Citrus Sinensis ID: 028922

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
MVTVSSQCTKKEANRGAWTAEEDQKLAQAIEVHGPKKWKSVAAKAGLNRCGKSCRLRWMNYLRPHIKRGNISDQEEDLILRLHKLLGNRWSLIAGRLPGRTDNEIKNYWNSHLSKKIKQNEKPSRGSTAKDLELEISKGEEKGSTVQKRSGDLEGTFYADGGSKLFSFVGDNKFFDCYNDEPLNLEWMSRFFEIDESWFDFA
cccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHccccccccccccccHHHHHHHHHHHHHHccHHHHHHccccccccHHHHHHHHHHHHHHHHccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccHHcccccccccHHHHHHHHHHHHHcccccHHHHHHHHcccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHcccccHHHccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
mvtvssqctkkeanrgawtAEEDQKLAQAIEVHGPKKWKSVAAKAGLNRCGKSCRLRWMNylrphikrgnisdQEEDLILRLHKLLGNRwsliagrlpgrtdneiKNYWNSHLSKkikqnekpsrgstakdLELEiskgeekgstvqkrsgdlegtfyadggsklfsfvgdnkffdcyndeplnlEWMSRFFEIdeswfdfa
mvtvssqctkkeanrgawtaeeDQKLAQAIEVhgpkkwksvaakaglnrcgkscRLRWMNYLRphikrgnisdqEEDLILRLHKLLGNRWsliagrlpgrtdNEIKNYWNShlskkikqnekpsrgstakdleleiskgeekgstvqkrsgDLEGTFYADGGSKLFSFVGDNKFFDCYNDEPLNLEWMSRFFEIDESWFDFA
MVTVSSQCTKKEANRGAWTAEEDQKLAQAIEVHGPKKWKSVAAKAGLNRCGKSCRLRWMNYLRPHIKRGNISDQEEDLILRLHKLLGNRWSLIAGRLPGRTDNEIKNYWNSHLSKKIKQNEKPSRGSTAKDLELEISKGEEKGSTVQKRSGDLEGTFYADGGSKLFSFVGDNKFFDCYNDEPLNLEWMSRFFEIDESWFDFA
****************************AIEVHGPKKWKSVAAKAGLNRCGKSCRLRWMNYLRPHIKRGNISDQEEDLILRLHKLLGNRWSLIAGRLPGRTDNEIKNYWN********************************************GTFYADGGSKLFSFVGDNKFFDCYNDEPLNLEWMSRFFEIDESWFD**
*****SQCTKKEANRGAWTAEEDQKLAQAIEVHGPKKWKSVAAKAGLNRCGKSCRLRWMNYLRPHIKRGNISDQEEDLILRLHKLLGNRWSLIAGRLPGRTDNEIKNYWNSHL************************************************************************EWMSRFFEIDESWFDFA
*******************AEEDQKLAQAIEVHGPKKWKSVAAKAGLNRCGKSCRLRWMNYLRPHIKRGNISDQEEDLILRLHKLLGNRWSLIAGRLPGRTDNEIKNYWNSHLSKK*************KDLELEISKGEEKGSTVQKRSGDLEGTFYADGGSKLFSFVGDNKFFDCYNDEPLNLEWMSRFFEIDESWFDFA
****SSQCTKKEANRGAWTAEEDQKLAQAIEVHGPKKWKSVAAKAGLNRCGKSCRLRWMNYLRPHIKRGNISDQEEDLILRLHKLLGNRWSLIAGRLPGRTDNEIKNYWNSHLSKKIKQNEKPS******************************************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTVSSQCTKKEANRGAWTAEEDQKLAQAIEVHGPKKWKSVAAKAGLNRCGKSCRLRWMNYLRPHIKRGNISDQEEDLILRLHKLLGNRWSLIAGRLPGRTDNEIKNYWNSHLSKKIKQNEKPSRGSTAKDLELEISKGEEKGSTVQKRSGDLEGTFYADGGSKLFSFVGDNKFFDCYNDEPLNLEWMSRFFEIDESWFDFA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query202 2.2.26 [Sep-21-2011]
Q38850249 Transcription repressor M yes no 0.826 0.670 0.502 2e-43
P10290273 Anthocyanin regulatory C1 N/A no 0.524 0.388 0.726 2e-41
Q9SEI0203 Transcription factor WER no no 0.658 0.655 0.573 1e-40
Q9SZP1282 Transcription repressor M no no 0.559 0.400 0.628 3e-40
Q9S9K9257 Transcription factor MYB3 no no 0.559 0.439 0.646 3e-40
Q96276219 Transcription factor MYB2 no no 0.524 0.484 0.669 4e-40
Q9FJA2258 Transcription factor TT2 no no 0.603 0.472 0.629 5e-40
Q38851236 Transcription repressor M no no 0.559 0.478 0.637 8e-40
P81393232 Myb-related protein 308 O N/A no 0.559 0.487 0.628 2e-39
P20026267 Myb-related protein Hv1 O N/A no 0.559 0.423 0.637 2e-39
>sp|Q38850|MYB5_ARATH Transcription repressor MYB5 OS=Arabidopsis thaliana GN=MYB5 PE=1 SV=1 Back     alignment and function desciption
 Score =  175 bits (443), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 116/187 (62%), Gaps = 20/187 (10%)

Query: 8   CTKKEANRGAWTAEEDQKLAQAIEVHGPKKWKSVAAKAGLNRCGKSCRLRWMNYLRPHIK 67
           CTK    RG WT EED+ L   I+  G  +W+S+  +AGL RCGKSCRLRWMNYLRP +K
Sbjct: 18  CTKMGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVK 77

Query: 68  RGNISDQEEDLILRLHKLLGNRWSLIAGRLPGRTDNEIKNYWNSHLSKKI------KQNE 121
           RG I+  EEDLILRLH+LLGNRWSLIAGR+PGRTDNEIKNYWN+HL KK+       Q  
Sbjct: 78  RGGITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGIDPQTH 137

Query: 122 KPSRGSTAKDLELEISKGEE-----------KGSTVQKRSGDLEGT---FYADGGSKLFS 167
           KP   +     E E+S G++             +TV    GD + +   F  + G + F 
Sbjct: 138 KPLDANNIHKPEEEVSGGQKYPLEPISSSHTDDTTVNGGDGDSKNSINVFGGEHGYEDFG 197

Query: 168 FVGDNKF 174
           F  D+KF
Sbjct: 198 FCYDDKF 204
Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1 or BHLH042/TT8.
Arabidopsis thaliana (taxid: 3702)
>sp|P10290|MYBC_MAIZE Anthocyanin regulatory C1 protein OS=Zea mays GN=C1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SEI0|WER_ARATH Transcription factor WER OS=Arabidopsis thaliana GN=WER PE=1 SV=1 Back     alignment and function description
>sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 Back     alignment and function description
>sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 Back     alignment and function description
>sp|Q96276|MYB23_ARATH Transcription factor MYB23 OS=Arabidopsis thaliana GN=MYB23 PE=1 SV=1 Back     alignment and function description
>sp|Q9FJA2|TT2_ARATH Transcription factor TT2 OS=Arabidopsis thaliana GN=TT2 PE=1 SV=1 Back     alignment and function description
>sp|Q38851|MYB6_ARATH Transcription repressor MYB6 OS=Arabidopsis thaliana GN=MYB6 PE=1 SV=1 Back     alignment and function description
>sp|P81393|MYB08_ANTMA Myb-related protein 308 OS=Antirrhinum majus GN=MYB308 PE=2 SV=1 Back     alignment and function description
>sp|P20026|MYB1_HORVU Myb-related protein Hv1 OS=Hordeum vulgare GN=MYB1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query202
343887323202 MYB transcription factor [Citrus unshiu] 1.0 1.0 0.980 1e-113
224088752197 predicted protein [Populus trichocarpa] 0.975 1.0 0.722 3e-73
147773779197 hypothetical protein VITISV_001712 [Viti 0.975 1.0 0.698 8e-71
225429672197 PREDICTED: transcription factor WER [Vit 0.975 1.0 0.693 2e-70
224142926200 predicted protein [Populus trichocarpa] 0.905 0.915 0.671 2e-68
327412623222 putative MYB transcription factor [Rosa 0.990 0.900 0.6 1e-64
225442138203 PREDICTED: transcription factor WER [Vit 0.896 0.891 0.668 3e-60
224111524197 predicted protein [Populus trichocarpa] 0.861 0.883 0.648 6e-60
296083498 479 unnamed protein product [Vitis vinifera] 0.881 0.371 0.619 8e-57
224054108194 predicted protein [Populus trichocarpa] 0.871 0.907 0.618 2e-55
>gi|343887323|dbj|BAK61869.1| MYB transcription factor [Citrus unshiu] Back     alignment and taxonomy information
 Score =  411 bits (1057), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 198/202 (98%), Positives = 201/202 (99%)

Query: 1   MVTVSSQCTKKEANRGAWTAEEDQKLAQAIEVHGPKKWKSVAAKAGLNRCGKSCRLRWMN 60
           MVTVSSQCTKKEANRGAWTAEEDQKLAQAIEVHGPKKWKSVAAKAGLNRCGKSCRLRWMN
Sbjct: 1   MVTVSSQCTKKEANRGAWTAEEDQKLAQAIEVHGPKKWKSVAAKAGLNRCGKSCRLRWMN 60

Query: 61  YLRPHIKRGNISDQEEDLILRLHKLLGNRWSLIAGRLPGRTDNEIKNYWNSHLSKKIKQN 120
           YLRP+IKRG+ISDQEEDLILRLHKLLGNRWSLIAGRLPGRTDNEIKNYWNSHLSKKIKQN
Sbjct: 61  YLRPNIKRGSISDQEEDLILRLHKLLGNRWSLIAGRLPGRTDNEIKNYWNSHLSKKIKQN 120

Query: 121 EKPSRGSTAKDLELEISKGEEKGSTVQKRSGDLEGTFYADGGSKLFSFVGDNKFFDCYND 180
           EKPSRGSTAKDLELEISKGEEKGSTVQKRSGDLEGTFYADGGSKLFSFVGDNKFFDCYND
Sbjct: 121 EKPSRGSTAKDLELEISKGEEKGSTVQKRSGDLEGTFYADGGSKLFSFVGDNKFFDCYND 180

Query: 181 EPLNLEWMSRFFEIDESWFDFA 202
           EPLNLEWM RFFE+DESWFDFA
Sbjct: 181 EPLNLEWMGRFFEMDESWFDFA 202

Source: Citrus unshiu

Species: Citrus unshiu

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224088752|ref|XP_002308525.1| predicted protein [Populus trichocarpa] gi|222854501|gb|EEE92048.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147773779|emb|CAN65256.1| hypothetical protein VITISV_001712 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225429672|ref|XP_002279941.1| PREDICTED: transcription factor WER [Vitis vinifera] gi|296081715|emb|CBI20720.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224142926|ref|XP_002324782.1| predicted protein [Populus trichocarpa] gi|222866216|gb|EEF03347.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|327412623|emb|CCA29100.1| putative MYB transcription factor [Rosa rugosa] Back     alignment and taxonomy information
>gi|225442138|ref|XP_002273991.1| PREDICTED: transcription factor WER [Vitis vinifera] gi|297743011|emb|CBI35878.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224111524|ref|XP_002332922.1| predicted protein [Populus trichocarpa] gi|222872005|gb|EEF09136.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296083498|emb|CBI23467.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224054108|ref|XP_002298097.1| predicted protein [Populus trichocarpa] gi|222845355|gb|EEE82902.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query202
TAIR|locus:2092820249 MYB5 "myb domain protein 5" [A 0.846 0.686 0.529 1.2e-42
TAIR|locus:2162585 319 MYB49 "myb domain protein 49" 0.559 0.354 0.628 1.4e-40
TAIR|locus:2185470203 MYB66 "myb domain protein 66" 0.658 0.655 0.588 3.3e-40
TAIR|locus:2009452257 MYB3 "myb domain protein 3" [A 0.544 0.428 0.654 6.8e-40
TAIR|locus:2075387 321 MYB107 "myb domain protein 107 0.554 0.348 0.625 9.4e-40
TAIR|locus:2169538258 TT2 "TRANSPARENT TESTA 2" [Ara 0.574 0.449 0.661 1.1e-39
TAIR|locus:2133677236 MYB6 "myb domain protein 6" [A 0.544 0.466 0.645 1.8e-39
TAIR|locus:2121259282 MYB4 "myb domain protein 4" [A 0.544 0.390 0.636 1.8e-39
TAIR|locus:1005716764212 HOS10 "high response to osmoti 0.732 0.698 0.525 2.9e-39
TAIR|locus:2170553219 MYB23 "myb domain protein 23" 0.737 0.680 0.529 3.7e-39
TAIR|locus:2092820 MYB5 "myb domain protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 451 (163.8 bits), Expect = 1.2e-42, P = 1.2e-42
 Identities = 100/189 (52%), Positives = 122/189 (64%)

Query:     8 CTKKEANRGAWTAEEDQKLAQAIEVHGPKKWKSVAAKAGLNRCGKSCRLRWMNYLRPHIK 67
             CTK    RG WT EED+ L   I+  G  +W+S+  +AGL RCGKSCRLRWMNYLRP +K
Sbjct:    18 CTKMGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVK 77

Query:    68 RGNISDQEEDLILRLHKLLGNRWSLIAGRLPGRTDNEIKNYWNSHLSKKI-KQNEKPSRG 126
             RG I+  EEDLILRLH+LLGNRWSLIAGR+PGRTDNEIKNYWN+HL KK+ +Q   P   
Sbjct:    78 RGGITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGIDPQ-- 135

Query:   127 STAKDLELE-ISKGEEKGSTVQK------RSGDLEGTFY--ADGGSK--LFSFVGDNKFF 175
              T K L+   I K EE+ S  QK       S   + T     DG SK  +  F G++ + 
Sbjct:   136 -THKPLDANNIHKPEEEVSGGQKYPLEPISSSHTDDTTVNGGDGDSKNSINVFGGEHGYE 194

Query:   176 D---CYNDE 181
             D   CY+D+
Sbjct:   195 DFGFCYDDK 203
GO:0003677 "DNA binding" evidence=IEA;ISS;TAS
GO:0005634 "nucleus" evidence=ISM
GO:0009845 "seed germination" evidence=NAS
GO:0010026 "trichome differentiation" evidence=NAS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0010090 "trichome morphogenesis" evidence=IMP
GO:0010214 "seed coat development" evidence=IMP
GO:0010468 "regulation of gene expression" evidence=IEP
GO:0048354 "mucilage biosynthetic process involved in seed coat development" evidence=IMP
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
TAIR|locus:2162585 MYB49 "myb domain protein 49" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2185470 MYB66 "myb domain protein 66" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009452 MYB3 "myb domain protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075387 MYB107 "myb domain protein 107" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169538 TT2 "TRANSPARENT TESTA 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133677 MYB6 "myb domain protein 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121259 MYB4 "myb domain protein 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1005716764 HOS10 "high response to osmotic stress 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170553 MYB23 "myb domain protein 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q38850MYB5_ARATHNo assigned EC number0.50260.82670.6706yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 5e-55
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 4e-49
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 2e-17
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 7e-16
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 6e-13
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 7e-12
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 9e-11
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 4e-10
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 8e-10
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 6e-09
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 5e-06
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information 
 Score =  174 bits (443), Expect = 5e-55
 Identities = 94/187 (50%), Positives = 116/187 (62%), Gaps = 20/187 (10%)

Query: 8   CTKKEANRGAWTAEEDQKLAQAIEVHGPKKWKSVAAKAGLNRCGKSCRLRWMNYLRPHIK 67
           CTK    RG WT EED+ L   I+  G  +W+S+  +AGL RCGKSCRLRWMNYLRP +K
Sbjct: 18  CTKMGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVK 77

Query: 68  RGNISDQEEDLILRLHKLLGNRWSLIAGRLPGRTDNEIKNYWNSHLSKKI------KQNE 121
           RG I+  EEDLILRLH+LLGNRWSLIAGR+PGRTDNEIKNYWN+HL KK+       Q  
Sbjct: 78  RGGITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGIDPQTH 137

Query: 122 KPSRGSTAKDLELEISKGEE-----------KGSTVQKRSGDLEGT---FYADGGSKLFS 167
           KP   +     E E+S G++             +TV    GD + +   F  + G + F 
Sbjct: 138 KPLDANNIHKPEEEVSGGQKYPIEPISSSHTDDTTVNGGDGDSKNSINVFGGEHGYEDFG 197

Query: 168 FVGDNKF 174
           F  D+KF
Sbjct: 198 FCYDDKF 204

Length = 249
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 202
PLN03212249 Transcription repressor MYB5; Provisional 100.0
PLN03091 459 hypothetical protein; Provisional 100.0
KOG0048238 consensus Transcription factor, Myb superfamily [T 100.0
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.85
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.84
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.74
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.66
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.64
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.55
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.55
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.54
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.45
PLN03212249 Transcription repressor MYB5; Provisional 99.44
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.36
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.32
PLN03091 459 hypothetical protein; Provisional 99.28
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.26
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.23
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.09
KOG0051607 consensus RNA polymerase I termination factor, Myb 98.99
COG5147512 REB1 Myb superfamily proteins, including transcrip 98.51
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 98.34
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 98.17
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 98.05
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.97
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 97.93
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.9
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.6
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.57
COG5259 531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.51
KOG1279 506 consensus Chromatin remodeling factor subunit and 97.46
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 97.45
KOG1279506 consensus Chromatin remodeling factor subunit and 97.39
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.27
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 97.05
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.93
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.93
PRK13923170 putative spore coat protein regulator protein YlbO 96.62
PLN031421033 Probable chromatin-remodeling complex ATPase chain 96.54
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 96.23
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 96.23
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 95.96
PRK13923170 putative spore coat protein regulator protein YlbO 95.86
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.79
KOG2656 445 consensus DNA methyltransferase 1-associated prote 94.39
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 94.28
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 93.84
KOG4282 345 consensus Transcription factor GT-2 and related pr 92.28
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 91.68
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 91.4
PF1162687 Rap1_C: TRF2-interacting telomeric protein/Rap1 - 90.78
KOG4167 907 consensus Predicted DNA-binding protein, contains 90.73
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 90.35
KOG1194 534 consensus Predicted DNA-binding protein, contains 89.55
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 88.68
KOG4329445 consensus DNA-binding protein [General function pr 86.71
KOG4282345 consensus Transcription factor GT-2 and related pr 84.84
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 84.82
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 84.22
KOG4167 907 consensus Predicted DNA-binding protein, contains 83.53
KOG4468 782 consensus Polycomb-group transcriptional regulator 81.84
smart0059589 MADF subfamily of SANT domain. 80.22
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.9e-37  Score=257.26  Aligned_cols=122  Identities=62%  Similarity=1.147  Sum_probs=115.2

Q ss_pred             CCCcccCCCCCCCCCCHHHHHHHHHHHHHhCCCChhHHhhhhccCcCccccchhhhccccCCCCCCCCCHHHHHHHHHHH
Q 028922            4 VSSQCTKKEANRGAWTAEEDQKLAQAIEVHGPKKWKSVAAKAGLNRCGKSCRLRWMNYLRPHIKRGNISDQEEDLILRLH   83 (202)
Q Consensus         4 ~~~~~~~~~~~kg~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~~~Rt~~qcr~Rw~~~L~p~~~k~~WT~eEd~~Ll~~v   83 (202)
                      ++++|.|+.++|++||+|||++|+++|++||..+|..||+.++.+|+++|||+||.++|+|.+++++||.|||++|++++
T Consensus        14 ~~pcc~K~glKRg~WT~EEDe~L~~lV~kyG~~nW~~IAk~~g~gRT~KQCReRW~N~L~P~I~kgpWT~EED~lLlel~   93 (249)
T PLN03212         14 TTPCCTKMGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGGITSDEEDLILRLH   93 (249)
T ss_pred             CCCCcccCCCcCCCCCHHHHHHHHHHHHHhCcccHHHHHHhhhcCCCcchHHHHHHHhhchhcccCCCChHHHHHHHHHH
Confidence            56789999999999999999999999999998999999999966999999999999999999999999999999999999


Q ss_pred             HHhCCChHHHhccCCCCCHHHHHHHHHHhhhHHHhhcCCCCC
Q 028922           84 KLLGNRWSLIAGRLPGRTDNEIKNYWNSHLSKKIKQNEKPSR  125 (202)
Q Consensus        84 ~~~G~~W~~Ia~~l~gRT~~q~k~rw~~~l~~~~~~~~~~~~  125 (202)
                      ..||++|+.||+.|||||+++||+||+.++++.+.+.+....
T Consensus        94 ~~~GnKWs~IAk~LpGRTDnqIKNRWns~LrK~l~r~~i~p~  135 (249)
T PLN03212         94 RLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGIDPQ  135 (249)
T ss_pred             HhccccHHHHHhhcCCCCHHHHHHHHHHHHhHHHHhcCCCCC
Confidence            999999999999999999999999999999998887665443

>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF11626 Rap1_C: TRF2-interacting telomeric protein/Rap1 - C terminal domain; InterPro: IPR021661 This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [] Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>KOG4329 consensus DNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>smart00595 MADF subfamily of SANT domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 4e-25
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 7e-25
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 7e-25
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 1e-24
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 9e-24
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 4e-18
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 6e-14
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 5e-10
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 1e-09
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 5e-09
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 2e-08
1mbg_A53 Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 4e-08
1gv5_A52 Crystal Structure Of C-Myb R2 Length = 52 4e-08
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure 
Iteration: 1

 Score =  110 bits (276), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 75/106 (70%), Gaps = 1/106 (0%)
Query: 12  EANRGAWTAEEDQKLAQAIEVHGPKKWKSVAAKAGLNRCGKSCRLRWMNYLRPHIKRGNI 71
           E N+G WT EEDQ++ + ++ +GPK+W  +A K    R GK CR RW N+L P +K+ + 
Sbjct: 24  ELNKGPWTKEEDQRVIEHVQKYGPKRWSDIA-KHLKGRIGKQCRERWHNHLNPEVKKTSW 82
Query: 72  SDQEEDLILRLHKLLGNRWSLIAGRLPGRTDNEIKNYWNSHLSKKI 117
           +++E+ +I + HK LGNRW+ IA  LPGRTDN +KN+WNS + +K+
Sbjct: 83  TEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNSTMRRKV 128
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure
>pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 Back     alignment and structure
>pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 3e-63
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 2e-60
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 2e-59
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 6e-16
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 3e-54
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 8e-54
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 3e-50
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 1e-30
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 8e-23
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-22
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 8e-21
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 7e-19
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 6e-10
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-07
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 1e-09
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 2e-09
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 1e-07
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 2e-07
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 7e-07
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 9e-07
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 9e-07
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 1e-06
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 5e-06
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 5e-06
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 7e-06
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 4e-05
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 6e-05
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 7e-05
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 2e-04
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 6e-04
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 3e-04
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
 Score =  191 bits (487), Expect = 3e-63
 Identities = 42/116 (36%), Positives = 66/116 (56%), Gaps = 1/116 (0%)

Query: 15  RGAWTAEEDQKLAQAIEVHGPKKWKSVAAKAGLNRCGKSCRLRWMNYLRPHIKRGNISDQ 74
           +G +T  ED  + + ++ +GP+ W  + +    NR  K CR RW N+L P + +   + +
Sbjct: 2   KGPFTEAEDDLIREYVKENGPQNWPRITSFLP-NRSPKQCRERWFNHLDPAVVKHAWTPE 60

Query: 75  EEDLILRLHKLLGNRWSLIAGRLPGRTDNEIKNYWNSHLSKKIKQNEKPSRGSTAK 130
           E++ I R +  LG++WS+IA  +PGRTDN IKN WNS +SK+I  N          
Sbjct: 61  EDETIFRNYLKLGSKWSVIAKLIPGRTDNAIKNRWNSSISKRISTNSNHKEILLPD 116
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query202
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 100.0
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 100.0
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 100.0
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 100.0
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 100.0
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 100.0
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.98
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.89
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.89
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.81
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.79
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.79
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.79
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.76
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.76
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.76
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.75
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.74
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.74
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.73
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.73
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.73
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.73
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.71
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.7
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.7
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.69
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.69
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.67
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.67
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.66
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.65
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.65
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.64
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.62
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.62
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.41
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.57
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.56
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.55
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.53
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.51
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.5
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.5
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.49
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.49
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.48
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.47
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.46
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.45
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.18
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.43
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.41
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.39
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.35
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.34
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.23
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.23
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 99.18
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.05
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 99.02
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.02
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.94
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.91
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.89
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.76
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.75
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.69
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.66
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.66
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.6
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 98.48
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.41
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.36
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.34
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.3
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 98.24
2crg_A70 Metastasis associated protein MTA3; transcription 98.23
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.21
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.5
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.96
2crg_A70 Metastasis associated protein MTA3; transcription 97.86
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.82
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.67
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 97.59
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 97.41
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.4
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.37
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.33
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 96.1
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 96.52
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 95.43
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 95.26
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 94.6
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 94.5
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 92.16
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 91.0
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
Probab=100.00  E-value=6.3e-37  Score=227.00  Aligned_cols=105  Identities=47%  Similarity=0.897  Sum_probs=99.5

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCChhHHhhhhccCcCccccchhhhccccCCCCCCCCCHHHHHHHHHHHHHhCCChH
Q 028922           12 EANRGAWTAEEDQKLAQAIEVHGPKKWKSVAAKAGLNRCGKSCRLRWMNYLRPHIKRGNISDQEEDLILRLHKLLGNRWS   91 (202)
Q Consensus        12 ~~~kg~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~~~Rt~~qcr~Rw~~~L~p~~~k~~WT~eEd~~Ll~~v~~~G~~W~   91 (202)
                      .+++|+||+|||++|+.+|..||..+|..||..|+ +||+.||++||.++|+|.+++++||+|||.+|+++|.+||++|+
T Consensus         1 ~l~k~~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~-~Rt~~qcr~Rw~~~l~p~~~~~~Wt~eEd~~L~~~~~~~G~~W~   79 (105)
T 1gv2_A            1 ELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWA   79 (105)
T ss_dssp             CCCCSCCCHHHHHHHHHHHHHHCTTCHHHHHTTST-TCCHHHHHHHHHHTTCCCCCCCCCCHHHHHHHHHHHHHHSSCHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCcHHHHhhhhc-CCCHHHHHHHHHhccCCcccccCCCHHHHHHHHHHHHHhCCCHH
Confidence            36899999999999999999999889999999999 99999999999999999999999999999999999999999999


Q ss_pred             HHhccCCCCCHHHHHHHHHHhhhHHH
Q 028922           92 LIAGRLPGRTDNEIKNYWNSHLSKKI  117 (202)
Q Consensus        92 ~Ia~~l~gRT~~q~k~rw~~~l~~~~  117 (202)
                      .||..|||||++||++||+.++++++
T Consensus        80 ~Ia~~l~gRt~~~~k~rw~~~~~~~~  105 (105)
T 1gv2_A           80 EIAKLLPGRTDNAIKNHWNSTMRRKV  105 (105)
T ss_dssp             HHHTTCTTCCHHHHHHHHHHHTC---
T ss_pred             HHHHHcCCCCHHHHHHHHHHHHhccC
Confidence            99999999999999999999988753
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 202
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 7e-18
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 3e-09
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-17
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 3e-07
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 3e-15
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 3e-12
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 5e-14
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 7e-13
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 2e-12
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 0.003
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 4e-12
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 4e-10
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 1e-11
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 1e-09
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 3e-10
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 7e-10
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 3e-05
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 1e-08
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 1e-05
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 2e-08
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 1e-06
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 7e-07
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 2e-05
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 8e-05
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 1e-04
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 71.7 bits (176), Expect = 7e-18
 Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 1/51 (1%)

Query: 14 NRGAWTAEEDQKLAQAIEVHGPKKWKSVAAKAGLNRCGKSCRLRWMNYLRP 64
           +G WT EEDQ+L + ++ +GPK+W  +A K    R GK CR RW N+L P
Sbjct: 2  IKGPWTKEEDQRLIKLVQKYGPKRWSVIA-KHLKGRIGKQCRERWHNHLNP 51
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query202
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.79
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.79
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.77
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.76
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.75
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.71
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.67
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.64
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.62
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.62
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.61
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.58
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.58
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.58
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.56
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.56
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.51
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.48
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.47
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.45
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.44
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.43
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.36
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.35
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.32
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.19
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.13
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.96
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.6
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.42
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.33
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.22
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 98.1
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 97.78
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.77
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.35
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 97.04
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.85
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.07
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 95.6
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 94.34
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 92.57
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 90.66
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 84.19
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.79  E-value=2.7e-22  Score=141.73  Aligned_cols=70  Identities=19%  Similarity=0.257  Sum_probs=64.3

Q ss_pred             CCCCCHHHHHHHHHHHHHhCCC-----ChhHHhhhhccCcCccccchhhhccccCCCCCCCCCHHHHHHHHHHHHH
Q 028922           15 RGAWTAEEDQKLAQAIEVHGPK-----KWKSVAAKAGLNRCGKSCRLRWMNYLRPHIKRGNISDQEEDLILRLHKL   85 (202)
Q Consensus        15 kg~WT~eED~~L~~~v~~~g~~-----~W~~Ia~~l~~~Rt~~qcr~Rw~~~L~p~~~k~~WT~eEd~~Ll~~v~~   85 (202)
                      |+.||+|||++|+++|.+||..     +|..||..|| |||+.||++||.++|+|.+++++||.+||.+|+..+..
T Consensus         1 k~~WT~eED~~L~~~v~~~g~~~~~~~~W~~IA~~lp-gRt~~qcr~Rw~~~L~p~l~~~~~t~~ed~ll~d~~~~   75 (86)
T d1igna1           1 KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVP-NHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGN   75 (86)
T ss_dssp             CCCCCHHHHHHHHHHHHTSGGGTTCSHHHHHHTTTST-TSCHHHHHHHHHHTTGGGCCCEECBCTTSCBCBCTTSC
T ss_pred             CCCCCHHHHHHHHHHHHHhCcCcCCccCHHHHHHHcC-CCCHHHHHHHHHHHcCccccCCCCCCchhHHHHHHhhc
Confidence            6899999999999999999854     4999999999 99999999999999999999999999999988765533
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure