Citrus Sinensis ID: 029022

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200

MGEENKEEQKKEEAKKEKKEEEKKEEETPEIVLKVDMHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSGRKVELISPLPKPPPPDADDQEKKEQQKVEKKEEPPAAITVVLNVRMHCEACAQGLRKRIRKIQGIYFHWHSHFPLILQIYYSLNLMCCYYCRCGVCGNQPSQWPGNCKRCS

cccccccHHHHHHHHHHHHHHHHccccccEEEEEEEcccHHHHHHHHHHHcccccEEEEEEEccccEEEEEEccccHHHHHHHHHHHHcccEEEccccccccccccccHHHHHHHHHcccccccccHHHcccccccHHHHHHHHHHHHcccccEEEEEccccccEEEEEEcccHHHHHHHHHcccccccccccccccccc

ccccccHccccHHccccccccccccccccEEEEEEEEccHHHHHHHHHHHHcccccEEEEEEccccEEEEEccEccHHHHHHHHHHHccccEEEEccccccccccccccccccccccccccccccEEEEEEEEEccHHHHHHHHHHHHHHHccccEEEcccHHHHHEEHcccccEEEEEEEccccccccccccccccccc

MGEENKEEQKKEEAKKEKKEEekkeeetpeiVLKVDMHCEACARKVARALKgfegvdditadskASKVVVkgktadpiKVCERLQkksgrkvelisplpkppppdaddqEKKEQQKvekkeeppaAITVVLNVRMHCEACAQGLRKRIRKIQGIYFHWHSHFPLILQIYYSLNLMccyycrcgvcgnqpsqwpgnckrcs

mgeenkeeqkkeeakkekkeeekkeeetpeivlkvdMHCEACARKVARALKgfegvdditadskaskvvvkgktadpikvcerlqkksgrkvelisplpkppppdaddQEKKEQqkvekkeeppaAITVVLNVRMHCEACAQGLRKRIRKIQGIYFHWHSHFPLILQIYYSLNLMCCYYCRCGVCGnqpsqwpgnckrcs

MGeenkeeqkkeeakkekkeeekkeeeTPEIVLKVDMHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSGRKVELISplpkppppdaddqekkeqqkvekkeeppaaITVVLNVRMHCEACAQGLRKRIRKIQGIYFHWHSHFPLILQIYYSLNLMCCYYCRCGVCGNQPSQWPGNCKRCS

******************************IVLKVDMHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVC********************************************AITVVLNVRMHCEACAQGLRKRIRKIQGIYFHWHSHFPLILQIYYSLNLMCCYYCRCGVCGNQ************

*******************************VLKVDMHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSGRKVELISPLPKP******************KEEPPAAITVVLNVRMHCEACAQGLRKRIRKIQGIYFHWHSHFPLILQIYYSLNLMCCYYCRCGVCGN*PSQW*GNCK***

*****************************EIVLKVDMHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSGRKVELISPLPKPP********************PPAAITVVLNVRMHCEACAQGLRKRIRKIQGIYFHWHSHFPLILQIYYSLNLMCCYYCRCGVCGNQPSQWPGNCKRCS

**************************ETPEIVLKVDMHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSGRKVELISPLP***********************PPAAITVVLNVRMHCEACAQGLRKRIRKIQGIYFHWHSHFPLILQIYYSLNLMCCYYCRCGVCGNQPSQWPGNC****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxPEIVLKVDMHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSGRKVELISPLPKPPPPDADDQEKKEQQKVEKKEEPPAAITVVLNVRMHCEACAQGLRKRIRKIQGIYFHWHSHFPLILQIYYSLNLMCCYYCRCGVCGNQPSQWPGNCKRCS

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		200	2.2.26 [Sep-21-2011]
Q9SZN7		153	Heavy metal-associated is	no	no	0.38	0.496	0.428	1e-08

>sp\|Q9SZN7\|HIP26_ARATH Heavy metal-associated isoprenylated plant protein 26 OS=Arabidopsis thaliana GN=HIPP26 PE=1 SV=1	Back alignment and function desciption

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 48/77 (62%), Gaps = 1/77 (1%)

Query: 23 KKEEETPEIVLKVDMHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCE 82
          KK ++   + +KV M CE C RKV R+++G +GV  +T + KA KV V G   DP KV  
Sbjct: 20 KKRKQLQTVEIKVKMDCEGCERKVRRSVEGMKGVSSVTLEPKAHKVTVVG-YVDPNKVVA 78

Query: 83 RLQKKSGRKVELISPLP 99
          R+  ++G+KVEL   +P
Sbjct: 79 RMSHRTGKKVELWPYVP 95

Heavy-metal-binding protein. Binds lead, cadmium and copper. May be involved in heavy-metal transport.
Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		200
224139462		267	predicted protein [Populus trichocarpa]	0.6	0.449	0.763	1e-46
224089579		261	predicted protein [Populus trichocarpa]	0.625	0.478	0.761	1e-40
147838471		271	hypothetical protein VITISV_038964 [Viti	0.625	0.461	0.585	4e-39
449479514		300	PREDICTED: uncharacterized protein LOC10	0.765	0.51	0.610	1e-38
449434040		300	PREDICTED: uncharacterized protein LOC10	0.765	0.51	0.610	1e-38
356532758		267	PREDICTED: uncharacterized protein LOC10	0.615	0.460	0.782	7e-37
356532760		259	PREDICTED: uncharacterized protein LOC10	0.615	0.474	0.782	8e-37
356555759		267	PREDICTED: uncharacterized protein LOC10	0.615	0.460	0.774	1e-36
388502808		224	unknown [Medicago truncatula]	0.625	0.558	0.714	4e-36
351723703		262	uncharacterized protein LOC100527827 [Gl	0.765	0.583	0.746	4e-36

>gi\|224139462\|ref\|XP_002323124.1\| predicted protein [Populus trichocarpa] gi\|222867754\|gb\|EEF04885.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 112/131 (85%), Gaps = 11/131 (8%)

Query: 29  PEIVLKVDMHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKS 88
           PEIVLKVDMHCEACARKVARALKGFEGV+++T DSKASKVVVKGK ADPIKVCERL+KK+
Sbjct: 29  PEIVLKVDMHCEACARKVARALKGFEGVEEVTTDSKASKVVVKGKKADPIKVCERLRKKN 88

Query: 89  GRKVELISPLPKPPPPDADDQEKKEQQKV-----EKKEEPPAAITVVLNVRMHCEACAQG 143
           GRKVELISPLPKPP      +E KE+ K      EKK+EPP  +TVVLNVRMHCEACAQ 
Sbjct: 89  GRKVELISPLPKPP------EENKEENKDPPKEEEKKDEPPPVVTVVLNVRMHCEACAQS 142

Query: 144 LRKRIRKIQGI 154
           L+KRIRKI+G+
Sbjct: 143 LQKRIRKIKGV 153

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224089579\|ref\|XP_002308765.1\| predicted protein [Populus trichocarpa] gi\|222854741\|gb\|EEE92288.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|147838471\|emb\|CAN69857.1\| hypothetical protein VITISV_038964 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449479514\|ref\|XP_004155621.1\| PREDICTED: uncharacterized protein LOC101226864 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449434040\|ref\|XP_004134804.1\| PREDICTED: uncharacterized protein LOC101208608 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356532758\|ref\|XP_003534938.1\| PREDICTED: uncharacterized protein LOC100807490 isoform 1 [Glycine max]	Back alignment and taxonomy information

>gi\|356532760\|ref\|XP_003534939.1\| PREDICTED: uncharacterized protein LOC100807490 isoform 2 [Glycine max]	Back alignment and taxonomy information

>gi\|356555759\|ref\|XP_003546197.1\| PREDICTED: uncharacterized protein LOC100776967 [Glycine max]	Back alignment and taxonomy information

>gi\|388502808\|gb\|AFK39470.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

>gi\|351723703\|ref\|NP_001238056.1\| uncharacterized protein LOC100527827 [Glycine max] gi\|255633318\|gb\|ACU17016.1\| unknown [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		200
TAIR\|locus:2163300		290	AT5G50740 [Arabidopsis thalian	0.335	0.231	0.701	1.4e-29
TAIR\|locus:2167366		355	FP3 "farnesylated protein 3" [	0.335	0.188	0.641	2.4e-27
TAIR\|locus:2075497		246	AT3G02960 "AT3G02960" [Arabido	0.335	0.272	0.522	1.7e-20
TAIR\|locus:2057951		386	AT2G36950 [Arabidopsis thalian	0.31	0.160	0.539	3.9e-19
TAIR\|locus:2142614		392	AT5G03380 [Arabidopsis thalian	0.325	0.165	0.439	8.8e-17
TAIR\|locus:2153969		319	AT5G24580 "AT5G24580" [Arabido	0.335	0.210	0.352	2e-16
TAIR\|locus:2046183		245	AT2G28090 [Arabidopsis thalian	0.6	0.489	0.32	2.6e-15
TAIR\|locus:2018768		287	AT1G29000 [Arabidopsis thalian	0.615	0.428	0.288	1.1e-10
TAIR\|locus:2121199		153	FP6 "farnesylated protein 6" [	0.315	0.411	0.468	1.2e-10
TAIR\|locus:2089870		136	AT3G21490 "AT3G21490" [Arabido	0.325	0.477	0.409	1.5e-10

TAIR\|locus:2163300 AT5G50740 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 248 (92.4 bits), Expect = 1.4e-29, Sum P(2) = 1.4e-29
 Identities = 47/67 (70%), Positives = 57/67 (85%)

Query:    30 EIVLKVDMHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSG 89
             EIVLK+ MHCE CA+K+ R LKGFEGV+D+T D K SKVVVKG+ ADP+KV +RLQ+KS 
Sbjct:    35 EIVLKIFMHCEGCAKKIHRCLKGFEGVEDVTTDCKTSKVVVKGEKADPLKVLQRLQRKSH 94

Query:    90 RKVELIS 96
             R+VELIS
Sbjct:    95 RQVELIS 101

GO:0005634 "nucleus" evidence=ISM

GO:0005737 "cytoplasm" evidence=ISM

GO:0005886 "plasma membrane" evidence=ISM

GO:0030001 "metal ion transport" evidence=IEA

GO:0046872 "metal ion binding" evidence=IEA;ISS

TAIR\|locus:2167366 FP3 "farnesylated protein 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2075497 AT3G02960 "AT3G02960" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2057951 AT2G36950 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2142614 AT5G03380 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2153969 AT5G24580 "AT5G24580" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2046183 AT2G28090 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2018768 AT1G29000 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2121199 FP6 "farnesylated protein 6" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2089870 AT3G21490 "AT3G21490" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	estExt_fgenesh4_pg.C_LG_XVI0018	hypothetical protein (268 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		200
cd00371		63	cd00371, HMA, Heavy-metal-associated domain (HMA)	4e-10
pfam00403		62	pfam00403, HMA, Heavy-metal-associated domain	8e-09
PLN02957		238	PLN02957, PLN02957, copper, zinc superoxide dismut	1e-05
COG2217		713	COG2217, ZntA, Cation transport ATPase [Inorganic	7e-04
COG2608		71	COG2608, CopZ, Copper chaperone [Inorganic ion tra	0.003

>gnl\|CDD\|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones	Back alignment and domain information

 Score = 53.4 bits (129), Expect = 4e-10
 Identities = 15/63 (23%), Positives = 26/63 (41%), Gaps = 1/63 (1%)

Query: 32 VLKVD-MHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSGR 90
           L V+ M C  C  K+ +AL+   GV+ +  D +  K  V+       +      + +G 
Sbjct: 1  ELSVEGMTCAGCVSKIEKALEKLPGVESVEVDLETGKATVEYDPEVSPEELLEAIEDAGY 60

Query: 91 KVE 93
          K  
Sbjct: 61 KAR 63

HMA domain contains two cysteine residues that are important in binding and transfer of metal ions, such as copper, cadmium, cobalt and zinc. In the case of copper, stoichiometry of binding is one Cu+ ion per binding domain. Repeats of the HMA domain in copper chaperone has been associated with Menkes/Wilson disease due to binding of multiple copper ions. Length = 63

>gnl\|CDD\|215902 pfam00403, HMA, Heavy-metal-associated domain	Back alignment and domain information

>gnl\|CDD\|215516 PLN02957, PLN02957, copper, zinc superoxide dismutase	Back alignment and domain information

>gnl\|CDD\|225127 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|225328 COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		200
KOG0207		951	consensus Cation transport ATPase [Inorganic ion t	99.56
KOG0207		951	consensus Cation transport ATPase [Inorganic ion t	99.53
PRK10671		834	copA copper exporting ATPase; Provisional	99.42
PF00403		62	HMA: Heavy-metal-associated domain; InterPro: IPR0	99.31
PF00403		62	HMA: Heavy-metal-associated domain; InterPro: IPR0	99.21
COG2608		71	CopZ Copper chaperone [Inorganic ion transport and	99.09
COG2608		71	CopZ Copper chaperone [Inorganic ion transport and	99.08
KOG1603		73	consensus Copper chaperone [Inorganic ion transpor	98.6
KOG4656		247	consensus Copper chaperone for superoxide dismutas	98.5
COG2217		713	ZntA Cation transport ATPase [Inorganic ion transp	98.46
KOG1603		73	consensus Copper chaperone [Inorganic ion transpor	97.98
TIGR00003		68	copper ion binding protein. This model describes a	97.95
PLN02957		238	copper, zinc superoxide dismutase	97.83
KOG4656		247	consensus Copper chaperone for superoxide dismutas	97.79
PLN02957		238	copper, zinc superoxide dismutase	97.62
COG2217		713	ZntA Cation transport ATPase [Inorganic ion transp	97.61
PRK10671		834	copA copper exporting ATPase; Provisional	97.5
PRK11033		741	zntA zinc/cadmium/mercury/lead-transporting ATPase	97.35
TIGR00003		68	copper ion binding protein. This model describes a	97.07
PRK11033		741	zntA zinc/cadmium/mercury/lead-transporting ATPase	95.75
PRK14054		172	methionine sulfoxide reductase A; Provisional	94.44
TIGR02052		92	MerP mercuric transport protein periplasmic compon	93.35
PRK05528		156	methionine sulfoxide reductase A; Provisional	93.34
cd00371		63	HMA Heavy-metal-associated domain (HMA) is a conse	93.06
PRK00058		213	methionine sulfoxide reductase A; Provisional	92.51
PRK13014		186	methionine sulfoxide reductase A; Provisional	92.36
PF01625		155	PMSR: Peptide methionine sulfoxide reductase; Inte	91.47
PRK05550		283	bifunctional methionine sulfoxide reductase B/A pr	88.56
TIGR00401		149	msrA methionine-S-sulfoxide reductase. This model	88.35
PRK13748		561	putative mercuric reductase; Provisional	88.29
COG0225		174	MsrA Peptide methionine sulfoxide reductase [Postt	87.57
KOG1635		191	consensus Peptide methionine sulfoxide reductase [	84.6

>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

Probab=99.56  E-value=2e-14  Score=135.86  Aligned_cols=116  Identities=22%  Similarity=0.376  Sum_probs=103.2

Q ss_pred             eccCHhHHHHHHHHHhcCCCccEEEeecCCceeEeeCC-CCChHHHHHHHHhhcCCeeeecCCCCCCCCCCCCchhHHhh
Q 029022           36 DMHCEACARKVARALKGFEGVDDITADSKASKVVVKGK-TADPIKVCERLQKKSGRKVELISPLPKPPPPDADDQEKKEQ  114 (200)
Q Consensus        36 ~M~C~~Ca~~Ie~~L~~l~GV~~v~v~l~~~~~~V~~~-~~~~~~i~~~i~~~~G~~a~~~~~~~~~~~~~~~~~~~~~~  114 (200)
                      +|+|..|+..|+.+++..+||.++.+++..+++.|.++ ..+++.|.+.|+ ++||++.+.+....              
T Consensus         2 gmtc~ac~~si~~~~~~~~g~~~i~vsl~~~~~~v~~~~~~~~~~i~~~ie-d~gf~~~~~~~~~~--------------   66 (951)
T KOG0207|consen    2 GMTCSACSNSIEKAISRKPGVQKIEVSLAQKRANVSYDNIVSPESIKETIE-DMGFEASLLSDSEI--------------   66 (951)
T ss_pred             CccHHHHhhhHHHHHhcCCCceeEEEEeccccceEEEeeccCHHHHHHHhh-cccceeeecccCcc--------------
Confidence            49999999999999999999999999999999999873 578999999999 89999987643211              


Q ss_pred             hhhcccCCCCcceEEEEEe-eccChhHHHHHHHHHhccCCeeEEEeecCCcEEEEEEcCCeee
Q 029022          115 QKVEKKEEPPAAITVVLNV-RMHCEACAQGLRKRIRKIQGIYFHWHSHFPLILQIYYSLNLMC  176 (200)
Q Consensus       115 ~~~~~~~~~~~~~~~~l~I-gM~CasCa~~IE~aL~~~~GV~~a~Vnlat~~a~V~ydp~~~~  176 (200)
                                ...+..|.| ||+|++|++.||+.|++..||.++.|.+...++.|.|||..+-
T Consensus        67 ----------~~~~~~l~v~GmtC~scv~~i~~~l~~~~gv~~~~val~~~~~~v~~dp~v~s  119 (951)
T KOG0207|consen   67 ----------TASKCYLSVNGMTCASCVATIERNLRKIEGVESAVVALSASKAEVIYDPAVTS  119 (951)
T ss_pred             ----------ccceeEEEecCceeHHHHHHHHHHhhccCCcceEEEEeeccceeEEECCcccC
Confidence                      123678999 8999999999999999999999999999999999999998764

>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK10671 copA copper exporting ATPase; Provisional	Back alignment and domain information

>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures	Back alignment and domain information

>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures	Back alignment and domain information

>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00003 copper ion binding protein	Back alignment and domain information

>PLN02957 copper, zinc superoxide dismutase	Back alignment and domain information

>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PLN02957 copper, zinc superoxide dismutase	Back alignment and domain information

>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK10671 copA copper exporting ATPase; Provisional	Back alignment and domain information

>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional	Back alignment and domain information

>TIGR00003 copper ion binding protein	Back alignment and domain information

>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional	Back alignment and domain information

>PRK14054 methionine sulfoxide reductase A; Provisional	Back alignment and domain information

>TIGR02052 MerP mercuric transport protein periplasmic component	Back alignment and domain information

>PRK05528 methionine sulfoxide reductase A; Provisional	Back alignment and domain information

>cd00371 HMA Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones	Back alignment and domain information

>PRK00058 methionine sulfoxide reductase A; Provisional	Back alignment and domain information

>PRK13014 methionine sulfoxide reductase A; Provisional	Back alignment and domain information

>PF01625 PMSR: Peptide methionine sulfoxide reductase; InterPro: IPR002569 Peptide methionine sulphoxide reductase (Msr) reverses the inactivation of many proteins due to the oxidation of critical methionine residues by reducing methionine sulphoxide, Met(O), to methionine []	Back alignment and domain information

>PRK05550 bifunctional methionine sulfoxide reductase B/A protein; Provisional	Back alignment and domain information

>TIGR00401 msrA methionine-S-sulfoxide reductase	Back alignment and domain information

>PRK13748 putative mercuric reductase; Provisional	Back alignment and domain information

>COG0225 MsrA Peptide methionine sulfoxide reductase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1635 consensus Peptide methionine sulfoxide reductase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		200
2crl_A		98	Copper chaperone for superoxide dismutase; SOD1, f	1e-16
2crl_A		98	Copper chaperone for superoxide dismutase; SOD1, f	5e-05
1qup_A		222	Superoxide dismutase 1 copper chaperone; two domai	2e-15
2rop_A		202	Copper-transporting ATPase 2; wilson protein, mobi	5e-12
3iwl_A		68	Copper transport protein ATOX1; beta-alpha-beta-BE	1e-11
1jk9_B		249	CCS, copper chaperone for superoxide dismutase; pr	2e-11
1cc8_A		73	Protein (metallochaperone ATX1); copper transport,	1e-10
2ew9_A		149	Copper-transporting ATPase 2; copper trafficking,	2e-08
1p6t_A		151	Potential copper-transporting ATPase; COPA, P-type	3e-07
2k2p_A		85	Uncharacterized protein ATU1203; putative metal-bi	8e-07
2kkh_A		95	Putative heavy metal transporter; zinc transport,	2e-06
2xmm_A		64	SSR2857 protein, ATX1; metal transport, copper hom	6e-06
2roe_A		66	Heavy metal binding protein; NMR {Thermus thermoph	2e-05
2qif_A		69	Copper chaperone COPZ; tetranuclear Cu(I) cluster;	2e-05
2l3m_A		71	Copper-ION-binding protein; structural genomics, c	4e-05
3j09_A		723	COPA, copper-exporting P-type ATPase A; copper tra	5e-05
1yg0_A		66	COP associated protein; open-faced beta-sandwich,	6e-05
1kvi_A		79	Copper-transporting ATPase 1; menkes, Cu-protein,	2e-04
2g9o_A		90	Copper-transporting ATPase 1; menkes disease, solu	2e-04
1osd_A		72	MERP, hypothetical protein MERP; mercury resistanc	3e-04
3fry_A		73	Probable copper-exporting P-type ATPase A; transpo	4e-04
1aw0_A		72	Menkes copper-transporting ATPase; copper-binding	4e-04
3cjk_B		75	Copper-transporting ATPase 1; HAH1, ATP7B, menkes	5e-04
2ofg_X		111	Zinc-transporting ATPase; ferredoxin-like fold, be	7e-04

>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98	Back alignment and structure

 Score = 71.0 bits (174), Expect = 1e-16
 Identities = 18/76 (23%), Positives = 33/76 (43%), Gaps = 2/76 (2%)

Query: 21 EEKKEEETPEIVLKVDMHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKV 80
          +   +     +   V M C++C   V ++L+G  GV D+    +   V+V   T    +V
Sbjct: 11 DSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHT-TLPSQEV 69

Query: 81 CERLQKKSGRKVELIS 96
             L+  +GR+  L  
Sbjct: 70 QALLE-GTGRQAVLKG 84

PyMOL of 2crl

>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98	Back alignment and structure

>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222	Back alignment and structure

>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202	Back alignment and structure

>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68	Back alignment and structure

>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249	Back alignment and structure

>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73	Back alignment and structure

>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149	Back alignment and structure

>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151	Back alignment and structure

>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Length = 85	Back alignment and structure

>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Length = 95	Back alignment and structure

>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Length = 64	Back alignment and structure

>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66	Back alignment and structure

>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69	Back alignment and structure

>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71	Back alignment and structure

>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 723	Back alignment and structure

>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Length = 66	Back alignment and structure

>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Length = 79	Back alignment and structure

>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Length = 90	Back alignment and structure

>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Length = 72	Back alignment and structure

>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Length = 73	Back alignment and structure

>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Length = 72	Back alignment and structure

>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Length = 75	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		200
2ew9_A		149	Copper-transporting ATPase 2; copper trafficking,	99.87
1p6t_A		151	Potential copper-transporting ATPase; COPA, P-type	99.83
2rop_A		202	Copper-transporting ATPase 2; wilson protein, mobi	99.8
3iwl_A		68	Copper transport protein ATOX1; beta-alpha-beta-BE	99.32
3dxs_X		74	Copper-transporting ATPase RAN1; CXXC motif, ferre	99.31
4a4j_A		69	Pacszia, cation-transporting ATPase PACS; hydrolas	99.23
4a4j_A		69	Pacszia, cation-transporting ATPase PACS; hydrolas	99.22
3dxs_X		74	Copper-transporting ATPase RAN1; CXXC motif, ferre	99.19
1cc8_A		73	Protein (metallochaperone ATX1); copper transport,	99.16
2g9o_A		90	Copper-transporting ATPase 1; menkes disease, solu	99.16
3fry_A		73	Probable copper-exporting P-type ATPase A; transpo	99.15
3iwl_A		68	Copper transport protein ATOX1; beta-alpha-beta-BE	99.15
2l3m_A		71	Copper-ION-binding protein; structural genomics, c	99.13
1mwy_A		73	ZNTA; open-faced beta-sandwich fold, beta-alpha-be	99.13
1osd_A		72	MERP, hypothetical protein MERP; mercury resistanc	99.12
3cjk_B		75	Copper-transporting ATPase 1; HAH1, ATP7B, menkes	99.11
2xmw_A		71	PACS-N, cation-transporting ATPase PACS; hydrolase	99.11
2qif_A		69	Copper chaperone COPZ; tetranuclear Cu(I) cluster;	99.11
3fry_A		73	Probable copper-exporting P-type ATPase A; transpo	99.1
1yg0_A		66	COP associated protein; open-faced beta-sandwich,	99.1
1aw0_A		72	Menkes copper-transporting ATPase; copper-binding	99.09
1cpz_A		68	Protein (COPZ); copper chaperone, metal transport,	99.08
2crl_A		98	Copper chaperone for superoxide dismutase; SOD1, f	99.07
1kvi_A		79	Copper-transporting ATPase 1; menkes, Cu-protein,	99.06
1yjr_A		75	Copper-transporting ATPase 1; metallochaperone, pr	99.06
1q8l_A		84	Copper-transporting ATPase 1; metal binding protei	99.06
2kt2_A		69	Mercuric reductase; nmera, MERA, HMA domain, mercu	99.05
2ofg_X		111	Zinc-transporting ATPase; ferredoxin-like fold, be	99.05
2ldi_A		71	Zinc-transporting ATPase; metal homeostasis, metal	99.04
1y3j_A		77	Copper-transporting ATPase 1; ferrodoxin-like fold	99.03
1opz_A		76	Potential copper-transporting ATPase; mutation, fo	99.03
2roe_A		66	Heavy metal binding protein; NMR {Thermus thermoph	99.01
2xmm_A		64	SSR2857 protein, ATX1; metal transport, copper hom	99.01
2aj0_A		71	Probable cadmium-transporting ATPase; ferrodoxin-l	99.01
2ofg_X		111	Zinc-transporting ATPase; ferredoxin-like fold, be	99.0
1jww_A		80	Potential copper-transporting ATPase; beta-alpha-b	98.99
2kyz_A		67	Heavy metal binding protein; structural genomics,	98.99
2k2p_A		85	Uncharacterized protein ATU1203; putative metal-bi	98.99
1fvq_A		72	Copper-transporting ATPase; APO-CCC2A, hydrolase;	98.98
2kkh_A		95	Putative heavy metal transporter; zinc transport,	98.97
1aw0_A		72	Menkes copper-transporting ATPase; copper-binding	98.97
2l3m_A		71	Copper-ION-binding protein; structural genomics, c	98.96
1mwy_A		73	ZNTA; open-faced beta-sandwich fold, beta-alpha-be	98.96
1cc8_A		73	Protein (metallochaperone ATX1); copper transport,	98.94
2xmw_A		71	PACS-N, cation-transporting ATPase PACS; hydrolase	98.94
2g9o_A		90	Copper-transporting ATPase 1; menkes disease, solu	98.91
2xmm_A		64	SSR2857 protein, ATX1; metal transport, copper hom	98.91
2qif_A		69	Copper chaperone COPZ; tetranuclear Cu(I) cluster;	98.9
3cjk_B		75	Copper-transporting ATPase 1; HAH1, ATP7B, menkes	98.9
1osd_A		72	MERP, hypothetical protein MERP; mercury resistanc	98.89
2kt2_A		69	Mercuric reductase; nmera, MERA, HMA domain, mercu	98.89
1cpz_A		68	Protein (COPZ); copper chaperone, metal transport,	98.88
1y3j_A		77	Copper-transporting ATPase 1; ferrodoxin-like fold	98.88
2k2p_A		85	Uncharacterized protein ATU1203; putative metal-bi	98.86
1kvi_A		79	Copper-transporting ATPase 1; menkes, Cu-protein,	98.86
2kkh_A		95	Putative heavy metal transporter; zinc transport,	98.85
1yg0_A		66	COP associated protein; open-faced beta-sandwich,	98.84
2ldi_A		71	Zinc-transporting ATPase; metal homeostasis, metal	98.84
1q8l_A		84	Copper-transporting ATPase 1; metal binding protei	98.84
2roe_A		66	Heavy metal binding protein; NMR {Thermus thermoph	98.83
1fvq_A		72	Copper-transporting ATPase; APO-CCC2A, hydrolase;	98.83
1opz_A		76	Potential copper-transporting ATPase; mutation, fo	98.82
2kyz_A		67	Heavy metal binding protein; structural genomics,	98.81
2crl_A		98	Copper chaperone for superoxide dismutase; SOD1, f	98.79
1yjr_A		75	Copper-transporting ATPase 1; metallochaperone, pr	98.79
2rop_A		202	Copper-transporting ATPase 2; wilson protein, mobi	98.79
2ew9_A		149	Copper-transporting ATPase 2; copper trafficking,	98.78
1jww_A		80	Potential copper-transporting ATPase; beta-alpha-b	98.76
1p6t_A		151	Potential copper-transporting ATPase; COPA, P-type	98.69
1qup_A		222	Superoxide dismutase 1 copper chaperone; two domai	98.67
1jk9_B		249	CCS, copper chaperone for superoxide dismutase; pr	98.57
2aj0_A		71	Probable cadmium-transporting ATPase; ferrodoxin-l	98.56
3j09_A		723	COPA, copper-exporting P-type ATPase A; copper tra	98.54
1qup_A		222	Superoxide dismutase 1 copper chaperone; two domai	98.39
1jk9_B		249	CCS, copper chaperone for superoxide dismutase; pr	98.25
3j09_A		723	COPA, copper-exporting P-type ATPase A; copper tra	98.11
4gwb_A		168	Peptide methionine sulfoxide reductase MSRA 3; str	93.97
1nwa_A		203	Peptide methionine sulfoxide reductase MSRA; oxido	92.54
1fvg_A		199	Peptide methionine sulfoxide reductase; oxidoreduc	92.39
3bqh_A		193	PILB, peptide methionine sulfoxide reductase MSRA/	92.36
1ff3_A		211	Peptide methionine sulfoxide reductase; alpha beta	92.18
2j89_A		261	Methionine sulfoxide reductase A; MSRA, poplar, ox	91.32
3e0m_A		313	Peptide methionine sulfoxide reductase MSRA/MSRB 1	89.41
3pim_A		187	Peptide methionine sulfoxide reductase; methionine	86.21
1q3j_A		36	ALO3; peptide, knottin, cystine-knot, antifungal p	82.22

>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens}	Back alignment and structure

Probab=99.87  E-value=4.8e-21  Score=144.96  Aligned_cols=122  Identities=16%  Similarity=0.367  Sum_probs=103.7

Q ss_pred             cceEEEEEe-ccCHhHHHHHHHHHhcCCCccEEEeecCCceeEeeCC--CCChHHHHHHHHhhcCCeeeecCCCCCCCCC
Q 029022           28 TPEIVLKVD-MHCEACARKVARALKGFEGVDDITADSKASKVVVKGK--TADPIKVCERLQKKSGRKVELISPLPKPPPP  104 (200)
Q Consensus        28 ~~~~~~~V~-M~C~~Ca~~Ie~~L~~l~GV~~v~v~l~~~~~~V~~~--~~~~~~i~~~i~~~~G~~a~~~~~~~~~~~~  104 (200)
                      +.+..|.|. |+|++|+.+|++.|.+++||..+.+++.++++.|.++  ..+++.|..+|+ .+||.+.+.....     
T Consensus         3 ~~~~~~~v~gm~C~~C~~~ie~~l~~~~gv~~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~-~~G~~~~~~~~~~-----   76 (149)
T 2ew9_A            3 PQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQ-DLGFEAAVMEDYA-----   76 (149)
T ss_dssp             CEEEEEEEECCCSSSHHHHHHHHHHTTSSCCCEEEETTTTEEEEEECTTTCCHHHHHHHHH-HHTCEEEECSCSC-----
T ss_pred             cEEEEEEECCeecHHHHHHHHHHHhcCCCcEEEEEEecCCEEEEEEcCCCCCHHHHHHHHh-cCCCceEeecccc-----
Confidence            456789997 9999999999999999999999999999999998752  346778889998 7999876432100     


Q ss_pred             CCCchhHHhhhhhcccCCCCcceEEEEEe-eccChhHHHHHHHHHhccCCeeEEEeecCCcEEEEEEcCCe
Q 029022          105 DADDQEKKEQQKVEKKEEPPAAITVVLNV-RMHCEACAQGLRKRIRKIQGIYFHWHSHFPLILQIYYSLNL  174 (200)
Q Consensus       105 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~I-gM~CasCa~~IE~aL~~~~GV~~a~Vnlat~~a~V~ydp~~  174 (200)
                                         ....++.|.| ||+|++|+++|+++|.+++||.++.|||.+++++|.|+|..
T Consensus        77 -------------------~~~~~~~~~v~gm~C~~C~~~ie~~l~~~~gv~~~~v~~~~~~~~v~~~~~~  128 (149)
T 2ew9_A           77 -------------------GSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEI  128 (149)
T ss_dssp             -------------------CSSSEEEEEEESCCSHHHHHHHHHHHHHSSSCCEEEEETTTTEEEEECCTTT
T ss_pred             -------------------cccceeEEEEEeccCHHHHHHHHHHHhcCCCeEEEEEEcCCCEEEEEECCCC
Confidence                               0013578999 99999999999999999999999999999999999999864

PyMOL of 2ew9

>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A	Back alignment and structure

>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens}	Back alignment and structure

>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A	Back alignment and structure

>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0	Back alignment and structure

>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A	Back alignment and structure

>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A	Back alignment and structure

>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0	Back alignment and structure

>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A	Back alignment and structure

>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A	Back alignment and structure

>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus}	Back alignment and structure

>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A	Back alignment and structure

>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis}	Back alignment and structure

>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A	Back alignment and structure

>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A	Back alignment and structure

>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A	Back alignment and structure

>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A	Back alignment and structure

>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A	Back alignment and structure

>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus}	Back alignment and structure

>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori}	Back alignment and structure

>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A	Back alignment and structure

>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1	Back alignment and structure

>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A	Back alignment and structure

>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A	Back alignment and structure

>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A	Back alignment and structure

>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A	Back alignment and structure

>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP}	Back alignment and structure

>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A	Back alignment and structure

>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A	Back alignment and structure

>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A	Back alignment and structure

>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A	Back alignment and structure

>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A	Back alignment and structure

>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A	Back alignment and structure

>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima}	Back alignment and structure

>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str}	Back alignment and structure

>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B	Back alignment and structure

>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana}	Back alignment and structure

>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A	Back alignment and structure

>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis}	Back alignment and structure

>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A	Back alignment and structure

>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A	Back alignment and structure

>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A	Back alignment and structure

>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A	Back alignment and structure

>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A	Back alignment and structure

>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A	Back alignment and structure

>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A	Back alignment and structure

>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A	Back alignment and structure

>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A	Back alignment and structure

>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1	Back alignment and structure

>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A	Back alignment and structure

>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str}	Back alignment and structure

>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A	Back alignment and structure

>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana}	Back alignment and structure

>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori}	Back alignment and structure

>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP}	Back alignment and structure

>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A	Back alignment and structure

>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A	Back alignment and structure

>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B	Back alignment and structure

>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A	Back alignment and structure

>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima}	Back alignment and structure

>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A	Back alignment and structure

>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens}	Back alignment and structure

>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens}	Back alignment and structure

>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A	Back alignment and structure

>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A	Back alignment and structure

>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1	Back alignment and structure

>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1	Back alignment and structure

>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A	Back alignment and structure

>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus}	Back alignment and structure

>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1	Back alignment and structure

>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1	Back alignment and structure

>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus}	Back alignment and structure

>4gwb_A Peptide methionine sulfoxide reductase MSRA 3; structural genomics, protein structure initiative, nysgrc, R PSI-biology; 1.20A {Sinorhizobium meliloti}	Back alignment and structure

>1nwa_A Peptide methionine sulfoxide reductase MSRA; oxidoreductase, product complex, structural genomics, PSI, protein structure initiative; 1.50A {Mycobacterium tuberculosis} SCOP: d.58.28.1	Back alignment and structure

>1fvg_A Peptide methionine sulfoxide reductase; oxidoreductase; 1.60A {Bos taurus} SCOP: d.58.28.1 PDB: 1fva_A 2l90_A*	Back alignment and structure

>3bqh_A PILB, peptide methionine sulfoxide reductase MSRA/MSRB; methionine sulfoxide reductase A, oxidized form, elect transport; 1.95A {Neisseria meningitidis} PDB: 3bqe_A 3bqf_A* 3bqg_A	Back alignment and structure

>1ff3_A Peptide methionine sulfoxide reductase; alpha beta roll, PMSR, MSRA, oxidoreductase; 1.90A {Escherichia coli} SCOP: d.58.28.1 PDB: 2gt3_A 2iem_A	Back alignment and structure

>2j89_A Methionine sulfoxide reductase A; MSRA, poplar, oxidoreductase; 1.7A {Populus trichocarpa}	Back alignment and structure

>3e0m_A Peptide methionine sulfoxide reductase MSRA/MSRB 1; fusion, msrab, linker, hinge, cell membrane, membrane, multifunctional enzyme, oxidoreductase; 2.40A {Streptococcus pneumoniae}	Back alignment and structure

>3pim_A Peptide methionine sulfoxide reductase; methionine-S-sulfoxide reductase, oxidoreductase; 1.90A {Saccharomyces cerevisiae} PDB: 3pil_A 3pin_B	Back alignment and structure

>1q3j_A ALO3; peptide, knottin, cystine-knot, antifungal protein; NMR {Synthetic} SCOP: g.3.4.2	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		200
d1qupa2		72	d.58.17.1 (A:2-73) Copper chaperone for superoxide	6e-12
d1fe0a_		66	d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX	7e-10
d1kvja_		79	d.58.17.1 (A:) Menkes copper-transporting ATPase {	7e-08
d1cc8a_		72	d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX	8e-08
d2ggpb1		72	d.58.17.1 (B:1-72) Copper transporter domain ccc2a	9e-08
d2aw0a_		72	d.58.17.1 (A:) Menkes copper-transporting ATPase {	2e-07
d1p6ta1		72	d.58.17.1 (A:1-72) Potential copper-translocating	3e-07
d1osda_		72	d.58.17.1 (A:) Mercuric ion binding protein MerP {	3e-07
d1mwza_		73	d.58.17.1 (A:) Metal ion-transporting ATPase ZntA,	5e-07
d1sb6a_		64	d.58.17.1 (A:) Copper chaperone {Synechocystis sp.	2e-06
d1p6ta2		79	d.58.17.1 (A:73-151) Potential copper-translocatin	3e-06
d1cpza_		68	d.58.17.1 (A:) Copper chaperone {Enterococcus hira	1e-05
d2qifa1		69	d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt	2e-05
d1q8la_		84	d.58.17.1 (A:) Menkes copper-transporting ATPase {	0.001

>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: Copper chaperone for superoxide dismutase, N-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 56.7 bits (137), Expect = 6e-12
 Identities = 15/68 (22%), Positives = 29/68 (42%), Gaps = 2/68 (2%)

Query: 27 ETPEIVLKVDMHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQK 86
          +T E    + MHCE C   +   LK   G++ +  D +   + V+  +  P  +   L +
Sbjct: 4  DTYEATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVES-SVAPSTIINTL-R 61

Query: 87 KSGRKVEL 94
            G+   +
Sbjct: 62 NCGKDAII 69

PyMOL of d1qupa2

>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66	Back information, alignment and structure

>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79	Back information, alignment and structure

>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72	Back information, alignment and structure

>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72	Back information, alignment and structure

>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72	Back information, alignment and structure

>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72	Back information, alignment and structure

>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72	Back information, alignment and structure

>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73	Back information, alignment and structure

>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64	Back information, alignment and structure

>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79	Back information, alignment and structure

>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68	Back information, alignment and structure

>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69	Back information, alignment and structure

>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		200
d2aw0a_		72	Menkes copper-transporting ATPase {Human (Homo sap	99.5
d1qupa2		72	Copper chaperone for superoxide dismutase, N-termi	99.5
d2qifa1		69	Copper chaperone {Bacillus subtilis, CopZ [TaxId:	99.5
d1osda_		72	Mercuric ion binding protein MerP {Ralstonia metal	99.49
d2ggpb1		72	Copper transporter domain ccc2a {Baker's yeast (Sa	99.49
d1cpza_		68	Copper chaperone {Enterococcus hirae [TaxId: 1354]	99.48
d1fe0a_		66	ATX1 metallochaperone protein (ATOX1) {Human (Homo	99.48
d1p6ta1		72	Potential copper-translocating P-type ATPase CopA	99.48
d1cc8a_		72	ATX1 metallochaperone protein (ATOX1) {Baker's yea	99.47
d1q8la_		84	Menkes copper-transporting ATPase {Human (Homo sap	99.45
d1p6ta2		79	Potential copper-translocating P-type ATPase CopA	99.43
d1kvja_		79	Menkes copper-transporting ATPase {Human (Homo sap	99.42
d1mwza_		73	Metal ion-transporting ATPase ZntA, N-terminal dom	99.4
d2aw0a_		72	Menkes copper-transporting ATPase {Human (Homo sap	99.39
d2ggpb1		72	Copper transporter domain ccc2a {Baker's yeast (Sa	99.38
d1cpza_		68	Copper chaperone {Enterococcus hirae [TaxId: 1354]	99.37
d1sb6a_		64	Copper chaperone {Synechocystis sp. pcc 6803, Scat	99.37
d1osda_		72	Mercuric ion binding protein MerP {Ralstonia metal	99.36
d2qifa1		69	Copper chaperone {Bacillus subtilis, CopZ [TaxId:	99.35
d1kvja_		79	Menkes copper-transporting ATPase {Human (Homo sap	99.34
d1q8la_		84	Menkes copper-transporting ATPase {Human (Homo sap	99.3
d1mwza_		73	Metal ion-transporting ATPase ZntA, N-terminal dom	99.29
d1p6ta1		72	Potential copper-translocating P-type ATPase CopA	99.29
d1cc8a_		72	ATX1 metallochaperone protein (ATOX1) {Baker's yea	99.28
d1fe0a_		66	ATX1 metallochaperone protein (ATOX1) {Human (Homo	99.27
d1qupa2		72	Copper chaperone for superoxide dismutase, N-termi	99.27
d1p6ta2		79	Potential copper-translocating P-type ATPase CopA	99.25
d1sb6a_		64	Copper chaperone {Synechocystis sp. pcc 6803, Scat	99.24
d1nwaa_		168	Peptide methionine sulfoxide reductase {Mycobacter	93.14
d1ff3a_		211	Peptide methionine sulfoxide reductase {Escherichi	91.72
d1fvga_		192	Peptide methionine sulfoxide reductase {Cow (Bos t	90.75
d1uwda_		102	Hypothetical protein TM0487 {Thermotoga maritima [	82.03

>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: Menkes copper-transporting ATPase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.50  E-value=1.6e-14  Score=96.54  Aligned_cols=49  Identities=24%  Similarity=0.278  Sum_probs=46.1

Q ss_pred             eEEEEEe-eccChhHHHHHHHHHhccCCeeEEEeecCCcEEEEEEcCCee
Q 029022          127 ITVVLNV-RMHCEACAQGLRKRIRKIQGIYFHWHSHFPLILQIYYSLNLM  175 (200)
Q Consensus       127 ~~~~l~I-gM~CasCa~~IE~aL~~~~GV~~a~Vnlat~~a~V~ydp~~~  175 (200)
                      .+..|.| ||+|++|+++||++|.++|||.++.|||.+++++|.|||..+
T Consensus         3 ~~~~l~V~GM~C~~C~~~Ie~~l~~~~GV~~v~v~~~~~~v~v~~d~~~~   52 (72)
T d2aw0a_           3 QETVINIDGMTCNSCVQSIEGVISKKPGVKSIRVSLANSNGTVEYDPLLT   52 (72)
T ss_dssp             EEEEEEEECCCSHHHHHHHHHHHHTSTTCCCEEEETTTTEEEEEECTTTC
T ss_pred             EEEEEEECCcccHHHHHHHHHHHhcCCCcEEEEEECCCCEEEEEECCCCC
Confidence            3578999 999999999999999999999999999999999999999764

PyMOL of d2aw0a_

>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]}	Back information, alignment and structure

>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]}	Back information, alignment and structure

>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]}	Back information, alignment and structure

>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]}	Back information, alignment and structure

>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]}	Back information, alignment and structure

>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]}	Back information, alignment and structure

>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]}	Back information, alignment and structure

>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]}	Back information, alignment and structure

>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]}	Back information, alignment and structure

>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]}	Back information, alignment and structure

>d1nwaa_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ff3a_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1fvga_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1uwda_ d.52.8.2 (A:) Hypothetical protein TM0487 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure