999985468999999998777766654443433211 12123789999999999999


Q ss_pred             ccCCcchHHHHHHHHhhhhhhhhccCCCCceEEEEecCCCCCChHHHHHHHHHHHHHcCcEEecCCCcCCCCcccccccc
Q 028917           81 SRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVK  160 (202)
Q Consensus        81 ~y~g~~~~~~k~fld~~~~~~~~~~l~gK~~~~~~t~g~~~g~~~~~l~~~~~~l~~~g~~vv~~~~~~~~~~~~~~~~~  160 (202)
                      +|+|++++.+|.|+|++..+|....|.||++++|+++||.+|+.+.++.++...+.++||.+++.++. +..++..+..+
T Consensus        79 ty~g~~~~~lk~fld~~~~~~~~~~l~gK~~~~f~s~g~~~Gg~~~~l~~l~~~~~~~gm~vv~~~~~-~~~~~~~~~~~  157 (200)
T PRK03767         79 TRFGNMAGQMRNFLDQTGGLWAKGALVGKVGSVFTSTGTQHGGQETTITSTHTTLLHHGMVIVGLPYA-FQGQMDVDEVT  157 (200)
T ss_pred             ccCCCchHHHHHHHHHhccccccCCccCCEEEEEEeCCCCCCChHHHHHHHHHHHHHcCCEEeCCCCc-ccccccccccc
Confidence            99999999999999999887766679999999999999987888889999999999999999998776 44544445567


Q ss_pred             CcccccceeecC-CCCCCCCHHHHHHHHHHhHHHHHHHHHhhC
Q 028917          161 GGSSYGAGTFAA-DGSRQPTDLELQQAFHQGKYVAEIAKKLKR  202 (202)
Q Consensus       161 ~~~~~g~~~~~~-~~~~~p~e~~~~~a~~~g~~l~~~~~~~~~  202 (202)
                      +|++||+.++.+ +++.+|+++|++.|+.+|+|+++.+++|++
T Consensus       158 ~g~~~G~~~~~~~~~~~~p~~~d~~~a~~~g~r~a~~~~~~~~  200 (200)
T PRK03767        158 GGSPYGATTIAGGDGSRQPSENELAGARYQGRHVAEIAAKLAG  200 (200)
T ss_pred             CCcccceeeecCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHhC
Confidence            899999988776 677899999999999999999999999874

>TIGR01755 flav_wrbA NAD(P)H:quinone oxidoreductase, type IV Back     alignment and domain information
>KOG3135 consensus 1,4-benzoquinone reductase-like; Trp repressor binding protein-like/protoplast-secreted protein [General function prediction only] Back     alignment and domain information
>COG0655 WrbA Multimeric flavodoxin WrbA [General function prediction only] Back     alignment and domain information
>PRK06756 flavodoxin; Provisional Back     alignment and domain information
>PRK05569 flavodoxin; Provisional Back     alignment and domain information
>PRK05568 flavodoxin; Provisional Back     alignment and domain information
>PRK06703 flavodoxin; Provisional Back     alignment and domain information
>PRK06242 flavodoxin; Provisional Back     alignment and domain information
>TIGR01753 flav_short flavodoxin, short chain Back     alignment and domain information
>PRK07308 flavodoxin; Validated Back     alignment and domain information
>PF03358 FMN_red: NADPH-dependent FMN reductase; InterPro: IPR005025 NADPH-dependent FMN reductase (1 Back     alignment and domain information
>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>PRK09267 flavodoxin FldA; Validated Back     alignment and domain information
>PRK10569 NAD(P)H-dependent FMN reductase; Provisional Back     alignment and domain information
>TIGR03566 FMN_reduc_MsuE FMN reductase, MsuE subfamily Back     alignment and domain information
>TIGR03567 FMN_reduc_SsuE FMN reductase, SsuE family Back     alignment and domain information
>PRK12359 flavodoxin FldB; Provisional Back     alignment and domain information
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>PRK00170 azoreductase; Reviewed Back     alignment and domain information
>TIGR01752 flav_long flavodoxin, long chain Back     alignment and domain information
>PRK01355 azoreductase; Reviewed Back     alignment and domain information
>PRK09271 flavodoxin; Provisional Back     alignment and domain information
>PRK09739 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02690 resist_ArsH arsenical resistance protein ArsH Back     alignment and domain information
>TIGR01754 flav_RNR ribonucleotide reductase-associated flavodoxin, putative Back     alignment and domain information
>PF12682 Flavodoxin_4: Flavodoxin; PDB: 3EDO_B 3KLB_A Back     alignment and domain information
>PRK07116 flavodoxin; Provisional Back     alignment and domain information
>PRK13556 azoreductase; Provisional Back     alignment and domain information
>PRK11104 hemG protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK06934 flavodoxin; Provisional Back     alignment and domain information
>PF12641 Flavodoxin_3: Flavodoxin domain Back     alignment and domain information
>PRK09004 FMN-binding protein MioC; Provisional Back     alignment and domain information
>COG0716 FldA Flavodoxins [Energy production and conversion] Back     alignment and domain information
>PRK13555 azoreductase; Provisional Back     alignment and domain information
>PF02525 Flavodoxin_2: Flavodoxin-like fold; InterPro: IPR003680 This family consists of a domain with a flavodoxin-like fold Back     alignment and domain information
>PF12724 Flavodoxin_5: Flavodoxin domain Back     alignment and domain information
>PF00258 Flavodoxin_1: Flavodoxin; InterPro: IPR008254 This domain is found in a number of proteins including flavodoxin and nitric-oxide synthase Back     alignment and domain information
>PRK08105 flavodoxin; Provisional Back     alignment and domain information
>PRK04930 glutathione-regulated potassium-efflux system ancillary protein KefG; Provisional Back     alignment and domain information
>COG0431 Predicted flavoprotein [General function prediction only] Back     alignment and domain information
>COG4635 HemG Flavodoxin [Energy production and conversion / Coenzyme metabolism] Back     alignment and domain information
>PRK00871 glutathione-regulated potassium-efflux system ancillary protein KefF; Provisional Back     alignment and domain information
>COG2249 MdaB Putative NADPH-quinone reductase (modulator of drug activity B) [General function prediction only] Back     alignment and domain information
>PRK05723 flavodoxin; Provisional Back     alignment and domain information
>COG1182 AcpD Acyl carrier protein phosphodiesterase [Lipid metabolism] Back     alignment and domain information
>PRK10953 cysJ sulfite reductase subunit alpha; Provisional Back     alignment and domain information
>TIGR01931 cysJ sulfite reductase [NADPH] flavoprotein, alpha-component Back     alignment and domain information
>KOG4530 consensus Predicted flavoprotein [General function prediction only] Back     alignment and domain information
>PRK03600 nrdI ribonucleotide reductase stimulatory protein; Reviewed Back     alignment and domain information
>TIGR00333 nrdI ribonucleoside-diphosphate reductase 2, operon protein nrdI Back     alignment and domain information
>PRK02551 flavoprotein NrdI; Provisional Back     alignment and domain information
>KOG1159 consensus NADP-dependent flavoprotein reductase [Energy production and conversion] Back     alignment and domain information
>PF07972 Flavodoxin_NdrI: NrdI Flavodoxin like ; InterPro: IPR004465 Ribonucleotide reductases (RNRs) are enzymes that provide the precursors of DNA synthesis Back     alignment and domain information
>COG1780 NrdI Protein involved in ribonucleotide reduction [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK10310 PTS system galactitol-specific transporter subunit IIB; Provisional Back     alignment and domain information
>COG0369 CysJ Sulfite reductase, alpha subunit (flavoprotein) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10427 putative PTS system fructose-like transporter subunit EIIB; Provisional Back     alignment and domain information
>PRK10499 PTS system N,N'-diacetylchitobiose-specific transporter subunit IIB; Provisional Back     alignment and domain information
>TIGR00853 pts-lac PTS system, lactose/cellobiose family IIB component Back     alignment and domain information
>COG1440 CelA Phosphotransferase system cellobiose-specific component IIB [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07053 glutamine amidotransferase; Provisional Back     alignment and domain information
>PF02302 PTS_IIB: PTS system, Lactose/Cellobiose specific IIB subunit; InterPro: IPR003501 The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes Back     alignment and domain information
>cd05565 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of enzyme II (EII) of the lactose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) found in Firmicutes as well as Actinobacteria Back     alignment and domain information
>COG1445 FrwB Phosphotransferase system fructose-specific component IIB [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09590 celB cellobiose phosphotransferase system IIB component; Reviewed Back     alignment and domain information
>KOG1160 consensus Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>cd05566 PTS_IIB_galactitol PTS_IIB_galactitol: subunit IIB of enzyme II (EII) of the galactitol-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>cd05564 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>COG3414 SgaB Phosphotransferase system, galactitol-specific IIB component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK06490 glutamine amidotransferase; Provisional Back     alignment and domain information
>PF06283 ThuA: Trehalose utilisation; PDB: 4E5V_A 1T0B_A Back     alignment and domain information
>cd05567 PTS_IIB_mannitol PTS_IIB_mannitol: subunit IIB of enzyme II (EII) of the mannitol-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>PRK08250 glutamine amidotransferase; Provisional Back     alignment and domain information
>cd05569 PTS_IIB_fructose PTS_IIB_fructose: subunit IIB of enzyme II (EII) of the fructose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>KOG3179 consensus Predicted glutamine synthetase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>PRK05665 amidotransferase; Provisional Back     alignment and domain information
>PRK09065 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK11574 oxidative-stress-resistance chaperone; Provisional Back     alignment and domain information
>cd00133 PTS_IIB PTS_IIB: subunit IIB of enzyme II (EII) is the central energy-coupling domain of the phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>PRK06895 putative anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK09548 PTS system ascorbate-specific transporter subunits IICB; Provisional Back     alignment and domain information
>TIGR00829 FRU PTS system, fructose-specific, IIB component Back     alignment and domain information
>cd05563 PTS_IIB_ascorbate PTS_IIB_ascorbate: subunit IIB of enzyme II (EII) of the L-ascorbate-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK11404 putative PTS system transporter subunits IIBC; Provisional Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>cd05568 PTS_IIB_bgl_like PTS_IIB_bgl_like: the PTS (phosphotransferase system) IIB domain of a family of sensory systems composed of a membrane-bound sugar-sensor (similar to BglF) and a transcription antiterminator (similar to BglG) which regulate expression of genes involved in sugar utilization Back     alignment and domain information
>PRK05928 hemD uroporphyrinogen-III synthase; Reviewed Back     alignment and domain information
>PRK10712 PTS system fructose-specific transporter subunits IIBC; Provisional Back     alignment and domain information
>COG1927 Mtd Coenzyme F420-dependent N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PF00289 CPSase_L_chain: Carbamoyl-phosphate synthase L chain, N-terminal domain; InterPro: IPR005481 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00994 F420-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK10017 colanic acid biosynthesis protein; Provisional Back     alignment and domain information
>PF08357 SEFIR: SEFIR domain; InterPro: IPR013568 This domain is found in IL17 receptors (IL17Rs, e Back     alignment and domain information
>PRK14571 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
3b6i_A198 Wrba From Escherichia Coli, Native Structure Length 6e-46
1zwk_A207 Structure Of Wrba From Pseudomonas Aeruginosa Lengt 5e-24
2zki_A199 Crystal Structure Of Hypothetical Trp Repressor Bin 2e-23
2a5l_A200 The Crystal Structure Of The Trp Repressor Binding 3e-16
1ydg_A211 Crystal Structure Of Trp Repressor Binding Protein 6e-11
1yrh_A211 Crystal Structure Of Trp Repressor Binding Protein 7e-11
2ark_A188 Structure Of A Flavodoxin From Aquifex Aeolicus Len 3e-04
>pdb|3B6I|A Chain A, Wrba From Escherichia Coli, Native Structure Length = 198 Back     alignment and structure 
Iteration: 1

 Score =  180 bits (456), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 130/199 (65%), Gaps = 5/199 (2%)
Query: 4   KIYIVYYSLYGHVETMAREVQRGANSVLGVEATLWQVPETLSSVILQKMKAPPKTNDVPV 63
           K+ ++YYS+YGH+ETMAR V  GA+ V G E  + +VPET+   + +K  A  KT   PV
Sbjct: 3   KVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEK--AGGKTQTAPV 60
Query: 64  IRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGG 123
             P +L + D  +FG P+RFG M+ Q + F D T  LWAS AL GK A +F STG  GGG
Sbjct: 61  ATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTG-TGGG 119
Query: 124 QELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFA-ADGSRQPTDLE 182
           QE T  +  T LAHHGM+ VP+GY     +F++++V+GG+ YGA T A  DGSRQP+  E
Sbjct: 120 QEQTITSTWTTLAHHGMVIVPIGYA-AQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEE 178
Query: 183 LQQAFHQGKYVAEIAKKLK 201
           L  A +QG+YVA +A KL 
Sbjct: 179 LSIARYQGEYVAGLAVKLN 197
>pdb|1ZWK|A Chain A, Structure Of Wrba From Pseudomonas Aeruginosa Length = 207 Back     alignment and structure
>pdb|2ZKI|A Chain A, Crystal Structure Of Hypothetical Trp Repressor Binding Protein From Sul Folobus Tokodaii (St0872) Length = 199 Back     alignment and structure
>pdb|2A5L|A Chain A, The Crystal Structure Of The Trp Repressor Binding Protein Wrba From Pseudomonas Aeruginosa Length = 200 Back     alignment and structure
>pdb|1YDG|A Chain A, Crystal Structure Of Trp Repressor Binding Protein Wrba Length = 211 Back     alignment and structure
>pdb|1YRH|A Chain A, Crystal Structure Of Trp Repressor Binding Protein Wrba In Complex With Fmn Length = 211 Back     alignment and structure
>pdb|2ARK|A Chain A, Structure Of A Flavodoxin From Aquifex Aeolicus Length = 188 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
3b6i_A198 Flavoprotein WRBA; flavoproteins, NADH:quinone oxi 1e-89
2a5l_A200 Trp repressor binding protein WRBA; APC5760, PA094 4e-87
1ydg_A211 Trp repressor binding protein WRBA; tetramer, stru 8e-86
2zki_A199 199AA long hypothetical Trp repressor binding prot 6e-85
3d7n_A193 Flavodoxin, WRBA-like protein; structural genomics 4e-72
2ark_A188 Flavodoxin; FMN, structural genomics, PSI, structu 2e-67
3edo_A151 Flavoprotein, putative Trp repressor binding prote 1e-24
3hly_A161 Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein 1e-10
1sqs_A242 Conserved hypothetical protein; structural genomic 2e-10
3fni_A159 Putative diflavin flavoprotein A 3; alpha-beta pro 1e-09
3klb_A162 Putative flavoprotein; structural genomi center fo 1e-08
5nul_A138 Flavodoxin; electron transport, flavoprotein, FMN; 5e-08
2ohh_A404 Type A flavoprotein FPRA; beta-lactamase like doma 3e-06
1rli_A184 Trp repressor binding protein; structural genomics 3e-06
2q9u_A414 A-type flavoprotein; flavodoxin like, beta lactama 3e-05
2fz5_A137 Flavodoxin; alpha/beta doubly-wound topology, non- 4e-05
2q62_A247 ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobi 5e-05
1e5d_A402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 5e-05
1ycg_A398 Nitric oxide reductase; DIIRON site, oxidoreductas 5e-05
2vzf_A197 NADH-dependent FMN reductase; oxidoreductase; 2.50 7e-05
3k1y_A191 Oxidoreductase; structural genomics, PSI-2, protei 1e-04
2fzv_A279 Putative arsenical resistance protein; flavin bind 1e-04
>3b6i_A Flavoprotein WRBA; flavoproteins, NADH:quinone oxidoreductase, FMN; HET: FMN 15P; 1.66A {Escherichia coli} PDB: 2r96_A* 2r97_A 2rg1_A* 3b6j_A* 3b6k_A* 3b6m_A* Length = 198 Back     alignment and structure
 Score =  260 bits (666), Expect = 1e-89
 Identities = 94/200 (47%), Positives = 127/200 (63%), Gaps = 5/200 (2%)

Query: 3   TKIYIVYYSLYGHVETMAREVQRGANSVLGVEATLWQVPETLSSVILQKMKAPPKTNDVP 62
            K+ ++YYS+YGH+ETMAR V  GA+ V G E  + +VPET+   + +K     +    P
Sbjct: 2   AKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQ--TAP 59

Query: 63  VIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGG 122
           V  P +L + D  +FG P+RFG M+ Q + F D T  LWAS AL GK A +F STG   G
Sbjct: 60  VATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTG-G 118

Query: 123 GQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFA-ADGSRQPTDL 181
           GQE T  +  T LAHHGM+ VP+GY     +F++++V+GG+ YGA T A  DGSRQP+  
Sbjct: 119 GQEQTITSTWTTLAHHGMVIVPIGYAAQ-ELFDVSQVRGGTPYGATTIAGGDGSRQPSQE 177

Query: 182 ELQQAFHQGKYVAEIAKKLK 201
           EL  A +QG+YVA +A KL 
Sbjct: 178 ELSIARYQGEYVAGLAVKLN 197
>2a5l_A Trp repressor binding protein WRBA; APC5760, PA0949, protein structure initiative, PSI, structural genomics; 1.70A {Pseudomonas aeruginosa} SCOP: c.23.5.8 PDB: 1zwk_A 1zwl_A* Length = 200 Back     alignment and structure
>1ydg_A Trp repressor binding protein WRBA; tetramer, structural genomics, PSI, protein structure initiative; 2.00A {Deinococcus radiodurans} SCOP: c.23.5.8 PDB: 1yrh_A* Length = 211 Back     alignment and structure
>2zki_A 199AA long hypothetical Trp repressor binding protein; alpha/beta structure, transcription; 2.90A {Sulfolobus tokodaii} Length = 199 Back     alignment and structure
>3d7n_A Flavodoxin, WRBA-like protein; structural genomics, PSI, MCS protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens} Length = 193 Back     alignment and structure
>2ark_A Flavodoxin; FMN, structural genomics, PSI, structure initiative, midwest center for structural genomic electron transport; 2.40A {Aquifex aeolicus} SCOP: c.23.5.8 Length = 188 Back     alignment and structure
>3edo_A Flavoprotein, putative Trp repressor binding protein; YP_193882.1, flavoprotein in complex with FMN, structural genomics; HET: MSE FMN; 1.20A {Lactobacillus acidophilus ncfm} Length = 151 Back     alignment and structure
>3hly_A Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein, DFA1, SNR135D, NESG, structural genomics, PSI-2; 2.40A {Synechococcus elongatus pcc 6301} Length = 161 Back     alignment and structure
>1sqs_A Conserved hypothetical protein; structural genomics, alpha beta protein, PSI, protein struct initiative; HET: TLA; 1.50A {Streptococcus pneumoniae} SCOP: c.23.5.5 PDB: 2oys_A* Length = 242 Back     alignment and structure
>3fni_A Putative diflavin flavoprotein A 3; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.30A {Nostoc SP} PDB: 2klb_A Length = 159 Back     alignment and structure
>3klb_A Putative flavoprotein; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: FMN; 1.75A {Bacteroides fragilis nctc 9343} Length = 162 Back     alignment and structure
>5nul_A Flavodoxin; electron transport, flavoprotein, FMN; HET: FMN; 1.60A {Clostridium beijerinckii} SCOP: c.23.5.1 PDB: 2flv_A* 2fvx_A* 1fld_A* 3nll_A* 1fvx_A* 1fla_A* 4nll_A* 5nll_A* 2fox_A* 5ull_A* 2fdx_A* 2fax_A* 6nul_A* 1fln_A* 4nul_A* Length = 138 Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Length = 404 Back     alignment and structure
>1rli_A Trp repressor binding protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.80A {Bacillus subtilis} SCOP: c.23.5.6 Length = 184 Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Length = 414 Back     alignment and structure
>2fz5_A Flavodoxin; alpha/beta doubly-wound topology, non-covalently bound FMN, electron transport; HET: FNR; NMR {Megasphaera elsdenii} SCOP: c.23.5.1 Length = 137 Back     alignment and structure
>2q62_A ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobium meliloti} Length = 247 Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Length = 402 Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Length = 398 Back     alignment and structure
>2vzf_A NADH-dependent FMN reductase; oxidoreductase; 2.50A {Edta-degrading bacterium BNC1} PDB: 2vzh_A* 2vzj_A* Length = 197 Back     alignment and structure
>3k1y_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, CDR100D; 2.50A {Corynebacterium diphtheriae} PDB: 3k20_A Length = 191 Back     alignment and structure
>2fzv_A Putative arsenical resistance protein; flavin binding protein, structural genomics, PSI, protein ST initiative; 1.70A {Shigella flexneri 2A} SCOP: c.23.5.4 Length = 279 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query202
2a5l_A200 Trp repressor binding protein WRBA; APC5760, PA094 100.0
3b6i_A198 Flavoprotein WRBA; flavoproteins, NADH:quinone oxi 100.0
2zki_A199 199AA long hypothetical Trp repressor binding prot 100.0
1ydg_A211 Trp repressor binding protein WRBA; tetramer, stru 100.0
3d7n_A193 Flavodoxin, WRBA-like protein; structural genomics 100.0
2ark_A188 Flavodoxin; FMN, structural genomics, PSI, structu 99.97
3hly_A161 Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein 99.96
3fni_A159 Putative diflavin flavoprotein A 3; alpha-beta pro 99.96
2vzf_A197 NADH-dependent FMN reductase; oxidoreductase; 2.50 99.95
5nul_A138 Flavodoxin; electron transport, flavoprotein, FMN; 99.95
3f6r_A148 Flavodoxin; FMN binding, oxidized, electron transp 99.95
1sqs_A242 Conserved hypothetical protein; structural genomic 99.94
2q62_A247 ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobi 99.93
2fzv_A279 Putative arsenical resistance protein; flavin bind 99.93
3fvw_A192 Putative NAD(P)H-dependent FMN reductase; Q8DWD8_s 99.93
1f4p_A147 Flavodoxin; electron transport, flavoprotein, FMN, 99.93
2fz5_A137 Flavodoxin; alpha/beta doubly-wound topology, non- 99.93
2q9u_A414 A-type flavoprotein; flavodoxin like, beta lactama 99.92
1rtt_A193 Conserved hypothetical protein; protein structure 99.92
3u7r_A190 NADPH-dependent FMN reductase; alpha/beta twisted 99.92
3gfs_A174 FMN-dependent NADPH-azoreductase; flavoproteins, q 99.92
4hs4_A199 Chromate reductase; triple-layered, A/B/A structur 99.92
1rli_A184 Trp repressor binding protein; structural genomics 99.91
3k1y_A191 Oxidoreductase; structural genomics, PSI-2, protei 99.91
1czn_A169 Flavodoxin; FMN binding, redox potential, electron 99.91
1obo_A169 Flavodoxin; electron transfer, flavoprotein, elect 99.9
2ohh_A404 Type A flavoprotein FPRA; beta-lactamase like doma 99.9
3svl_A193 Protein YIEF; E. coli CHRR enzyme, chromate biorem 99.89
2hpv_A208 FMN-dependent NADH-azoreductase; structural genomi 99.89
1t0i_A191 YLR011WP; FMN binding protein, flavodoxin, azoredu 99.89
1ykg_A167 SIR-FP, sulfite reductase [NADPH] flavoprotein alp 99.89
1ag9_A175 Flavodoxin; electron transport, reductive activati 99.89
2wc1_A182 Flavodoxin; electron transport, flavoprotein; HET: 99.89
1t5b_A201 Acyl carrier protein phosphodiesterase; structural 99.89
3s2y_A199 Chromate reductase; uranium reductase, oxidoreduct 99.81
1yob_A179 Flavodoxin 2, flavodoxin II; alpha-beta fold, non- 99.88
1e5d_A402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 99.88
4dik_A410 Flavoprotein; TM0755, electron transport, DI-iron 99.88
1ycg_A398 Nitric oxide reductase; DIIRON site, oxidoreductas 99.87
2fcr_A173 Flavodoxin; electron transport; HET: FMN; 1.80A {C 99.87
2hna_A147 Protein MIOC, flavodoxin; alpha-beta sandwich, fla 99.86
3f2v_A192 General stress protein 14; alpha-beta protein., st 99.86
3klb_A162 Putative flavoprotein; structural genomi center fo 99.86
3r6w_A212 FMN-dependent NADH-azoreductase 1; nitrofurazone, 99.85
3lcm_A196 SMU.1420, putative oxidoreductase; NADPH:quinone o 99.85
1d4a_A273 DT-diaphorase, quinone reductase; flavoprotein, ro 99.85
3edo_A151 Flavoprotein, putative Trp repressor binding prote 99.85
2amj_A204 Modulator of drug activity B; oxidoreductase, mena 99.85
3p0r_A211 Azoreductase; structural genomics, center for stru 99.85
2bmv_A164 Flavodoxin; electron transport, flavoprotein, FMN, 99.84
4ici_A171 Putative flavoprotein; PF12682 family protein, fla 99.84
3rpe_A218 MDAB, modulator of drug activity B; structural gen 99.82
1bvy_F191 Protein (cytochrome P450 BM-3); fatty acid monooxy 99.82
3u7i_A223 FMN-dependent NADH-azoreductase 1; structural geno 99.81
3tem_A228 Ribosyldihydronicotinamide dehydrogenase [quinone; 99.81
4gi5_A280 Quinone reductase; protein structure initiative, F 99.78
3ha2_A177 NADPH-quinone reductase; structural genomics, PSI- 99.74
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 99.72
3hr4_A219 Nitric oxide synthase, inducible; inducible nitric 99.69
2bpo_A 682 CPR, P450R, NADPH-cytochrom P450 reductase; NADPH- 99.67
2xod_A119 NRDI protein, NRDI; flavoprotein, redox protein, r 99.55
3qe2_A 618 CPR, P450R, NADPH--cytochrome P450 reductase; cypo 99.5
1tll_A 688 Nitric-oxide synthase, brain; reductase module, FM 99.44
1rlj_A139 NRDI protein; flavoprotein, FMN, thioredoxin, alph 99.17
3n3a_C153 Protein NRDI; ribonucleotide reductase, four-helix 98.96
2kyr_A111 Fructose-like phosphotransferase enzyme IIB compo; 97.52
2m1z_A106 LMO0427 protein; homolog PTS system IIB component, 97.48
1tvm_A113 PTS system, galactitol-specific IIB component; pho 97.02
1e2b_A106 Enzyme IIB-cellobiose; phosphotransferase system, 96.9
2l2q_A109 PTS system, cellobiose-specific IIB component (CE; 96.19
3nbm_A108 PTS system, lactose-specific IIBC components; PTS_ 96.18
2r48_A106 Phosphotransferase system (PTS) mannose-specific i 95.97
3czc_A110 RMPB; alpha/beta sandwich, phosphotransferase syst 95.91
2r4q_A106 Phosphotransferase system (PTS) fructose-specific 95.83
1vkr_A125 Mannitol-specific PTS system enzyme iiabc compone; 93.83
3rht_A259 (gatase1)-like protein; structural genomics, PSI-b 93.75
4gud_A211 Imidazole glycerol phosphate synthase subunit His; 93.36
3kkl_A244 Probable chaperone protein HSP33; peptidase, heat 92.96
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 92.57
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 91.89
1u9c_A224 APC35852; structural genomics, protein structure i 91.78
4e08_A190 DJ-1 beta; flavodoxin-like fold, stress response, 91.64
3m3p_A250 Glutamine amido transferase; structural genomics, 91.52
4e5v_A281 Putative THUA-like protein; THUA-like proteins, tr 91.4
3ot1_A208 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate 91.0
2rk3_A197 Protein DJ-1; parkinson'S disease, THIJ, PFPI, cha 90.97
3n7t_A247 Macrophage binding protein; seattle structural gen 90.89
4gdh_A194 DJ-1, uncharacterized protein C22E12.03C; unknown 90.88
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 90.78
3l3b_A242 ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, 90.54
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 90.27
1t0b_A252 THUA-like protein; trehalose metabolism, NCS symme 90.12
3qha_A 296 Putative oxidoreductase; seattle structural genomi 89.73
2ab0_A205 YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase 89.65
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 89.43
1iow_A 306 DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho 88.32
1ka9_H200 Imidazole glycerol phosphtate synthase; riken stru 88.32
2iuf_A688 Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen 88.11
4eg0_A 317 D-alanine--D-alanine ligase; structural genomics, 87.62
1vhq_A232 Enhancing lycopene biosynthesis protein 2; structu 87.52
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 87.3
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 87.15
1qv9_A283 F420-dependent methylenetetrahydromethanopterin de 86.84
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 86.32
3efe_A212 THIJ/PFPI family protein; structural GEN csgid, ce 85.77
3l7n_A236 Putative uncharacterized protein; glutamine amidot 84.82
1rw7_A243 YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI supe 84.73
4ezb_A 317 Uncharacterized conserved protein; structural geno 83.76
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 83.76
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 83.46
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 83.36
3l4e_A206 Uncharacterized peptidase LMO0363; hypothetical pr 83.31
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 82.35
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 81.61
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 81.35
2iuy_A 342 Avigt4, glycosyltransferase; antibiotics, family G 81.1
3uk7_A 396 Class I glutamine amidotransferase-like domain-CO 80.78
1oi4_A193 Hypothetical protein YHBO; PFPI/THIJ family, compl 80.57
1o1y_A239 Conserved hypothetical protein TM1158; flavodoxin- 80.41
2vpi_A218 GMP synthase; guanine monophosphate synthetase, ph 80.37
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 80.33
>2a5l_A Trp repressor binding protein WRBA; APC5760, PA0949, protein structure initiative, PSI, structural genomics; 1.70A {Pseudomonas aeruginosa} SCOP: c.23.5.8 PDB: 1zwk_A 1zwl_A* Back     alignment and structure
Probab=100.00  E-value=5.4e-35  Score=222.82  Aligned_cols=195  Identities=37%  Similarity=0.558  Sum_probs=145.6

Q ss_pred             CceEEEEEecCCChHHHHHHHHHHHhhccCCceEEEEEccCCCcHHHHhhcCCCCCCCCCCcCChhhhccCCeeEEeccc
Q 028917            2 ATKIYIVYYSLYGHVETMAREVQRGANSVLGVEATLWQVPETLSSVILQKMKAPPKTNDVPVIRPHQLKEADGFLFGFPS   81 (202)
Q Consensus         2 ~~kiliiy~S~~G~T~~la~~i~~~~~~~~g~~v~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~ad~ii~gsP~   81 (202)
                      |+||+|||+|++|||+++|+.+++++++ .|++++++++.+. +..|..+..|. +++..+....+++.+||+|||+||+
T Consensus         5 M~kilii~~S~~g~T~~la~~i~~~l~~-~g~~v~~~~l~~~-~~~~~~~~~~~-~~~~~~~~~~~~l~~aD~ii~gsP~   81 (200)
T 2a5l_A            5 SPYILVLYYSRHGATAEMARQIARGVEQ-GGFEARVRTVPAV-STECEAVAPDI-PAEGALYATLEDLKNCAGLALGSPT   81 (200)
T ss_dssp             CCEEEEEECCSSSHHHHHHHHHHHHHHH-TTCEEEEEBCCCE-EC--------------CCBCCHHHHHTCSEEEEEEEC
T ss_pred             cceEEEEEeCCCChHHHHHHHHHHHHhh-CCCEEEEEEhhhc-cchhhhhcccc-ccccCchhhHHHHHHCCEEEEEcCh
Confidence            3499999999999999999999999998 8999999999886 33344444454 2121222347889999999999999


Q ss_pred             cCCcchHHHHHHHHhhhhhhhhccCCCCceEEEEecCCCCCChHHHHHHHHHHHHHcCcEEecCCCcCCCCccccccccC
Q 028917           82 RFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKG  161 (202)
Q Consensus        82 y~g~~~~~~k~fld~~~~~~~~~~l~gK~~~~~~t~g~~~g~~~~~l~~~~~~l~~~g~~vv~~~~~~~~~~~~~~~~~~  161 (202)
                      ||+++|+.+|+|||++...|....++||++++|+++|+..++.+.++..+...+..+|+.+++..+.. +..  ......
T Consensus        82 y~~~~~~~lk~~ld~~~~~~~~~~l~~K~~~~~~t~g~~~~~~~~~~~~l~~~l~~~g~~~~~~~~~~-~~~--~~~~~~  158 (200)
T 2a5l_A           82 RFGNMASPLKYFLDGTSSLWLTGSLVGKPAAVFTSTASLHGGQETTQLSMLLPLLHHGMLVLGIPYSE-PAL--LETRGG  158 (200)
T ss_dssp             BTTBCCHHHHHHHHTCHHHHHHTTTTTCEEEEEEEBSCSSCCHHHHHHHHHHHHHHTTCEECCCCC--------------
T ss_pred             hccCccHHHHHHHHHHHHHhhccccCCCEEEEEEecCCCCCCHHHHHHHHHHHHHHCCCEEECCCCCC-ccc--cccccC
Confidence            99999999999999998776556789999999999998766666788999999999999999866531 111  001123


Q ss_pred             cccccceeecC-CCCCCCCHHHHHHHHHHhHHHHHHHHHhhC
Q 028917          162 GSSYGAGTFAA-DGSRQPTDLELQQAFHQGKYVAEIAKKLKR  202 (202)
Q Consensus       162 ~~~~g~~~~~~-~~~~~p~e~~~~~a~~~g~~l~~~~~~~~~  202 (202)
                      +.+++.+.+.. +++..|+++++++|+++|++|++.++++++
T Consensus       159 ~~~~~~~~~~~~~~~~~p~~~~~~~a~~~g~~l~~~~~~~~~  200 (200)
T 2a5l_A          159 GTPYGASHFAGADGKRSLDEHELTLCRALGKRLAETAGKLGS  200 (200)
T ss_dssp             -CTTSBCCBCCTTSCCCCCHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             CCCcceeeeeCCCCCCCCCHHHHHHHHHHHHHHHHHHHHhhC
Confidence            44566555543 445689999999999999999999998864
>3b6i_A Flavoprotein WRBA; flavoproteins, NADH:quinone oxidoreductase, FMN; HET: FMN 15P; 1.66A {Escherichia coli} PDB: 2r96_A* 2r97_A 2rg1_A* 3b6j_A* 3b6k_A* 3b6m_A* Back     alignment and structure
>2zki_A 199AA long hypothetical Trp repressor binding protein; alpha/beta structure, transcription; 2.90A {Sulfolobus tokodaii} Back     alignment and structure
>1ydg_A Trp repressor binding protein WRBA; tetramer, structural genomics, PSI, protein structure initiative; 2.00A {Deinococcus radiodurans} SCOP: c.23.5.8 PDB: 1yrh_A* Back     alignment and structure
>3d7n_A Flavodoxin, WRBA-like protein; structural genomics, PSI, MCS protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens} Back     alignment and structure
>2ark_A Flavodoxin; FMN, structural genomics, PSI, structure initiative, midwest center for structural genomic electron transport; 2.40A {Aquifex aeolicus} SCOP: c.23.5.8 Back     alignment and structure
>3hly_A Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein, DFA1, SNR135D, NESG, structural genomics, PSI-2; 2.40A {Synechococcus elongatus pcc 6301} Back     alignment and structure
>3fni_A Putative diflavin flavoprotein A 3; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.30A {Nostoc SP} PDB: 2klb_A Back     alignment and structure
>2vzf_A NADH-dependent FMN reductase; oxidoreductase; 2.50A {Edta-degrading bacterium BNC1} PDB: 2vzh_A* 2vzj_A* Back     alignment and structure
>5nul_A Flavodoxin; electron transport, flavoprotein, FMN; HET: FMN; 1.60A {Clostridium beijerinckii} SCOP: c.23.5.1 PDB: 2flv_A* 2fvx_A* 1fld_A* 3nll_A* 1fvx_A* 1fla_A* 4nll_A* 5nll_A* 2fox_A* 5ull_A* 2fdx_A* 2fax_A* 6nul_A* 1fln_A* 4nul_A* Back     alignment and structure
>3f6r_A Flavodoxin; FMN binding, oxidized, electron transport, flavoprotein, FMN, transport; HET: FMN; 2.00A {Desulfovibrio desulfuricans} SCOP: c.23.5.0 PDB: 3f6s_A* 3f90_A* 3kap_A* 3kaq_A* Back     alignment and structure
>1sqs_A Conserved hypothetical protein; structural genomics, alpha beta protein, PSI, protein struct initiative; HET: TLA; 1.50A {Streptococcus pneumoniae} SCOP: c.23.5.5 PDB: 2oys_A* Back     alignment and structure
>2q62_A ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobium meliloti} Back     alignment and structure
>2fzv_A Putative arsenical resistance protein; flavin binding protein, structural genomics, PSI, protein ST initiative; 1.70A {Shigella flexneri 2A} SCOP: c.23.5.4 Back     alignment and structure
>3fvw_A Putative NAD(P)H-dependent FMN reductase; Q8DWD8_strmu, SMR99, NESG, structural genomics, PSI-2, protein structure initiative; 2.30A {Streptococcus mutans} Back     alignment and structure
>1f4p_A Flavodoxin; electron transport, flavoprotein, FMN, 3D-STRCTURE, anisotropic refinement, redox protein; HET: FMN; 1.30A {Desulfovibrio vulgaris} SCOP: c.23.5.1 PDB: 1bu5_A* 1c7f_A* 1c7e_A* 1akr_A* 1fx1_A* 1akt_A* 1akq_A* 1aku_A* 1akv_A* 1azl_A* 1j8q_A* 2fx2_A* 3fx2_A* 4fx2_A* 5fx2_A* 1akw_A* 1i1o_A* 1wsw_A* 1wsb_A* 1xyv_A* ... Back     alignment and structure
>2fz5_A Flavodoxin; alpha/beta doubly-wound topology, non-covalently bound FMN, electron transport; HET: FNR; NMR {Megasphaera elsdenii} SCOP: c.23.5.1 Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Back     alignment and structure
>1rtt_A Conserved hypothetical protein; protein structure initiative, SAD with sulfur, putative REDU PSI; 1.28A {Pseudomonas aeruginosa} SCOP: c.23.5.4 PDB: 1x77_A* Back     alignment and structure
>3u7r_A NADPH-dependent FMN reductase; alpha/beta twisted open-sheet, lavoprotein, quinone reductas oxidoreductase; HET: MSE FNR 2PE; 1.40A {Paracoccus denitrificans} Back     alignment and structure
>3gfs_A FMN-dependent NADPH-azoreductase; flavoproteins, quinone reductase, flavodoxin, oligomerization, flavoprotein, oxidoreductase; HET: FMN; 2.10A {Bacillus subtilis} SCOP: c.23.5.4 PDB: 1nni_1* 2gsw_A* 3gfr_A* 3gfq_A* Back     alignment and structure
>4hs4_A Chromate reductase; triple-layered, A/B/A structure, NAD(P)H-dependent FMN reduc oxidoreductase; HET: FMN; 2.10A {Gluconacetobacter hansenii} PDB: 3s2y_A* 4h6p_A* Back     alignment and structure
>1rli_A Trp repressor binding protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.80A {Bacillus subtilis} SCOP: c.23.5.6 Back     alignment and structure
>3k1y_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, CDR100D; 2.50A {Corynebacterium diphtheriae} PDB: 3k20_A Back     alignment and structure
>1czn_A Flavodoxin; FMN binding, redox potential, electron transport; HET: FMN; 1.70A {Synechococcus elongatus} SCOP: c.23.5.1 PDB: 1czl_A* 1czu_A* 1d04_A* 1ofv_A* 1czr_A* 1czk_A* 1czo_A* 1czh_A* 1d03_A* Back     alignment and structure
>1obo_A Flavodoxin; electron transfer, flavoprotein, electron transport; HET: FMN; 1.2A {Anabaena SP} SCOP: c.23.5.1 PDB: 2v5v_A* 1dx9_A 1rcf_A* 1flv_A* 1obv_A* 2v5u_A* 1ftg_A 1qhe_A 2kqu_A 3esy_A* 3esz_A* 3esx_A* Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Back     alignment and structure
>3svl_A Protein YIEF; E. coli CHRR enzyme, chromate bioremediation, tetramer role, mutant enzymes, oxidoreductase; HET: FMN; 2.20A {Escherichia coli} Back     alignment and structure
>2hpv_A FMN-dependent NADH-azoreductase; structural genomics, PS protein structure initiative, southeast collaboratory for S genomics, secsg; HET: FMN; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1t0i_A YLR011WP; FMN binding protein, flavodoxin, azoreductase, oxidoreductase; HET: FMN; 2.00A {Saccharomyces cerevisiae} SCOP: c.23.5.4 Back     alignment and structure
>1ykg_A SIR-FP, sulfite reductase [NADPH] flavoprotein alpha- component; electron transport; HET: FMN; NMR {Escherichia coli} SCOP: c.23.5.2 Back     alignment and structure
>1ag9_A Flavodoxin; electron transport, reductive activation; HET: FMN BTB; 1.80A {Escherichia coli} SCOP: c.23.5.1 PDB: 1ahn_A* Back     alignment and structure
>2wc1_A Flavodoxin; electron transport, flavoprotein; HET: FMN; 2.17A {Rhodobacter capsulatus} Back     alignment and structure
>1t5b_A Acyl carrier protein phosphodiesterase; structural genomics, FMN, alpha/beta/alpha sandwich, PSI, protein structure initiative; HET: FMN; 1.40A {Salmonella typhimurium} SCOP: c.23.5.3 PDB: 1tik_A 2z98_A* 2d5i_A* 1v4b_A* 2z9b_A* 2z9c_A* 2z9d_A* Back     alignment and structure
>3s2y_A Chromate reductase; uranium reductase, oxidoreductase; HET: FMN PG4; 2.24A {Gluconacetobacter hansenii} Back     alignment and structure
>1yob_A Flavodoxin 2, flavodoxin II; alpha-beta fold, non- covalently bound FMN, electron transport; HET: FMN; 2.25A {Azotobacter vinelandii} SCOP: c.23.5.1 Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>4dik_A Flavoprotein; TM0755, electron transport, DI-iron protein; 1.75A {Thermotoga maritima} PDB: 4dil_A 1vme_A* Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Back     alignment and structure
>2fcr_A Flavodoxin; electron transport; HET: FMN; 1.80A {Chondrus crispus} SCOP: c.23.5.1 Back     alignment and structure
>2hna_A Protein MIOC, flavodoxin; alpha-beta sandwich, flavodoxin fold, electron transport; NMR {Escherichia coli} PDB: 2hnb_A Back     alignment and structure
>3f2v_A General stress protein 14; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: FMN; 2.00A {Treponema denticola} Back     alignment and structure
>3klb_A Putative flavoprotein; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: FMN; 1.75A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3r6w_A FMN-dependent NADH-azoreductase 1; nitrofurazone, P. aeruginosa, nitroreductase, flavodoxin, oxidoreductase; HET: FMN NFZ; 2.08A {Pseudomonas aeruginosa} PDB: 3lt5_A* 2v9c_A* 3keg_A* Back     alignment and structure
>3lcm_A SMU.1420, putative oxidoreductase; NADPH:quinone oxidoreductase, MDAB; HET: FAD NAP; 1.80A {Streptococcus mutans} PDB: 4f8y_A* Back     alignment and structure
>1d4a_A DT-diaphorase, quinone reductase; flavoprotein, rossman fold, oxidoreductase; HET: FAD; 1.70A {Homo sapiens} SCOP: c.23.5.3 PDB: 1dxo_A* 1gg5_A* 1kbo_A* 1kbq_A* 2f1o_A* 3jsx_A* 1h69_A* 1h66_A* 1qbg_A* 1dxq_A* 1qrd_A* Back     alignment and structure
>3edo_A Flavoprotein, putative Trp repressor binding protein; YP_193882.1, flavoprotein in complex with FMN, structural genomics; HET: MSE FMN; 1.20A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>2amj_A Modulator of drug activity B; oxidoreductase, menadione, DT-diaphorase, montreal-kingston structural genomics initiative, BSGI; 1.80A {Escherichia coli} PDB: 2b3d_A* Back     alignment and structure
>3p0r_A Azoreductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 1.80A {Bacillus anthracis} Back     alignment and structure
>2bmv_A Flavodoxin; electron transport, flavoprotein, FMN, transport protein; 2.11A {Helicobacter pylori} PDB: 2w5u_A* 1fue_A* Back     alignment and structure
>4ici_A Putative flavoprotein; PF12682 family protein, flavodoxin_4, structural genomics, J center for structural genomics, JCSG; HET: MSE FMN EPE; 1.40A {Bacteroides eggerthii} Back     alignment and structure
>3rpe_A MDAB, modulator of drug activity B; structural genomics, center for structural genomics of infec diseases, csgid, flavodoxin-like fold; HET: FAD; 1.10A {Yersinia pestis} Back     alignment and structure
>1bvy_F Protein (cytochrome P450 BM-3); fatty acid monooxygenase, hemoprotein, flavoprotein, electron transfer, oxidoreductase; HET: HEM FMN; 2.03A {Bacillus megaterium} SCOP: c.23.5.1 Back     alignment and structure
>3u7i_A FMN-dependent NADH-azoreductase 1; structural genomics, the center for structural genomics of I diseases, csgid, oxidoreductase; HET: MSE; 1.75A {Bacillus anthracis} Back     alignment and structure
>3tem_A Ribosyldihydronicotinamide dehydrogenase [quinone; oxidoreductase-oxidoreductase inhibitor complex; HET: FAD 6A1 IMD; 1.45A {Homo sapiens} SCOP: c.23.5.3 PDB: 3te7_A* 3tzb_A* 3fw1_A* 2qwx_A* 1zx1_A* 3g5m_A* 3gam_A* 3ovm_A* 3owh_A* 3owx_A* 3ox1_A* 3ox2_A* 3ox3_A* 1sg0_A* 1qr2_A* 1xi2_A* 2qmy_A* 2qmz_A* 2qr2_A* 2qx4_A* ... Back     alignment and structure
>4gi5_A Quinone reductase; protein structure initiative, FAD bound, structural genomics, PSI-biology; HET: FAD; 1.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ha2_A NADPH-quinone reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics, consortium, NESG; HET: MSE; 1.80A {Pediococcus pentosaceus atcc 25745} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3hr4_A Nitric oxide synthase, inducible; inducible nitric oxide synthase, NOS, INOS, CALM binding, FAD, FMN, heme, iron, metal-binding, NADP, oxidore phosphoprotein; HET: FMN; 2.50A {Homo sapiens} Back     alignment and structure
>2bpo_A CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytochrome P450 reductase, diflavin reductase, FAD, FMN-binding, electron transfer; HET: FAD FMN NAP; 2.9A {Saccharomyces cerevisiae} PDB: 2bn4_A* 2bf4_A* Back     alignment and structure
>2xod_A NRDI protein, NRDI; flavoprotein, redox protein, ribonucleotide reductase; HET: FMN; 0.96A {Bacillus anthracis} PDB: 2xoe_A* 2x2o_A* 2x2p_A* Back     alignment and structure
>3qe2_A CPR, P450R, NADPH--cytochrome P450 reductase; cypor, antley-bixler syndrome, flavoprotein, FMN, FAD, oxidoreductase; HET: FAD FMN NAP; 1.75A {Homo sapiens} PDB: 3qfc_A* 3qfr_A* 1amo_A* 1j9z_A* 1ja0_A* 1ja1_A* 3es9_A* 3ojw_A* 3ojx_A* 3fjo_A* 1b1c_A* Back     alignment and structure
>1tll_A Nitric-oxide synthase, brain; reductase module, FMN, FAD, NADP+, oxidoreductase; HET: FMN FAD NAP; 2.30A {Rattus norvegicus} SCOP: b.43.4.1 c.23.5.2 c.25.1.4 Back     alignment and structure
>1rlj_A NRDI protein; flavoprotein, FMN, thioredoxin, alpha/beta/alpha sandwich, structural genomics, PSI, protein structure initiative; HET: FMN; 2.00A {Bacillus subtilis} SCOP: c.23.5.7 Back     alignment and structure
>3n3a_C Protein NRDI; ribonucleotide reductase, four-helix bundle, dimanganese CLU flavoprotein, oxidoreductase; HET: FMN; 1.99A {Escherichia coli} PDB: 3n39_C* 3n3b_C* Back     alignment and structure
>2kyr_A Fructose-like phosphotransferase enzyme IIB compo; ALP protein, structural genomics, PSI-2; NMR {Escherichia coli} Back     alignment and structure
>2m1z_A LMO0427 protein; homolog PTS system IIB component, transferase; NMR {Listeria monocytogenes egd-e} Back     alignment and structure
>1tvm_A PTS system, galactitol-specific IIB component; phosphotransferase system (PTS), P-loop; NMR {Escherichia coli} Back     alignment and structure
>1e2b_A Enzyme IIB-cellobiose; phosphotransferase system, transferas transport, phosphorylation; NMR {Escherichia coli} SCOP: c.44.2.1 PDB: 1iib_A 1h9c_A* 2wwv_D 2wy2_D Back     alignment and structure
>2l2q_A PTS system, cellobiose-specific IIB component (CE; cellobiose-specific phosphotransferase IIB component, struct genomics; NMR {Borrelia burgdorferi} Back     alignment and structure
>3nbm_A PTS system, lactose-specific IIBC components; PTS_IIB_LACTOSE, phosphoenolpyruvate:carbohydrate system, P- phosphorylation; HET: MSE; 1.30A {Streptococcus pneumoniae} Back     alignment and structure
>2r48_A Phosphotransferase system (PTS) mannose-specific iibca component; PTS system, fructose specific IIB PFAM02379, PSI-2, MCSG; 1.80A {Bacillus subtilis subsp} SCOP: c.44.2.2 Back     alignment and structure
>3czc_A RMPB; alpha/beta sandwich, phosphotransferase system, transferase, transport; 2.02A {Streptococcus mutans} Back     alignment and structure
>2r4q_A Phosphotransferase system (PTS) fructose-specific iiabc component; fructose specific IIB subunit, PF structural genomics, PSI-2; HET: MSE; 1.60A {Bacillus subtilis subsp} SCOP: c.44.2.2 Back     alignment and structure
>1vkr_A Mannitol-specific PTS system enzyme iiabc compone; phosphotransferase, transferase, kinase, sugar transport; NMR {Escherichia coli} SCOP: c.44.2.1 PDB: 1vrv_A* 2few_B* Back     alignment and structure
>3rht_A (gatase1)-like protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.83A {Planctomyces limnophilus} Back     alignment and structure
>4gud_A Imidazole glycerol phosphate synthase subunit His; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE 1PE; 1.91A {Vibrio cholerae} Back     alignment and structure
>3kkl_A Probable chaperone protein HSP33; peptidase, heat shock protein, hydrolase, protease, stress response; 2.03A {Saccharomyces cerevisiae} PDB: 3mii_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1u9c_A APC35852; structural genomics, protein structure initiative, MCSG, PAR disease, chaperone, cysteine protease, PSI; 1.35A {Geobacillus stearothermophilus} SCOP: c.23.16.2 Back     alignment and structure
>4e08_A DJ-1 beta; flavodoxin-like fold, stress response, motor protein; 2.00A {Drosophila melanogaster} Back     alignment and structure
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Back     alignment and structure
>4e5v_A Putative THUA-like protein; THUA-like proteins, trehalose utilisation, structural genomi center for structural genomics, JCSG; 1.75A {Parabacteroides merdae} Back     alignment and structure
>3ot1_A 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme; csgid, structural genomics; HET: MSE CSX; 1.16A {Vibrio cholerae o1 biovar el tor} SCOP: c.23.16.0 Back     alignment and structure
>2rk3_A Protein DJ-1; parkinson'S disease, THIJ, PFPI, chaperone, cytoplasm, disease mutation, nucleus, oncogene, oxidation, parkinson disease; 1.05A {Homo sapiens} PDB: 1pdv_A 1pdw_A 3cy6_A 1pe0_A 3cza_A 3cyf_A 2rk4_A 3cz9_A* 3ezg_A 3f71_A 3sf8_A 1p5f_A 1ps4_A 1q2u_A 1soa_A 1ucf_A 2or3_A 3bwe_A 3b38_A 3b36_A ... Back     alignment and structure
>3n7t_A Macrophage binding protein; seattle structural genomics center for infectious disease, S macrophage, pathogenic fungus, coccidioidomycosis; 2.10A {Coccidioides immitis} SCOP: c.23.16.0 Back     alignment and structure
>4gdh_A DJ-1, uncharacterized protein C22E12.03C; unknown function, cysteine oxidation; 1.05A {Schizosaccharomyces pombe} PDB: 4ge3_A 4ge0_A Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3l3b_A ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography, isopr biosynthesis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1t0b_A THUA-like protein; trehalose metabolism, NCS symmetry, structural genomics, PSI, protein structure initiative; 1.70A {Geobacillus stearothermophilus} SCOP: c.23.16.6 Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>2ab0_A YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase fold, unknown function; 1.10A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A* Back     alignment and structure
>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 Back     alignment and structure
>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* Back     alignment and structure
>4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A 4egj_A Back     alignment and structure
>1vhq_A Enhancing lycopene biosynthesis protein 2; structural genomics, unknown function; 1.65A {Escherichia coli} SCOP: c.23.16.2 PDB: 1oy1_A Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1qv9_A F420-dependent methylenetetrahydromethanopterin dehydrogenase; monomer: alpha/beta domain, helix bundle, trimer of dimers, oxidoreductase; HET: MSE; 1.54A {Methanopyrus kandleri} SCOP: c.127.1.1 PDB: 1u6i_A 1u6j_A 1u6k_A* 3iqe_A* 3iqf_A* 3iqz_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3efe_A THIJ/PFPI family protein; structural GEN csgid, center for structural genomics of infectious disease chaperone; 2.30A {Bacillus anthracis} Back     alignment and structure
>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} Back     alignment and structure
>1rw7_A YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI superfamily, unknown function; 1.80A {Saccharomyces cerevisiae} SCOP: c.23.16.2 PDB: 1qvv_A* 1qvz_A 1qvw_A Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3l4e_A Uncharacterized peptidase LMO0363; hypothetical protein LMO0363, csgid, similar to peptidase E, hydrolase, protease, serine protease; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>1oi4_A Hypothetical protein YHBO; PFPI/THIJ family, complete proteome, PFPI, THIJ, bacterial targets at IGS-CNRS, france, BIGS, structural genomics; 2.03A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Back     alignment and structure
>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 202
d1ydga_201 c.23.5.8 (A:) Trp repressor binding protein WrbA { 7e-51
d2a5la1196 c.23.5.8 (A:3-198) Trp repressor binding protein W 3e-48
d2arka1184 c.23.5.8 (A:1-184) Flavodoxin FldA {Aquifex aeolic 7e-36
d1e5da1152 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreduct 5e-19
d1sqsa_232 c.23.5.5 (A:) Hypothetical protein SP1951 {(Strept 2e-15
d1ycga1149 c.23.5.1 (A:251-399) Nitric oxide reductase C-term 1e-14
d1rlia_179 c.23.5.6 (A:) Hypothetical protein YwqN {Bacillus 2e-13
d1vmea1148 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, 4e-12
d1nni1_171 c.23.5.4 (1:) Azobenzene reductase {Bacillus subti 2e-07
d5nula_138 c.23.5.1 (A:) Flavodoxin {Clostridium beijerinckii 4e-07
d1t0ia_185 c.23.5.4 (A:) Hypothetical protein Ylr011wp {Baker 3e-05
d2fz5a1137 c.23.5.1 (A:1-137) Flavodoxin {Megasphaera elsdeni 3e-04
d1f4pa_147 c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [ 0.001
>d1ydga_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]} Length = 201 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Flavoproteins
family: WrbA-like
domain: Trp repressor binding protein WrbA
species: Deinococcus radiodurans [TaxId: 1299]

 Score =  161 bits (407), Expect = 7e-51
 Identities = 61/203 (30%), Positives = 82/203 (40%), Gaps = 12/203 (5%)

Query: 4   KIYIVYYSLYGHVETMAREVQRGANSVLGVEATLWQVPETLSSVILQKMKAP----PKTN 59
           K+ IV+YS  G    MA+E      +  G E  L +V ET    ++    A         
Sbjct: 4   KLAIVFYSSTGTGYAMAQEAAEAGRAA-GAEVRLLKVRETAPQDVIDGQDAWKANIEAMK 62

Query: 60  DVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGF 119
           DVP   P  L+ A+  +F  P+RFG   +Q +AF D    LW+S  LA K      S   
Sbjct: 63  DVPEATPADLEWAEAIVFSSPTRFGGATSQMRAFIDTLGGLWSSGKLANKTFSAMTSAQN 122

Query: 120 HGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFAADGSRQPT 179
             GGQE T  T      H G +  P GYT            GG+ YGA   A    +   
Sbjct: 123 VNGGQETTLQTLYMTAMHWGAVLTPPGYTDEVIF-----KSGGNPYGASVTA--NGQPLL 175

Query: 180 DLELQQAFHQGKYVAEIAKKLKR 202
           + +     HQ +   E+  KL  
Sbjct: 176 ENDRASIRHQVRRQVELTAKLLE 198
>d2a5la1 c.23.5.8 (A:3-198) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]} Length = 196 Back     information, alignment and structure
>d2arka1 c.23.5.8 (A:1-184) Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]} Length = 184 Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Length = 152 Back     information, alignment and structure
>d1sqsa_ c.23.5.5 (A:) Hypothetical protein SP1951 {(Streptococcus pneumoniae) [TaxId: 1313]} Length = 232 Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Length = 149 Back     information, alignment and structure
>d1rlia_ c.23.5.6 (A:) Hypothetical protein YwqN {Bacillus subtilis [TaxId: 1423]} Length = 179 Back     information, alignment and structure
>d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 148 Back     information, alignment and structure
>d1nni1_ c.23.5.4 (1:) Azobenzene reductase {Bacillus subtilis [TaxId: 1423]} Length = 171 Back     information, alignment and structure
>d5nula_ c.23.5.1 (A:) Flavodoxin {Clostridium beijerinckii [TaxId: 1520]} Length = 138 Back     information, alignment and structure
>d1t0ia_ c.23.5.4 (A:) Hypothetical protein Ylr011wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 185 Back     information, alignment and structure
>d2fz5a1 c.23.5.1 (A:1-137) Flavodoxin {Megasphaera elsdenii [TaxId: 907]} Length = 137 Back     information, alignment and structure
>d1f4pa_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} Length = 147 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query202
d1ydga_201 Trp repressor binding protein WrbA {Deinococcus ra 100.0
d2a5la1196 Trp repressor binding protein WrbA {Pseudomonas ae 100.0
d2arka1184 Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]} 100.0
d1ycga1149 Nitric oxide reductase C-terminal domain {Moorella 99.97
d1e5da1152 Rubredoxin oxygen:oxidoreductase (ROO), C-terminal 99.97
d1vmea1148 ROO-like flavoprotein TM0755, C-terminal domain {T 99.92
d2fz5a1137 Flavodoxin {Megasphaera elsdenii [TaxId: 907]} 99.92
d5nula_138 Flavodoxin {Clostridium beijerinckii [TaxId: 1520] 99.91
d1sqsa_232 Hypothetical protein SP1951 {(Streptococcus pneumo 99.91
d2fzva1233 Putative arsenical resistance protein {Shigella fl 99.91
d1rlia_179 Hypothetical protein YwqN {Bacillus subtilis [TaxI 99.91
d1nni1_171 Azobenzene reductase {Bacillus subtilis [TaxId: 14 99.9
d1rtta_174 Hypothetical protein PA1204 {Pseudomonas aeruginos 99.9
d1t0ia_185 Hypothetical protein Ylr011wp {Baker's yeast (Sacc 99.89
d1f4pa_147 Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} 99.84
d1d4aa_273 NAD(P)H:quinone reductase {Human (Homo sapiens) [T 99.83
d1oboa_169 Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 11 99.82
d1czna_169 Flavodoxin {Synechococcus elongatus PCC 7942 [TaxI 99.82
d2qwxa1230 Quinone reductase type 2 (menadione reductase) {Hu 99.79
d1yoba1179 Flavodoxin {Azotobacter vinelandii [TaxId: 354]} 99.76
d2z98a1200 ACP phosphodiesterase AcpD {Escherichia coli [TaxI 99.75
d2fcra_173 Flavodoxin {Chondrus crispus [TaxId: 2769]} 99.72
d1ag9a_175 Flavodoxin {Escherichia coli [TaxId: 562]} 99.71
d1fuea_163 Flavodoxin {Helicobacter pylori [TaxId: 210]} 99.66
d1ykga1146 Sulfite reductase alpha-component CysJ N-terminal 99.66
d1ja1a2177 NADPH-cytochrome p450 reductase, N-terminal domain 99.49
d1bvyf_152 FMN-binding domain of the cytochrome P450bm-3 {Bac 99.48
d1tlla2202 Nitric oxide (NO) synthase FMN domain {Rat (Rattus 99.41
d1rlja_135 Flavoprotein NrdI {Bacillus subtilis [TaxId: 1423] 98.98
d2a9va1196 GMP synthase subunit A, GuaAA {Archaeon Thermoplas 96.36
d2r4qa1103 Fructose-specific enzyme IIABC component FruA, mid 95.99
d2r48a1103 Mannose-specific enzyme IIBCA component ManP, N-te 95.76
d1u9ca_221 GK2698 ortholog {Bacillus stearothermophilus [TaxI 95.37
d1iloa_77 MTH985, a thioredoxin {Archaeon Methanobacterium t 93.12
d1ka9h_195 GAT subunit, HisH, (or domain) of imidazoleglycero 93.06
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 92.92
d1k9vf_200 GAT subunit, HisH, (or domain) of imidazoleglycero 91.42
d1iiba_103 Enzyme IIB-cellobiose {Escherichia coli [TaxId: 56 91.38
d3eeqa2207 Cobalamin biosynthesis protein G, CbiG {Sulfolobus 91.35
d1iowa196 D-Ala-D-Ala ligase, N-domain {Escherichia coli, ge 90.12
d1vhqa_217 Putative sigma cross-reacting protein 27A (SCRP-27 89.96
d2nv0a1195 Hypothetical protein YaaE {Bacillus subtilis [TaxI 89.41
d1vkra_97 PTS system mannitol-specific EIICBA component {Esc 89.25
d1p5fa_186 DJ-1 {Human (Homo sapiens) [TaxId: 9606]} 88.55
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 86.54
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 85.8
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 85.47
d1qvwa_236 Hypothetical protein Ydr533Cp {Baker's yeast (Sacc 84.98
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 84.92
d1q7ra_202 Hypothetical protein YaaE {Bacillus stearothermoph 84.59
d1jvna2232 GAT subunit, HisH, (or domain) of imidazoleglycero 84.19
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 83.44
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 83.24
d1o1ya_230 Hypothetical protein TM1158 {Thermotoga maritima [ 82.21
d1t0ba_240 GK2113 homologue {Bacillus stearothermophilus [Tax 81.07
d1nbwb_113 Glycerol dehydratase reactivase, beta subunit {Kle 81.01
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 80.46
>d1ydga_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Flavoproteins
family: WrbA-like
domain: Trp repressor binding protein WrbA
species: Deinococcus radiodurans [TaxId: 1299]

Probab=100.00  E-value=6.8e-39  Score=243.35  Aligned_cols=189  Identities=31%  Similarity=0.403  Sum_probs=160.3

Q ss_pred             ceEEEEEecCCChHHHHHHHHHHHhhccCCceEEEEEccCCCcHHHHhhcCC------CCCCCCCCcCChhhhccCCeeE
Q 028917            3 TKIYIVYYSLYGHVETMAREVQRGANSVLGVEATLWQVPETLSSVILQKMKA------PPKTNDVPVIRPHQLKEADGFL   76 (202)
Q Consensus         3 ~kiliiy~S~~G~T~~la~~i~~~~~~~~g~~v~~~~l~~~~~~~~~~~~~~------~~~~~~~~~~~~~~l~~ad~ii   76 (202)
                      |||+|||+|.+|||++||++|++++++ .|+|++++++.+..+..|+.+..|      ..+ |++. ...++|.+||+||
T Consensus         3 mkilivy~S~~GnT~~la~~ia~g~~~-~G~ev~~~~~~~~~~~~~~~~~~~~~~~~~~~~-d~~~-~~~~~i~~aD~ii   79 (201)
T d1ydga_           3 VKLAIVFYSSTGTGYAMAQEAAEAGRA-AGAEVRLLKVRETAPQDVIDGQDAWKANIEAMK-DVPE-ATPADLEWAEAIV   79 (201)
T ss_dssp             CEEEEEECCSSSHHHHHHHHHHHHHHH-TTCEEEEEECCCCSCHHHHTTCHHHHHHHHHTT-TSCB-CCHHHHHHCSEEE
T ss_pred             cEEEEEEeCCCcHHHHHHHHHHHHHHh-cCCEEEEEEccccCccchhhhhhHhhcCCCccc-Cchh-hhhhhHhhCCEeE
Confidence            499999999999999999999999999 999999999999877777655433      233 4444 4689999999999


Q ss_pred             EeccccCCcchHHHHHHHHhhhhhhhhccCCCCceEEEEecCCCCCChHHHHHHHHHHHHHcCcEEecCCCcCCCCcccc
Q 028917           77 FGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEM  156 (202)
Q Consensus        77 ~gsP~y~g~~~~~~k~fld~~~~~~~~~~l~gK~~~~~~t~g~~~g~~~~~l~~~~~~l~~~g~~vv~~~~~~~~~~~~~  156 (202)
                      ||||+||++++++||.||||+..+|....|.||++++|+++|+.+++++.++..+...+.++|+.+++.++...     .
T Consensus        80 ~gsPvy~~~~s~~~k~flDr~~~~~~~~~l~gK~~~~~~s~g~~~gg~e~~~~~~~~~~~~~g~~~v~~~~~~~-----~  154 (201)
T d1ydga_          80 FSSPTRFGGATSQMRAFIDTLGGLWSSGKLANKTFSAMTSAQNVNGGQETTLQTLYMTAMHWGAVLTPPGYTDE-----V  154 (201)
T ss_dssp             EEEEEETTEECHHHHHHHHTTHHHHHTTTTTTCEEEEEEEESSTTSSTTHHHHHHHHHHHTTTCEECCCTTCSH-----H
T ss_pred             EecceeeeeccchhHHHHHHhhhHHhccccCCceeeeeeccccCCCchHHHHHhHHHHHHHcCCccccccccch-----h
Confidence            99999999999999999999988887778999999999999998888888999999999999999998766421     0


Q ss_pred             ccccCcccccceeecCCCCCCCCHHHHHHHHHHhHHHHHHHHHhh
Q 028917          157 NEVKGGSSYGAGTFAADGSRQPTDLELQQAFHQGKYVAEIAKKLK  201 (202)
Q Consensus       157 ~~~~~~~~~g~~~~~~~~~~~p~e~~~~~a~~~g~~l~~~~~~~~  201 (202)
                      ....++.+||.+.+..+  ..|+|++++.|++||++|++.+++|.
T Consensus       155 ~~~~gg~~~G~~~~~~~--~~~~e~~l~~ar~lGk~la~~a~kL~  197 (201)
T d1ydga_         155 IFKSGGNPYGASVTANG--QPLLENDRASIRHQVRRQVELTAKLL  197 (201)
T ss_dssp             HHHTTCCSSSCEEECCS--SCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hhcCCCcccCcceecCC--CCCCHHHHHHHHHHHHHHHHHHHHHH
Confidence            11346677887666542  45899999999999999999999875
>d2a5la1 c.23.5.8 (A:3-198) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2arka1 c.23.5.8 (A:1-184) Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fz5a1 c.23.5.1 (A:1-137) Flavodoxin {Megasphaera elsdenii [TaxId: 907]} Back     information, alignment and structure
>d5nula_ c.23.5.1 (A:) Flavodoxin {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1sqsa_ c.23.5.5 (A:) Hypothetical protein SP1951 {(Streptococcus pneumoniae) [TaxId: 1313]} Back     information, alignment and structure
>d2fzva1 c.23.5.4 (A:1-233) Putative arsenical resistance protein {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1rlia_ c.23.5.6 (A:) Hypothetical protein YwqN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nni1_ c.23.5.4 (1:) Azobenzene reductase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rtta_ c.23.5.4 (A:) Hypothetical protein PA1204 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t0ia_ c.23.5.4 (A:) Hypothetical protein Ylr011wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f4pa_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1d4aa_ c.23.5.3 (A:) NAD(P)H:quinone reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oboa_ c.23.5.1 (A:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]} Back     information, alignment and structure
>d1czna_ c.23.5.1 (A:) Flavodoxin {Synechococcus elongatus PCC 7942 [TaxId: 1140]} Back     information, alignment and structure
>d2qwxa1 c.23.5.3 (A:1-230) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yoba1 c.23.5.1 (A:1-179) Flavodoxin {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2z98a1 c.23.5.3 (A:1-200) ACP phosphodiesterase AcpD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fcra_ c.23.5.1 (A:) Flavodoxin {Chondrus crispus [TaxId: 2769]} Back     information, alignment and structure
>d1ag9a_ c.23.5.1 (A:) Flavodoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fuea_ c.23.5.1 (A:) Flavodoxin {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ykga1 c.23.5.2 (A:63-208) Sulfite reductase alpha-component CysJ N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ja1a2 c.23.5.2 (A:63-239) NADPH-cytochrome p450 reductase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bvyf_ c.23.5.1 (F:) FMN-binding domain of the cytochrome P450bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1tlla2 c.23.5.2 (A:750-951) Nitric oxide (NO) synthase FMN domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rlja_ c.23.5.7 (A:) Flavoprotein NrdI {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2r4qa1 c.44.2.2 (A:171-273) Fructose-specific enzyme IIABC component FruA, middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2r48a1 c.44.2.2 (A:2-104) Mannose-specific enzyme IIBCA component ManP, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iiba_ c.44.2.1 (A:) Enzyme IIB-cellobiose {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3eeqa2 c.152.1.1 (A:8-214) Cobalamin biosynthesis protein G, CbiG {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1iowa1 c.30.1.2 (A:1-96) D-Ala-D-Ala ligase, N-domain {Escherichia coli, gene ddlB [TaxId: 562]} Back     information, alignment and structure
>d1vhqa_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vkra_ c.44.2.1 (A:) PTS system mannitol-specific EIICBA component {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qvwa_ c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t0ba_ c.23.16.6 (A:) GK2113 homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nbwb_ c.51.3.2 (B:) Glycerol dehydratase reactivase, beta subunit {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure