Citrus Sinensis ID: 029009
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 200 | ||||||
| 302398823 | 289 | HD domain class transcription factor [Ma | 0.93 | 0.643 | 0.623 | 8e-57 | |
| 296090659 | 266 | unnamed protein product [Vitis vinifera] | 0.855 | 0.642 | 0.625 | 6e-56 | |
| 359497258 | 283 | PREDICTED: homeobox-leucine zipper prote | 0.88 | 0.621 | 0.604 | 8e-56 | |
| 255579497 | 289 | homeobox protein, putative [Ricinus comm | 0.92 | 0.636 | 0.611 | 7e-51 | |
| 307715376 | 281 | homeodomain-leucine zipper protein HD4 [ | 0.915 | 0.651 | 0.668 | 8e-51 | |
| 224097208 | 229 | predicted protein [Populus trichocarpa] | 0.68 | 0.593 | 0.748 | 8e-50 | |
| 356541549 | 283 | PREDICTED: homeobox-leucine zipper prote | 0.92 | 0.650 | 0.577 | 9e-50 | |
| 255648285 | 283 | unknown [Glycine max] | 0.92 | 0.650 | 0.572 | 3e-49 | |
| 356497023 | 283 | PREDICTED: homeobox-leucine zipper prote | 0.905 | 0.639 | 0.574 | 3e-47 | |
| 255647889 | 283 | unknown [Glycine max] | 0.905 | 0.639 | 0.574 | 3e-47 |
| >gi|302398823|gb|ADL36706.1| HD domain class transcription factor [Malus x domestica] | Back alignment and taxonomy information |
|---|
Score = 225 bits (574), Expect = 8e-57, Method: Compositional matrix adjust.
Identities = 131/210 (62%), Positives = 146/210 (69%), Gaps = 24/210 (11%)
Query: 1 MGFDD-GCNTGLVLGLGFASAIETTPTN----KANNINIVNHQQLQLPKGTCFEPSLSLG 55
MGFDD CNTGLVLGLG S+ N NNI + P FEPSL+LG
Sbjct: 1 MGFDDHACNTGLVLGLGLTSSAPQESCNLTKFAKNNIKPSLNSA---PTSGAFEPSLTLG 57
Query: 56 LPGEIYPEAATATT---KKNSNSIDVNKGYEESAAAGVAEYQILNRQASPHS--AVSNSF 110
L GE Y + A+ NS+ + Y ++AAA +SPHS AVSNSF
Sbjct: 58 LSGEPYHQQTVASNIYKVGNSSQDEAIDLYRQAAAA-----------SSPHSHSAVSNSF 106
Query: 111 SSGRVVKRERDLSSEEIEVEKVISSRASDEDEDGVNARKKLRLTKEQSALLEESFKQHST 170
SSGRVVKRERDLSSEE++V++ +SSR SDEDEDG NARKKLRLTKEQSALLEESFKQHST
Sbjct: 107 SSGRVVKRERDLSSEEVDVDEKVSSRVSDEDEDGSNARKKLRLTKEQSALLEESFKQHST 166
Query: 171 LNPKQKQALARQLNLRPRQVEVWFQNRRAR 200
LNPKQKQALARQLNLRPRQVEVWFQNRRAR
Sbjct: 167 LNPKQKQALARQLNLRPRQVEVWFQNRRAR 196
|
Source: Malus x domestica Species: Malus x domestica Genus: Malus Family: Rosaceae Order: Rosales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|296090659|emb|CBI41059.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359497258|ref|XP_002271511.2| PREDICTED: homeobox-leucine zipper protein HAT22 [Vitis vinifera] gi|147778182|emb|CAN60988.1| hypothetical protein VITISV_022980 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255579497|ref|XP_002530591.1| homeobox protein, putative [Ricinus communis] gi|223529839|gb|EEF31771.1| homeobox protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|307715376|gb|ADN88095.1| homeodomain-leucine zipper protein HD4 [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|224097208|ref|XP_002310877.1| predicted protein [Populus trichocarpa] gi|222853780|gb|EEE91327.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356541549|ref|XP_003539237.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255648285|gb|ACU24595.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356497023|ref|XP_003517364.1| PREDICTED: homeobox-leucine zipper protein HAT22-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255647889|gb|ACU24403.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 200 | ||||||
| TAIR|locus:2137599 | 278 | HAT22 [Arabidopsis thaliana (t | 0.585 | 0.420 | 0.612 | 9.4e-40 | |
| TAIR|locus:2059143 | 274 | HAT9 [Arabidopsis thaliana (ta | 0.76 | 0.554 | 0.549 | 2.3e-32 | |
| TAIR|locus:2171489 | 283 | HAT2 [Arabidopsis thaliana (ta | 0.315 | 0.222 | 0.75 | 5.6e-25 | |
| TAIR|locus:2129136 | 284 | HB-2 "homeobox protein 2" [Ara | 0.555 | 0.390 | 0.532 | 2.6e-24 | |
| TAIR|locus:2055028 | 318 | HB4 "homeobox-leucine zipper p | 0.665 | 0.418 | 0.464 | 6.1e-23 | |
| TAIR|locus:2170194 | 336 | HAT14 "homeobox from Arabidops | 0.545 | 0.324 | 0.530 | 6.1e-23 | |
| TAIR|locus:2103396 | 315 | HAT3 "homeobox-leucine zipper | 0.945 | 0.6 | 0.364 | 3e-21 | |
| TAIR|locus:2129061 | 282 | HAT1 [Arabidopsis thaliana (ta | 0.505 | 0.358 | 0.504 | 1.2e-19 | |
| TAIR|locus:2049614 | 275 | HB17 "homeobox-leucine zipper | 0.3 | 0.218 | 0.7 | 3.6e-18 | |
| TAIR|locus:2013980 | 206 | HB18 "homeobox-leucine zipper | 0.31 | 0.300 | 0.693 | 4.7e-16 |
| TAIR|locus:2137599 HAT22 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 335 (123.0 bits), Expect = 9.4e-40, Sum P(2) = 9.4e-40
Identities = 79/129 (61%), Positives = 91/129 (70%)
Query: 80 KGYEESAAAGVAEYQILNRQASPHSAVSNSFSSGRVVKRERDLXXXXXXXXXXXXX---- 135
+ Y+ AG + QI RQ S HS +S SFSSGRV KRER++
Sbjct: 53 ESYKIKTGAGAGD-QIC-RQTSSHSGIS-SFSSGRV-KREREISGGDGEEEAEETTERVV 108
Query: 136 --RASDE--DEDGVNARKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVE 191
R SD+ DE+GV+ARKKLRLTK+QSALLE++FK HSTLNPKQKQALARQLNLRPRQVE
Sbjct: 109 CSRVSDDHDDEEGVSARKKLRLTKQQSALLEDNFKLHSTLNPKQKQALARQLNLRPRQVE 168
Query: 192 VWFQNRRAR 200
VWFQNRRAR
Sbjct: 169 VWFQNRRAR 177
|
|
| TAIR|locus:2059143 HAT9 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2171489 HAT2 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2129136 HB-2 "homeobox protein 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2055028 HB4 "homeobox-leucine zipper protein 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2170194 HAT14 "homeobox from Arabidopsis thaliana" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2103396 HAT3 "homeobox-leucine zipper protein 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2129061 HAT1 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2049614 HB17 "homeobox-leucine zipper protein 17" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2013980 HB18 "homeobox-leucine zipper protein 18" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 200 | |||
| smart00389 | 57 | smart00389, HOX, Homeodomain | 6e-17 | |
| cd00086 | 59 | cd00086, homeodomain, Homeodomain; DNA binding dom | 2e-16 | |
| pfam00046 | 57 | pfam00046, Homeobox, Homeobox domain | 2e-16 | |
| COG5576 | 156 | COG5576, COG5576, Homeodomain-containing transcrip | 1e-09 |
| >gnl|CDD|197696 smart00389, HOX, Homeodomain | Back alignment and domain information |
|---|
Score = 71.1 bits (175), Expect = 6e-17
Identities = 23/53 (43%), Positives = 37/53 (69%)
Query: 148 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRAR 200
RK+ T EQ LE+ F+++ + ++++ LA++L L RQV+VWFQNRRA+
Sbjct: 3 RKRTSFTPEQLEELEKEFQKNPYPSREEREELAKKLGLSERQVKVWFQNRRAK 55
|
DNA-binding factors that are involved in the transcriptional regulation of key developmental processes. Length = 57 |
| >gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain | Back alignment and domain information |
|---|
| >gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 200 | |||
| KOG0842 | 307 | consensus Transcription factor tinman/NKX2-3, cont | 99.66 | |
| KOG0850 | 245 | consensus Transcription factor DLX and related pro | 99.63 | |
| KOG0489 | 261 | consensus Transcription factor zerknullt and relat | 99.61 | |
| KOG0484 | 125 | consensus Transcription factor PHOX2/ARIX, contain | 99.6 | |
| KOG0488 | 309 | consensus Transcription factor BarH and related HO | 99.6 | |
| KOG0487 | 308 | consensus Transcription factor Abd-B, contains HOX | 99.59 | |
| KOG0485 | 268 | consensus Transcription factor NKX-5.1/HMX1, conta | 99.59 | |
| KOG0843 | 197 | consensus Transcription factor EMX1 and related HO | 99.56 | |
| PF00046 | 57 | Homeobox: Homeobox domain not present here.; Inter | 99.55 | |
| KOG2251 | 228 | consensus Homeobox transcription factor [Transcrip | 99.54 | |
| KOG0492 | 246 | consensus Transcription factor MSH, contains HOX d | 99.53 | |
| KOG0493 | 342 | consensus Transcription factor Engrailed, contains | 99.52 | |
| KOG0494 | 332 | consensus Transcription factor CHX10 and related H | 99.5 | |
| TIGR01565 | 58 | homeo_ZF_HD homeobox domain, ZF-HD class. This mod | 99.49 | |
| smart00389 | 56 | HOX Homeodomain. DNA-binding factors that are invo | 99.49 | |
| cd00086 | 59 | homeodomain Homeodomain; DNA binding domains invol | 99.45 | |
| KOG0483 | 198 | consensus Transcription factor HEX, contains HOX a | 99.41 | |
| KOG0848 | 317 | consensus Transcription factor Caudal, contains HO | 99.4 | |
| KOG3802 | 398 | consensus Transcription factor OCT-1, contains POU | 99.39 | |
| COG5576 | 156 | Homeodomain-containing transcription factor [Trans | 99.38 | |
| KOG0491 | 194 | consensus Transcription factor BSH, contains HOX d | 99.35 | |
| KOG0486 | 351 | consensus Transcription factor PTX1, contains HOX | 99.32 | |
| KOG4577 | 383 | consensus Transcription factor LIM3, contains LIM | 99.28 | |
| KOG0844 | 408 | consensus Transcription factor EVX1, contains HOX | 99.25 | |
| KOG0490 | 235 | consensus Transcription factor, contains HOX domai | 99.1 | |
| KOG0847 | 288 | consensus Transcription factor, contains HOX domai | 99.08 | |
| KOG1168 | 385 | consensus Transcription factor ACJ6/BRN-3, contain | 98.88 | |
| KOG0849 | 354 | consensus Transcription factor PRD and related pro | 98.86 | |
| KOG0775 | 304 | consensus Transcription factor SIX and related HOX | 98.67 | |
| PF05920 | 40 | Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 | 98.29 | |
| KOG2252 | 558 | consensus CCAAT displacement protein and related h | 98.23 | |
| KOG0774 | 334 | consensus Transcription factor PBX and related HOX | 98.21 | |
| KOG0490 | 235 | consensus Transcription factor, contains HOX domai | 97.9 | |
| KOG1146 | 1406 | consensus Homeobox protein [General function predi | 97.29 | |
| PF11569 | 56 | Homez: Homeodomain leucine-zipper encoding, Homez; | 97.13 | |
| KOG0773 | 342 | consensus Transcription factor MEIS1 and related H | 97.03 | |
| KOG3623 | 1007 | consensus Homeobox transcription factor SIP1 [Tran | 94.75 | |
| PF04218 | 53 | CENP-B_N: CENP-B N-terminal DNA-binding domain; In | 92.03 |
| >KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
Probab=99.66 E-value=1.6e-16 Score=141.28 Aligned_cols=58 Identities=33% Similarity=0.613 Sum_probs=53.6
Q ss_pred cCCCCCCCccCCHHHHHHHHHHHhhCCCCCHHHHHHHHHHhCCCccccccccccccCC
Q 029009 143 DGVNARKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRAR 200 (200)
Q Consensus 143 ~~k~rr~Rt~ft~~Ql~~Le~~F~~~~~Ps~~~r~~LA~~lgLs~rqVqvWFQNRRaK 200 (200)
..++||.|.-|+..|+.+||+.|++++|++..+|+.||..|+|++.||||||||||-|
T Consensus 150 ~~~kRKrRVLFSqAQV~ELERRFrqQRYLSAPERE~LA~~LrLT~TQVKIWFQNrRYK 207 (307)
T KOG0842|consen 150 KRKKRKRRVLFSQAQVYELERRFRQQRYLSAPEREHLASSLRLTPTQVKIWFQNRRYK 207 (307)
T ss_pred cccccccccccchhHHHHHHHHHHhhhccccHhHHHHHHhcCCCchheeeeeecchhh
Confidence 3456666777999999999999999999999999999999999999999999999976
|
|
| >KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0485 consensus Transcription factor NKX-5 | Back alignment and domain information |
|---|
| >KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >PF00046 Homeobox: Homeobox domain not present here | Back alignment and domain information |
|---|
| >KOG2251 consensus Homeobox transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class | Back alignment and domain information |
|---|
| >smart00389 HOX Homeodomain | Back alignment and domain information |
|---|
| >cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >COG5576 Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0847 consensus Transcription factor, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] | Back alignment and domain information |
|---|
| >KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] | Back alignment and domain information |
|---|
| >KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1146 consensus Homeobox protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A | Back alignment and domain information |
|---|
| >KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] | Back alignment and domain information |
|---|
| >PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 200 | ||||
| 2e1o_A | 70 | Solution Structure Of Rsgi Ruh-028, A Homeobox Doma | 1e-05 | ||
| 1mh3_A | 421 | Maltose Binding-A1 Homeodomain Protein Chimera, Cry | 2e-05 | ||
| 1akh_A | 61 | Mat A1ALPHA2DNA TERNARY COMPLEX Length = 61 | 3e-05 | ||
| 2lp0_A | 60 | The Solution Structure Of Homeodomain-Protein Compl | 8e-05 | ||
| 1yrn_A | 61 | Crystal Structure Of The Mata1MATALPHA2 HOMEODOMAIN | 1e-04 | ||
| 1le8_A | 53 | Crystal Structure Of The Mata1MATALPHA2-3a Heterodi | 1e-04 | ||
| 1nk2_P | 77 | VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES | 1e-04 | ||
| 1qry_A | 80 | Homeobox Protein Vnd (Ventral Nervous System Defect | 3e-04 | ||
| 1puf_A | 77 | Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo | 3e-04 | ||
| 2dmu_A | 70 | Solution Structure Of The Homeobox Domain Of Homeob | 5e-04 | ||
| 1b8i_A | 81 | Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX | 5e-04 |
| >pdb|2E1O|A Chain A, Solution Structure Of Rsgi Ruh-028, A Homeobox Domain From Human Cdna Length = 70 | Back alignment and structure |
|
| >pdb|1MH3|A Chain A, Maltose Binding-A1 Homeodomain Protein Chimera, Crystal Form I Length = 421 | Back alignment and structure |
| >pdb|1AKH|A Chain A, Mat A1ALPHA2DNA TERNARY COMPLEX Length = 61 | Back alignment and structure |
| >pdb|2LP0|A Chain A, The Solution Structure Of Homeodomain-Protein Complex Length = 60 | Back alignment and structure |
| >pdb|1YRN|A Chain A, Crystal Structure Of The Mata1MATALPHA2 HOMEODOMAIN Heterodimer Bound To Dna Length = 61 | Back alignment and structure |
| >pdb|1LE8|A Chain A, Crystal Structure Of The Mata1MATALPHA2-3a Heterodimer Bound To Dna Complex Length = 53 | Back alignment and structure |
| >pdb|1NK2|P Chain P, VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES Length = 77 | Back alignment and structure |
| >pdb|1QRY|A Chain A, Homeobox Protein Vnd (Ventral Nervous System Defective Protein) Length = 80 | Back alignment and structure |
| >pdb|1PUF|A Chain A, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 77 | Back alignment and structure |
| >pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 | Back alignment and structure |
| >pdb|1B8I|A Chain A, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 81 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 200 | |||
| 1akh_A | 61 | Protein (mating-type protein A-1); complex (TWO DN | 3e-27 | |
| 2cqx_A | 72 | LAG1 longevity assurance homolog 5; homeodomain, D | 1e-14 | |
| 2da5_A | 75 | Zinc fingers and homeoboxes protein 3; homeobox do | 2e-13 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 2e-13 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 2e-12 | |
| 2dmp_A | 89 | Zinc fingers and homeoboxes protein 2; homeobox do | 4e-12 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 4e-12 | |
| 2ecb_A | 89 | Zinc fingers and homeoboxes protein 1; homeobox do | 1e-11 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 1e-11 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 2e-11 | |
| 1au7_A | 146 | Protein PIT-1, GHF-1; complex (DNA-binding protein | 4e-11 | |
| 1e3o_C | 160 | Octamer-binding transcription factor 1; transcript | 2e-10 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 2e-10 | |
| 1x2m_A | 64 | LAG1 longevity assurance homolog 6; homeobox domai | 3e-10 | |
| 3d1n_I | 151 | POU domain, class 6, transcription factor 1; prote | 4e-10 | |
| 3rkq_A | 58 | Homeobox protein NKX-2.5; helix-turn-helix, DNA bi | 4e-10 | |
| 2vi6_A | 62 | Homeobox protein nanog; homeodomain, DNA-binding, | 5e-10 | |
| 3l1p_A | 155 | POU domain, class 5, transcription factor 1; POU, | 5e-10 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 6e-10 | |
| 1wi3_A | 71 | DNA-binding protein SATB2; homeodomain, helix-turn | 6e-10 | |
| 3a03_A | 56 | T-cell leukemia homeobox protein 2; homeodomain, d | 1e-09 | |
| 2kt0_A | 84 | Nanog, homeobox protein nanog; homeodomain, struct | 2e-09 | |
| 1ftt_A | 68 | TTF-1 HD, thyroid transcription factor 1 homeodoma | 3e-09 | |
| 2l9r_A | 69 | Homeobox protein NKX-3.1; structural genomics, nor | 5e-09 | |
| 3a01_A | 93 | Homeodomain-containing protein; homeodomain, prote | 8e-09 | |
| 1nk2_P | 77 | Homeobox protein VND; homeodomain, DNA-binding pro | 8e-09 | |
| 2e1o_A | 70 | Homeobox protein PRH; DNA binding protein, structu | 1e-08 | |
| 2djn_A | 70 | Homeobox protein DLX-5; structural genomics, NPPSF | 1e-08 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 1e-08 | |
| 2hdd_A | 61 | Protein (engrailed homeodomain Q50K); DNA binding, | 2e-08 | |
| 1ig7_A | 58 | Homeotic protein MSX-1; helix-turn-helix, transcri | 2e-08 | |
| 2dmt_A | 80 | Homeobox protein BARH-like 1; homeobox domain, thr | 5e-08 | |
| 1jgg_A | 60 | Segmentation protein EVEN-skipped; homeodomain, pr | 5e-08 | |
| 2l7z_A | 73 | Homeobox protein HOX-A13; gene regulation; NMR {Ho | 8e-08 | |
| 1zq3_P | 68 | PRD-4, homeotic bicoid protein; protein-DNA comple | 1e-07 | |
| 2cra_A | 70 | Homeobox protein HOX-B13; DNA-binding, transcripti | 1e-07 | |
| 1puf_A | 77 | HOX-1.7, homeobox protein HOX-A9; homeodomian, pro | 1e-07 | |
| 3nar_A | 96 | ZHX1, zinc fingers and homeoboxes protein 1; corep | 2e-07 | |
| 2r5y_A | 88 | Homeotic protein sex combs reduced; homeodomain; H | 2e-07 | |
| 1ahd_P | 68 | Antennapedia protein mutant; DNA binding protein/D | 2e-07 | |
| 1b72_A | 97 | Protein (homeobox protein HOX-B1); homeodomain, DN | 2e-07 | |
| 1mnm_C | 87 | Protein (MAT alpha-2 transcriptional repressor); t | 2e-07 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 3e-07 | |
| 2h1k_A | 63 | IPF-1, pancreatic and duodenal homeobox 1, homeodo | 3e-07 | |
| 1b8i_A | 81 | Ultrabithorax, protein (ultrabithorax homeotic pro | 4e-07 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 4e-07 | |
| 2ecc_A | 76 | Homeobox and leucine zipper protein homez; homeobo | 4e-07 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 7e-07 | |
| 1k61_A | 60 | Mating-type protein alpha-2; protein-DNA complex, | 9e-07 | |
| 1le8_B | 83 | Mating-type protein alpha-2; matalpha2, isothermal | 1e-06 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 6e-06 | |
| 2dmu_A | 70 | Homeobox protein goosecoid; homeobox domain, three | 8e-06 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 2e-05 | |
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 3e-05 | |
| 2e19_A | 64 | Transcription factor 8; homeobox domain, structura | 5e-05 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 5e-05 | |
| 1puf_B | 73 | PRE-B-cell leukemia transcription factor-1; homeod | 6e-05 | |
| 2cue_A | 80 | Paired box protein PAX6; homeobox domain, transcri | 7e-05 | |
| 1x2n_A | 73 | Homeobox protein pknox1; homeobox domain, structur | 1e-04 | |
| 3a02_A | 60 | Homeobox protein aristaless; homeodomain, developm | 1e-04 | |
| 1du6_A | 64 | PBX1, homeobox protein PBX1; homeodomain, gene reg | 1e-04 | |
| 1b72_B | 87 | Protein (PBX1); homeodomain, DNA, complex, DNA-bin | 1e-04 | |
| 1yz8_P | 68 | Pituitary homeobox 2; DNA binding protein, transcr | 2e-04 | |
| 2dmn_A | 83 | Homeobox protein TGIF2LX; TGFB-induced factor 2-li | 5e-04 | |
| 3k2a_A | 67 | Homeobox protein MEIS2; homeobox domain, DNA-bindi | 5e-04 | |
| 2ys9_A | 70 | Homeobox and leucine zipper protein homez; homeodo | 6e-04 | |
| 2lk2_A | 89 | Homeobox protein TGIF1; NESG, structural genomics, | 9e-04 |
| >1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 | Back alignment and structure |
|---|
Score = 96.9 bits (242), Expect = 3e-27
Identities = 20/59 (33%), Positives = 36/59 (61%)
Query: 142 EDGVNARKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRAR 200
+ + + K ++ + A LEE F++ +LN K+K+ +A++ + P QV VWF N+R R
Sbjct: 1 KKEKSPKGKSSISPQARAFLEEVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMR 59
|
| >2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 | Back alignment and structure |
|---|
| >2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 | Back alignment and structure |
|---|
| >2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 | Back alignment and structure |
|---|
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 | Back alignment and structure |
|---|
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 | Back alignment and structure |
|---|
| >3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 | Back alignment and structure |
|---|
| >2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 | Back alignment and structure |
|---|
| >1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 | Back alignment and structure |
|---|
| >2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 | Back alignment and structure |
|---|
| >2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 | Back alignment and structure |
|---|
| >1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 | Back alignment and structure |
|---|
| >2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 | Back alignment and structure |
|---|
| >1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 | Back alignment and structure |
|---|
| >2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 | Back alignment and structure |
|---|
| >1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 | Back alignment and structure |
|---|
| >3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 | Back alignment and structure |
|---|
| >1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 | Back alignment and structure |
|---|
| >1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 | Back alignment and structure |
|---|
| >1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 | Back alignment and structure |
|---|
| >2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 | Back alignment and structure |
|---|
| >1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 | Back alignment and structure |
|---|
| >1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 | Back alignment and structure |
|---|
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 | Back alignment and structure |
|---|
| >2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 | Back alignment and structure |
|---|
| >1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Length = 73 | Back alignment and structure |
|---|
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 | Back alignment and structure |
|---|
| >1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 73 | Back alignment and structure |
|---|
| >3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 | Back alignment and structure |
|---|
| >1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 | Back alignment and structure |
|---|
| >1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Length = 87 | Back alignment and structure |
|---|
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 | Back alignment and structure |
|---|
| >2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 200 | |||
| 1wh5_A | 80 | ZF-HD homeobox family protein; structural genomics | 99.77 | |
| 2dmt_A | 80 | Homeobox protein BARH-like 1; homeobox domain, thr | 99.75 | |
| 2cra_A | 70 | Homeobox protein HOX-B13; DNA-binding, transcripti | 99.75 | |
| 1wh7_A | 80 | ZF-HD homeobox family protein; homeobox domain, st | 99.74 | |
| 2kt0_A | 84 | Nanog, homeobox protein nanog; homeodomain, struct | 99.74 | |
| 2djn_A | 70 | Homeobox protein DLX-5; structural genomics, NPPSF | 99.74 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 99.73 | |
| 2dmu_A | 70 | Homeobox protein goosecoid; homeobox domain, three | 99.73 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.73 | |
| 2vi6_A | 62 | Homeobox protein nanog; homeodomain, DNA-binding, | 99.72 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 99.72 | |
| 1nk2_P | 77 | Homeobox protein VND; homeodomain, DNA-binding pro | 99.72 | |
| 2h1k_A | 63 | IPF-1, pancreatic and duodenal homeobox 1, homeodo | 99.72 | |
| 2e1o_A | 70 | Homeobox protein PRH; DNA binding protein, structu | 99.72 | |
| 2cue_A | 80 | Paired box protein PAX6; homeobox domain, transcri | 99.72 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.72 | |
| 2hdd_A | 61 | Protein (engrailed homeodomain Q50K); DNA binding, | 99.71 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 99.71 | |
| 1puf_A | 77 | HOX-1.7, homeobox protein HOX-A9; homeodomian, pro | 99.71 | |
| 1akh_A | 61 | Protein (mating-type protein A-1); complex (TWO DN | 99.71 | |
| 1ig7_A | 58 | Homeotic protein MSX-1; helix-turn-helix, transcri | 99.71 | |
| 3rkq_A | 58 | Homeobox protein NKX-2.5; helix-turn-helix, DNA bi | 99.7 | |
| 2m0c_A | 75 | Homeobox protein aristaless-like 4; structural gen | 99.7 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 99.7 | |
| 2l7z_A | 73 | Homeobox protein HOX-A13; gene regulation; NMR {Ho | 99.7 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 99.7 | |
| 2da4_A | 80 | Hypothetical protein DKFZP686K21156; homeobox doma | 99.69 | |
| 2r5y_A | 88 | Homeotic protein sex combs reduced; homeodomain; H | 99.69 | |
| 1ahd_P | 68 | Antennapedia protein mutant; DNA binding protein/D | 99.69 | |
| 1jgg_A | 60 | Segmentation protein EVEN-skipped; homeodomain, pr | 99.69 | |
| 1yz8_P | 68 | Pituitary homeobox 2; DNA binding protein, transcr | 99.68 | |
| 1ftt_A | 68 | TTF-1 HD, thyroid transcription factor 1 homeodoma | 99.68 | |
| 1zq3_P | 68 | PRD-4, homeotic bicoid protein; protein-DNA comple | 99.68 | |
| 3a01_A | 93 | Homeodomain-containing protein; homeodomain, prote | 99.68 | |
| 1x2n_A | 73 | Homeobox protein pknox1; homeobox domain, structur | 99.68 | |
| 1b8i_A | 81 | Ultrabithorax, protein (ultrabithorax homeotic pro | 99.68 | |
| 2da5_A | 75 | Zinc fingers and homeoboxes protein 3; homeobox do | 99.67 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 99.67 | |
| 1wi3_A | 71 | DNA-binding protein SATB2; homeodomain, helix-turn | 99.67 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 99.66 | |
| 1du6_A | 64 | PBX1, homeobox protein PBX1; homeodomain, gene reg | 99.66 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 99.66 | |
| 3nar_A | 96 | ZHX1, zinc fingers and homeoboxes protein 1; corep | 99.66 | |
| 2ecc_A | 76 | Homeobox and leucine zipper protein homez; homeobo | 99.66 | |
| 3a02_A | 60 | Homeobox protein aristaless; homeodomain, developm | 99.65 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 99.65 | |
| 1b72_A | 97 | Protein (homeobox protein HOX-B1); homeodomain, DN | 99.65 | |
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 99.65 | |
| 3a03_A | 56 | T-cell leukemia homeobox protein 2; homeodomain, d | 99.64 | |
| 2ly9_A | 74 | Zinc fingers and homeoboxes protein 1; structural | 99.64 | |
| 1puf_B | 73 | PRE-B-cell leukemia transcription factor-1; homeod | 99.64 | |
| 2dmn_A | 83 | Homeobox protein TGIF2LX; TGFB-induced factor 2-li | 99.64 | |
| 1mnm_C | 87 | Protein (MAT alpha-2 transcriptional repressor); t | 99.63 | |
| 1k61_A | 60 | Mating-type protein alpha-2; protein-DNA complex, | 99.63 | |
| 2cqx_A | 72 | LAG1 longevity assurance homolog 5; homeodomain, D | 99.62 | |
| 1b72_B | 87 | Protein (PBX1); homeodomain, DNA, complex, DNA-bin | 99.62 | |
| 2e19_A | 64 | Transcription factor 8; homeobox domain, structura | 99.62 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 99.61 | |
| 1le8_B | 83 | Mating-type protein alpha-2; matalpha2, isothermal | 99.61 | |
| 1e3o_C | 160 | Octamer-binding transcription factor 1; transcript | 99.61 | |
| 1au7_A | 146 | Protein PIT-1, GHF-1; complex (DNA-binding protein | 99.61 | |
| 2dmp_A | 89 | Zinc fingers and homeoboxes protein 2; homeobox do | 99.61 | |
| 3d1n_I | 151 | POU domain, class 6, transcription factor 1; prote | 99.6 | |
| 2ecb_A | 89 | Zinc fingers and homeoboxes protein 1; homeobox do | 99.6 | |
| 1lfb_A | 99 | Liver transcription factor (LFB1); transcription r | 99.59 | |
| 1x2m_A | 64 | LAG1 longevity assurance homolog 6; homeobox domai | 99.57 | |
| 3l1p_A | 155 | POU domain, class 5, transcription factor 1; POU, | 99.57 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 99.57 | |
| 2da6_A | 102 | Hepatocyte nuclear factor 1-beta; homeobox domain, | 99.56 | |
| 2l9r_A | 69 | Homeobox protein NKX-3.1; structural genomics, nor | 99.56 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 99.55 | |
| 3k2a_A | 67 | Homeobox protein MEIS2; homeobox domain, DNA-bindi | 99.47 | |
| 2da7_A | 71 | Zinc finger homeobox protein 1B; homeobox domain, | 99.39 | |
| 1ic8_A | 194 | Hepatocyte nuclear factor 1-alpha; transcription r | 99.39 | |
| 2h8r_A | 221 | Hepatocyte nuclear factor 1-beta; trasncription fa | 99.36 | |
| 1mh3_A | 421 | Maltose binding-A1 homeodomain protein chimera; MA | 99.28 | |
| 2lk2_A | 89 | Homeobox protein TGIF1; NESG, structural genomics, | 99.26 | |
| 2nzz_A | 37 | Penetratin conjugated GAS (374-394) peptide; confo | 98.24 | |
| 2ys9_A | 70 | Homeobox and leucine zipper protein homez; homeodo | 96.18 |
| >1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
Probab=99.77 E-value=3e-19 Score=129.13 Aligned_cols=58 Identities=16% Similarity=0.332 Sum_probs=55.2
Q ss_pred cCCCCCCCccCCHHHHHHHHHHHhh----CCCCCHHHHHHHHHHhCCCccccccccccccCC
Q 029009 143 DGVNARKKLRLTKEQSALLEESFKQ----HSTLNPKQKQALARQLNLRPRQVEVWFQNRRAR 200 (200)
Q Consensus 143 ~~k~rr~Rt~ft~~Ql~~Le~~F~~----~~~Ps~~~r~~LA~~lgLs~rqVqvWFQNRRaK 200 (200)
..++||.|+.|+.+|+..||..|+. ++||+..+|++||..|||+++||+|||||||+|
T Consensus 14 ~~~~rR~Rt~ft~~Ql~~Le~~f~~~~~~~~yp~~~~r~~La~~lgL~~~~VkvWFqNrRaK 75 (80)
T 1wh5_A 14 GGIRKRHRTKFTAEQKERMLALAERIGWRIQRQDDEVIQRFCQETGVPRQVLKVWLHNNKHS 75 (80)
T ss_dssp CCCSCCCSCCCCHHHHHHHHHHHHHHTSCCCTTTHHHHHHHHHHSCCCHHHHHHHHHHHSSS
T ss_pred CCCCCCCCccCCHHHHHHHHHHHHhccCcCCCcCHHHHHHHHHHhCCCcccccCCccccCcC
Confidence 3567888999999999999999999 999999999999999999999999999999997
|
| >2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A | Back alignment and structure |
|---|
| >2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} | Back alignment and structure |
|---|
| >2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A | Back alignment and structure |
|---|
| >1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* | Back alignment and structure |
|---|
| >1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B | Back alignment and structure |
|---|
| >2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* | Back alignment and structure |
|---|
| >1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A | Back alignment and structure |
|---|
| >1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P | Back alignment and structure |
|---|
| >1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* | Back alignment and structure |
|---|
| >2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* | Back alignment and structure |
|---|
| >2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P | Back alignment and structure |
|---|
| >2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A | Back alignment and structure |
|---|
| >1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A | Back alignment and structure |
|---|
| >2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A | Back alignment and structure |
|---|
| >2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A | Back alignment and structure |
|---|
| >2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 200 | ||||
| d1x2na1 | 62 | a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H | 5e-16 | |
| d2e1oa1 | 57 | a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo | 8e-16 | |
| d1bw5a_ | 66 | a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { | 3e-15 | |
| d1x2ma1 | 52 | a.4.1.1 (A:8-59) Lag1 longevity assurance homolog | 4e-15 | |
| d1p7ia_ | 53 | a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel | 4e-15 | |
| d2craa1 | 58 | a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( | 7e-15 | |
| d1k61a_ | 60 | a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast | 9e-15 | |
| d2cqxa1 | 59 | a.4.1.1 (A:8-66) LAG1 longevity assurance homolog | 2e-14 | |
| d1pufa_ | 77 | a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m | 2e-14 | |
| d2cuea1 | 68 | a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H | 3e-14 | |
| d1b72a_ | 88 | a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo | 6e-14 | |
| d1le8a_ | 53 | a.4.1.1 (A:) Mating type protein A1 Homeodomain {B | 7e-14 | |
| d9anta_ | 56 | a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila | 1e-13 | |
| d1jgga_ | 57 | a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( | 2e-13 | |
| d1au7a1 | 58 | a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra | 3e-13 | |
| d1ig7a_ | 58 | a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu | 4e-13 | |
| d1pufb_ | 73 | a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 | 6e-13 | |
| d1fjla_ | 65 | a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila | 7e-13 | |
| d1uhsa_ | 72 | a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse | 8e-13 | |
| d1ftta_ | 68 | a.4.1.1 (A:) Thyroid transcription factor 1 homeod | 8e-13 | |
| d1yz8p1 | 60 | a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo | 2e-12 | |
| d1s7ea1 | 50 | a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M | 2e-12 | |
| d1zq3p1 | 67 | a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl | 2e-12 | |
| d1wh7a_ | 80 | a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha | 9e-12 | |
| d1ocpa_ | 67 | a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus | 3e-11 | |
| d1vnda_ | 77 | a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi | 5e-11 | |
| d1wi3a_ | 71 | a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom | 5e-11 | |
| d2ecba1 | 76 | a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote | 7e-11 | |
| d1e3oc1 | 57 | a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( | 1e-09 | |
| d2ecca1 | 76 | a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H | 1e-08 | |
| d2cufa1 | 82 | a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM | 9e-08 | |
| d1lfba_ | 78 | a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN | 2e-07 |
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: Homeobox protein pknox1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 67.1 bits (164), Expect = 5e-16
Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 3/56 (5%)
Query: 148 RKKLRLTKEQSALLEESFKQHST---LNPKQKQALARQLNLRPRQVEVWFQNRRAR 200
K+ L K + ++ QH +K+ +A Q NL QV WF N R R
Sbjct: 4 NKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRR 59
|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 | Back information, alignment and structure |
|---|
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 200 | |||
| d1p7ia_ | 53 | Engrailed Homeodomain {Drosophila melanogaster [Ta | 99.79 | |
| d2craa1 | 58 | Homeobox protein hox-b13 {Human (Homo sapiens) [Ta | 99.78 | |
| d1vnda_ | 77 | VND/NK-2 protein {Fruit fly (Drosophila melanogast | 99.76 | |
| d1ig7a_ | 58 | Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 | 99.76 | |
| d2e1oa1 | 57 | Homeobox protein prh {Human (Homo sapiens) [TaxId: | 99.75 | |
| d1pufa_ | 77 | Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax | 99.75 | |
| d1jgga_ | 57 | Even-skipped homeodomain {Fruit fly (Drosophila me | 99.75 | |
| d9anta_ | 56 | Antennapedia Homeodomain {Drosophila melanogaster | 99.74 | |
| d1zq3p1 | 67 | Homeotic bicoid protein {Fruit fly (Drosophila mel | 99.74 | |
| d1fjla_ | 65 | Paired protein {Fruit fly (Drosophila melanogaster | 99.73 | |
| d1ftta_ | 68 | Thyroid transcription factor 1 homeodomain {Rat (R | 99.72 | |
| d1le8a_ | 53 | Mating type protein A1 Homeodomain {Baker's yeast | 99.71 | |
| d1b72a_ | 88 | Homeobox protein hox-b1 {Human (Homo sapiens) [Tax | 99.71 | |
| d2cuea1 | 68 | Paired box protein pax6 {Human (Homo sapiens) [Tax | 99.71 | |
| d1ocpa_ | 67 | Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId | 99.71 | |
| d1bw5a_ | 66 | Insulin gene enhancer protein isl-1 {Rat (Rattus n | 99.71 | |
| d1wi3a_ | 71 | DNA-binding protein SATB2 {Human (Homo sapiens) [T | 99.7 | |
| d1uhsa_ | 72 | Homeodomain-only protein, Hop {Mouse (Mus musculus | 99.7 | |
| d1yz8p1 | 60 | Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: | 99.7 | |
| d1wh7a_ | 80 | ZF-HD homeobox protein At4g24660 {Thale cress (Ara | 99.69 | |
| d1au7a1 | 58 | Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta | 99.68 | |
| d1s7ea1 | 50 | Hepatocyte nuclear factor 6 {Mouse (Mus musculus) | 99.68 | |
| d2cufa1 | 82 | Homeobox-containing protein 1, HMBOX1 (Flj21616) { | 99.65 | |
| d1e3oc1 | 57 | Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId | 99.65 | |
| d2ecba1 | 76 | Zinc fingers and homeoboxes protein 1, ZHX1 {Human | 99.62 | |
| d1pufb_ | 73 | pbx1 {Human (Homo sapiens) [TaxId: 9606]} | 99.59 | |
| d2ecca1 | 76 | Homeobox-leucine zipper protein Homez {Human (Homo | 99.59 | |
| d1x2ma1 | 52 | Lag1 longevity assurance homolog 6, LASS6 {Mouse ( | 99.57 | |
| d2cqxa1 | 59 | LAG1 longevity assurance homolog 5, LASS5 {Mouse ( | 99.54 | |
| d1x2na1 | 62 | Homeobox protein pknox1 {Human (Homo sapiens) [Tax | 99.53 | |
| d1lfba_ | 78 | Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat | 99.53 | |
| d1k61a_ | 60 | mat alpha2 Homeodomain {Baker's yeast (Saccharomyc | 99.53 | |
| d1hlva1 | 66 | DNA-binding domain of centromere binding protein B | 82.68 |
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: Engrailed Homeodomain species: Drosophila melanogaster [TaxId: 7227]
Probab=99.79 E-value=1.1e-20 Score=125.56 Aligned_cols=53 Identities=34% Similarity=0.641 Sum_probs=51.5
Q ss_pred CCCccCCHHHHHHHHHHHhhCCCCCHHHHHHHHHHhCCCccccccccccccCC
Q 029009 148 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRAR 200 (200)
Q Consensus 148 r~Rt~ft~~Ql~~Le~~F~~~~~Ps~~~r~~LA~~lgLs~rqVqvWFQNRRaK 200 (200)
|+|+.|+..|+..||..|+.++||+..+|.+||..+||+++||+|||||||+|
T Consensus 1 R~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~lgL~~~qV~vWFqNrRaK 53 (53)
T d1p7ia_ 1 RPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNARAK 53 (53)
T ss_dssp CCCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHTCCHHHHHHHHHHHHHC
T ss_pred CCCccCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHhCCChHHhhhcccccCCC
Confidence 57899999999999999999999999999999999999999999999999997
|
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|