Citrus Sinensis ID: 029022
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 200 | ||||||
| 224139462 | 267 | predicted protein [Populus trichocarpa] | 0.6 | 0.449 | 0.763 | 1e-46 | |
| 224089579 | 261 | predicted protein [Populus trichocarpa] | 0.625 | 0.478 | 0.761 | 1e-40 | |
| 147838471 | 271 | hypothetical protein VITISV_038964 [Viti | 0.625 | 0.461 | 0.585 | 4e-39 | |
| 449479514 | 300 | PREDICTED: uncharacterized protein LOC10 | 0.765 | 0.51 | 0.610 | 1e-38 | |
| 449434040 | 300 | PREDICTED: uncharacterized protein LOC10 | 0.765 | 0.51 | 0.610 | 1e-38 | |
| 356532758 | 267 | PREDICTED: uncharacterized protein LOC10 | 0.615 | 0.460 | 0.782 | 7e-37 | |
| 356532760 | 259 | PREDICTED: uncharacterized protein LOC10 | 0.615 | 0.474 | 0.782 | 8e-37 | |
| 356555759 | 267 | PREDICTED: uncharacterized protein LOC10 | 0.615 | 0.460 | 0.774 | 1e-36 | |
| 388502808 | 224 | unknown [Medicago truncatula] | 0.625 | 0.558 | 0.714 | 4e-36 | |
| 351723703 | 262 | uncharacterized protein LOC100527827 [Gl | 0.765 | 0.583 | 0.746 | 4e-36 |
| >gi|224139462|ref|XP_002323124.1| predicted protein [Populus trichocarpa] gi|222867754|gb|EEF04885.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 191 bits (486), Expect = 1e-46, Method: Compositional matrix adjust.
Identities = 100/131 (76%), Positives = 112/131 (85%), Gaps = 11/131 (8%)
Query: 29 PEIVLKVDMHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKS 88
PEIVLKVDMHCEACARKVARALKGFEGV+++T DSKASKVVVKGK ADPIKVCERL+KK+
Sbjct: 29 PEIVLKVDMHCEACARKVARALKGFEGVEEVTTDSKASKVVVKGKKADPIKVCERLRKKN 88
Query: 89 GRKVELISPLPKPPPPDADDQEKKEQQKV-----EKKEEPPAAITVVLNVRMHCEACAQG 143
GRKVELISPLPKPP +E KE+ K EKK+EPP +TVVLNVRMHCEACAQ
Sbjct: 89 GRKVELISPLPKPP------EENKEENKDPPKEEEKKDEPPPVVTVVLNVRMHCEACAQS 142
Query: 144 LRKRIRKIQGI 154
L+KRIRKI+G+
Sbjct: 143 LQKRIRKIKGV 153
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224089579|ref|XP_002308765.1| predicted protein [Populus trichocarpa] gi|222854741|gb|EEE92288.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147838471|emb|CAN69857.1| hypothetical protein VITISV_038964 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449479514|ref|XP_004155621.1| PREDICTED: uncharacterized protein LOC101226864 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449434040|ref|XP_004134804.1| PREDICTED: uncharacterized protein LOC101208608 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356532758|ref|XP_003534938.1| PREDICTED: uncharacterized protein LOC100807490 isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356532760|ref|XP_003534939.1| PREDICTED: uncharacterized protein LOC100807490 isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356555759|ref|XP_003546197.1| PREDICTED: uncharacterized protein LOC100776967 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388502808|gb|AFK39470.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|351723703|ref|NP_001238056.1| uncharacterized protein LOC100527827 [Glycine max] gi|255633318|gb|ACU17016.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 200 | ||||||
| TAIR|locus:2163300 | 290 | AT5G50740 [Arabidopsis thalian | 0.335 | 0.231 | 0.701 | 1.4e-29 | |
| TAIR|locus:2167366 | 355 | FP3 "farnesylated protein 3" [ | 0.335 | 0.188 | 0.641 | 2.4e-27 | |
| TAIR|locus:2075497 | 246 | AT3G02960 "AT3G02960" [Arabido | 0.335 | 0.272 | 0.522 | 1.7e-20 | |
| TAIR|locus:2057951 | 386 | AT2G36950 [Arabidopsis thalian | 0.31 | 0.160 | 0.539 | 3.9e-19 | |
| TAIR|locus:2142614 | 392 | AT5G03380 [Arabidopsis thalian | 0.325 | 0.165 | 0.439 | 8.8e-17 | |
| TAIR|locus:2153969 | 319 | AT5G24580 "AT5G24580" [Arabido | 0.335 | 0.210 | 0.352 | 2e-16 | |
| TAIR|locus:2046183 | 245 | AT2G28090 [Arabidopsis thalian | 0.6 | 0.489 | 0.32 | 2.6e-15 | |
| TAIR|locus:2018768 | 287 | AT1G29000 [Arabidopsis thalian | 0.615 | 0.428 | 0.288 | 1.1e-10 | |
| TAIR|locus:2121199 | 153 | FP6 "farnesylated protein 6" [ | 0.315 | 0.411 | 0.468 | 1.2e-10 | |
| TAIR|locus:2089870 | 136 | AT3G21490 "AT3G21490" [Arabido | 0.325 | 0.477 | 0.409 | 1.5e-10 |
| TAIR|locus:2163300 AT5G50740 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 248 (92.4 bits), Expect = 1.4e-29, Sum P(2) = 1.4e-29
Identities = 47/67 (70%), Positives = 57/67 (85%)
Query: 30 EIVLKVDMHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSG 89
EIVLK+ MHCE CA+K+ R LKGFEGV+D+T D K SKVVVKG+ ADP+KV +RLQ+KS
Sbjct: 35 EIVLKIFMHCEGCAKKIHRCLKGFEGVEDVTTDCKTSKVVVKGEKADPLKVLQRLQRKSH 94
Query: 90 RKVELIS 96
R+VELIS
Sbjct: 95 RQVELIS 101
|
|
| TAIR|locus:2167366 FP3 "farnesylated protein 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075497 AT3G02960 "AT3G02960" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2057951 AT2G36950 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2142614 AT5G03380 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153969 AT5G24580 "AT5G24580" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2046183 AT2G28090 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2018768 AT1G29000 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2121199 FP6 "farnesylated protein 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089870 AT3G21490 "AT3G21490" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pg.C_LG_XVI0018 | hypothetical protein (268 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 200 | |||
| cd00371 | 63 | cd00371, HMA, Heavy-metal-associated domain (HMA) | 4e-10 | |
| pfam00403 | 62 | pfam00403, HMA, Heavy-metal-associated domain | 8e-09 | |
| PLN02957 | 238 | PLN02957, PLN02957, copper, zinc superoxide dismut | 1e-05 | |
| COG2217 | 713 | COG2217, ZntA, Cation transport ATPase [Inorganic | 7e-04 | |
| COG2608 | 71 | COG2608, CopZ, Copper chaperone [Inorganic ion tra | 0.003 |
| >gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
Score = 53.4 bits (129), Expect = 4e-10
Identities = 15/63 (23%), Positives = 26/63 (41%), Gaps = 1/63 (1%)
Query: 32 VLKVD-MHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSGR 90
L V+ M C C K+ +AL+ GV+ + D + K V+ + + +G
Sbjct: 1 ELSVEGMTCAGCVSKIEKALEKLPGVESVEVDLETGKATVEYDPEVSPEELLEAIEDAGY 60
Query: 91 KVE 93
K
Sbjct: 61 KAR 63
|
HMA domain contains two cysteine residues that are important in binding and transfer of metal ions, such as copper, cadmium, cobalt and zinc. In the case of copper, stoichiometry of binding is one Cu+ ion per binding domain. Repeats of the HMA domain in copper chaperone has been associated with Menkes/Wilson disease due to binding of multiple copper ions. Length = 63 |
| >gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain | Back alignment and domain information |
|---|
| >gnl|CDD|215516 PLN02957, PLN02957, copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >gnl|CDD|225127 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|225328 COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 200 | |||
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 99.56 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 99.53 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 99.42 | |
| PF00403 | 62 | HMA: Heavy-metal-associated domain; InterPro: IPR0 | 99.31 | |
| PF00403 | 62 | HMA: Heavy-metal-associated domain; InterPro: IPR0 | 99.21 | |
| COG2608 | 71 | CopZ Copper chaperone [Inorganic ion transport and | 99.09 | |
| COG2608 | 71 | CopZ Copper chaperone [Inorganic ion transport and | 99.08 | |
| KOG1603 | 73 | consensus Copper chaperone [Inorganic ion transpor | 98.6 | |
| KOG4656 | 247 | consensus Copper chaperone for superoxide dismutas | 98.5 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 98.46 | |
| KOG1603 | 73 | consensus Copper chaperone [Inorganic ion transpor | 97.98 | |
| TIGR00003 | 68 | copper ion binding protein. This model describes a | 97.95 | |
| PLN02957 | 238 | copper, zinc superoxide dismutase | 97.83 | |
| KOG4656 | 247 | consensus Copper chaperone for superoxide dismutas | 97.79 | |
| PLN02957 | 238 | copper, zinc superoxide dismutase | 97.62 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 97.61 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 97.5 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 97.35 | |
| TIGR00003 | 68 | copper ion binding protein. This model describes a | 97.07 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 95.75 | |
| PRK14054 | 172 | methionine sulfoxide reductase A; Provisional | 94.44 | |
| TIGR02052 | 92 | MerP mercuric transport protein periplasmic compon | 93.35 | |
| PRK05528 | 156 | methionine sulfoxide reductase A; Provisional | 93.34 | |
| cd00371 | 63 | HMA Heavy-metal-associated domain (HMA) is a conse | 93.06 | |
| PRK00058 | 213 | methionine sulfoxide reductase A; Provisional | 92.51 | |
| PRK13014 | 186 | methionine sulfoxide reductase A; Provisional | 92.36 | |
| PF01625 | 155 | PMSR: Peptide methionine sulfoxide reductase; Inte | 91.47 | |
| PRK05550 | 283 | bifunctional methionine sulfoxide reductase B/A pr | 88.56 | |
| TIGR00401 | 149 | msrA methionine-S-sulfoxide reductase. This model | 88.35 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 88.29 | |
| COG0225 | 174 | MsrA Peptide methionine sulfoxide reductase [Postt | 87.57 | |
| KOG1635 | 191 | consensus Peptide methionine sulfoxide reductase [ | 84.6 |
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Probab=99.56 E-value=2e-14 Score=135.86 Aligned_cols=116 Identities=22% Similarity=0.376 Sum_probs=103.2
Q ss_pred eccCHhHHHHHHHHHhcCCCccEEEeecCCceeEeeCC-CCChHHHHHHHHhhcCCeeeecCCCCCCCCCCCCchhHHhh
Q 029022 36 DMHCEACARKVARALKGFEGVDDITADSKASKVVVKGK-TADPIKVCERLQKKSGRKVELISPLPKPPPPDADDQEKKEQ 114 (200)
Q Consensus 36 ~M~C~~Ca~~Ie~~L~~l~GV~~v~v~l~~~~~~V~~~-~~~~~~i~~~i~~~~G~~a~~~~~~~~~~~~~~~~~~~~~~ 114 (200)
+|+|..|+..|+.+++..+||.++.+++..+++.|.++ ..+++.|.+.|+ ++||++.+.+....
T Consensus 2 gmtc~ac~~si~~~~~~~~g~~~i~vsl~~~~~~v~~~~~~~~~~i~~~ie-d~gf~~~~~~~~~~-------------- 66 (951)
T KOG0207|consen 2 GMTCSACSNSIEKAISRKPGVQKIEVSLAQKRANVSYDNIVSPESIKETIE-DMGFEASLLSDSEI-------------- 66 (951)
T ss_pred CccHHHHhhhHHHHHhcCCCceeEEEEeccccceEEEeeccCHHHHHHHhh-cccceeeecccCcc--------------
Confidence 49999999999999999999999999999999999873 578999999999 89999987643211
Q ss_pred hhhcccCCCCcceEEEEEe-eccChhHHHHHHHHHhccCCeeEEEeecCCcEEEEEEcCCeee
Q 029022 115 QKVEKKEEPPAAITVVLNV-RMHCEACAQGLRKRIRKIQGIYFHWHSHFPLILQIYYSLNLMC 176 (200)
Q Consensus 115 ~~~~~~~~~~~~~~~~l~I-gM~CasCa~~IE~aL~~~~GV~~a~Vnlat~~a~V~ydp~~~~ 176 (200)
...+..|.| ||+|++|++.||+.|++..||.++.|.+...++.|.|||..+-
T Consensus 67 ----------~~~~~~l~v~GmtC~scv~~i~~~l~~~~gv~~~~val~~~~~~v~~dp~v~s 119 (951)
T KOG0207|consen 67 ----------TASKCYLSVNGMTCASCVATIERNLRKIEGVESAVVALSASKAEVIYDPAVTS 119 (951)
T ss_pred ----------ccceeEEEecCceeHHHHHHHHHHhhccCCcceEEEEeeccceeEEECCcccC
Confidence 123678999 8999999999999999999999999999999999999998764
|
|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures | Back alignment and domain information |
|---|
| >PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures | Back alignment and domain information |
|---|
| >COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00003 copper ion binding protein | Back alignment and domain information |
|---|
| >PLN02957 copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02957 copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR00003 copper ion binding protein | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK14054 methionine sulfoxide reductase A; Provisional | Back alignment and domain information |
|---|
| >TIGR02052 MerP mercuric transport protein periplasmic component | Back alignment and domain information |
|---|
| >PRK05528 methionine sulfoxide reductase A; Provisional | Back alignment and domain information |
|---|
| >cd00371 HMA Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
| >PRK00058 methionine sulfoxide reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK13014 methionine sulfoxide reductase A; Provisional | Back alignment and domain information |
|---|
| >PF01625 PMSR: Peptide methionine sulfoxide reductase; InterPro: IPR002569 Peptide methionine sulphoxide reductase (Msr) reverses the inactivation of many proteins due to the oxidation of critical methionine residues by reducing methionine sulphoxide, Met(O), to methionine [] | Back alignment and domain information |
|---|
| >PRK05550 bifunctional methionine sulfoxide reductase B/A protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00401 msrA methionine-S-sulfoxide reductase | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >COG0225 MsrA Peptide methionine sulfoxide reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1635 consensus Peptide methionine sulfoxide reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 200 | |||
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 1e-16 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 5e-05 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 2e-15 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 5e-12 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 1e-11 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 2e-11 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 1e-10 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 2e-08 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 3e-07 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 8e-07 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 2e-06 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 6e-06 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 2e-05 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 2e-05 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 4e-05 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 5e-05 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 6e-05 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 2e-04 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 2e-04 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 3e-04 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 4e-04 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 4e-04 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 5e-04 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 7e-04 |
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
Score = 71.0 bits (174), Expect = 1e-16
Identities = 18/76 (23%), Positives = 33/76 (43%), Gaps = 2/76 (2%)
Query: 21 EEKKEEETPEIVLKVDMHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKV 80
+ + + V M C++C V ++L+G GV D+ + V+V T +V
Sbjct: 11 DSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHT-TLPSQEV 69
Query: 81 CERLQKKSGRKVELIS 96
L+ +GR+ L
Sbjct: 70 QALLE-GTGRQAVLKG 84
|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73 | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Length = 85 | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Length = 95 | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Length = 64 | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66 | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71 | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 723 | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Length = 66 | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Length = 79 | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Length = 90 | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Length = 72 | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Length = 73 | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Length = 72 | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Length = 75 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 200 | |||
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 99.87 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 99.83 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 99.8 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 99.32 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 99.31 | |
| 4a4j_A | 69 | Pacszia, cation-transporting ATPase PACS; hydrolas | 99.23 | |
| 4a4j_A | 69 | Pacszia, cation-transporting ATPase PACS; hydrolas | 99.22 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 99.19 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 99.16 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 99.16 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 99.15 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 99.15 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 99.13 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 99.13 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 99.12 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 99.11 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 99.11 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 99.11 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 99.1 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 99.1 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 99.09 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 99.08 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 99.07 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 99.06 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 99.06 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 99.06 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 99.05 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 99.05 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 99.04 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 99.03 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 99.03 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 99.01 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 99.01 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 99.01 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 99.0 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 98.99 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 98.99 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 98.99 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 98.98 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 98.97 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 98.97 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 98.96 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 98.96 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 98.94 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 98.94 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 98.91 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 98.91 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 98.9 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 98.9 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 98.89 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 98.89 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 98.88 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 98.88 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 98.86 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 98.86 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 98.85 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 98.84 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 98.84 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 98.84 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 98.83 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 98.83 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 98.82 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 98.81 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 98.79 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 98.79 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 98.79 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 98.78 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 98.76 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 98.69 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 98.67 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 98.57 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 98.56 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 98.54 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 98.39 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 98.25 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 98.11 | |
| 4gwb_A | 168 | Peptide methionine sulfoxide reductase MSRA 3; str | 93.97 | |
| 1nwa_A | 203 | Peptide methionine sulfoxide reductase MSRA; oxido | 92.54 | |
| 1fvg_A | 199 | Peptide methionine sulfoxide reductase; oxidoreduc | 92.39 | |
| 3bqh_A | 193 | PILB, peptide methionine sulfoxide reductase MSRA/ | 92.36 | |
| 1ff3_A | 211 | Peptide methionine sulfoxide reductase; alpha beta | 92.18 | |
| 2j89_A | 261 | Methionine sulfoxide reductase A; MSRA, poplar, ox | 91.32 | |
| 3e0m_A | 313 | Peptide methionine sulfoxide reductase MSRA/MSRB 1 | 89.41 | |
| 3pim_A | 187 | Peptide methionine sulfoxide reductase; methionine | 86.21 | |
| 1q3j_A | 36 | ALO3; peptide, knottin, cystine-knot, antifungal p | 82.22 |
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.87 E-value=4.8e-21 Score=144.96 Aligned_cols=122 Identities=16% Similarity=0.367 Sum_probs=103.7
Q ss_pred cceEEEEEe-ccCHhHHHHHHHHHhcCCCccEEEeecCCceeEeeCC--CCChHHHHHHHHhhcCCeeeecCCCCCCCCC
Q 029022 28 TPEIVLKVD-MHCEACARKVARALKGFEGVDDITADSKASKVVVKGK--TADPIKVCERLQKKSGRKVELISPLPKPPPP 104 (200)
Q Consensus 28 ~~~~~~~V~-M~C~~Ca~~Ie~~L~~l~GV~~v~v~l~~~~~~V~~~--~~~~~~i~~~i~~~~G~~a~~~~~~~~~~~~ 104 (200)
+.+..|.|. |+|++|+.+|++.|.+++||..+.+++.++++.|.++ ..+++.|..+|+ .+||.+.+.....
T Consensus 3 ~~~~~~~v~gm~C~~C~~~ie~~l~~~~gv~~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~-~~G~~~~~~~~~~----- 76 (149)
T 2ew9_A 3 PQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQ-DLGFEAAVMEDYA----- 76 (149)
T ss_dssp CEEEEEEEECCCSSSHHHHHHHHHHTTSSCCCEEEETTTTEEEEEECTTTCCHHHHHHHHH-HHTCEEEECSCSC-----
T ss_pred cEEEEEEECCeecHHHHHHHHHHHhcCCCcEEEEEEecCCEEEEEEcCCCCCHHHHHHHHh-cCCCceEeecccc-----
Confidence 456789997 9999999999999999999999999999999998752 346778889998 7999876432100
Q ss_pred CCCchhHHhhhhhcccCCCCcceEEEEEe-eccChhHHHHHHHHHhccCCeeEEEeecCCcEEEEEEcCCe
Q 029022 105 DADDQEKKEQQKVEKKEEPPAAITVVLNV-RMHCEACAQGLRKRIRKIQGIYFHWHSHFPLILQIYYSLNL 174 (200)
Q Consensus 105 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~I-gM~CasCa~~IE~aL~~~~GV~~a~Vnlat~~a~V~ydp~~ 174 (200)
....++.|.| ||+|++|+++|+++|.+++||.++.|||.+++++|.|+|..
T Consensus 77 -------------------~~~~~~~~~v~gm~C~~C~~~ie~~l~~~~gv~~~~v~~~~~~~~v~~~~~~ 128 (149)
T 2ew9_A 77 -------------------GSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEI 128 (149)
T ss_dssp -------------------CSSSEEEEEEESCCSHHHHHHHHHHHHHSSSCCEEEEETTTTEEEEECCTTT
T ss_pred -------------------cccceeEEEEEeccCHHHHHHHHHHHhcCCCeEEEEEEcCCCEEEEEECCCC
Confidence 0013578999 99999999999999999999999999999999999999864
|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 | Back alignment and structure |
|---|
| >4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A | Back alignment and structure |
|---|
| >4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4gwb_A Peptide methionine sulfoxide reductase MSRA 3; structural genomics, protein structure initiative, nysgrc, R PSI-biology; 1.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1nwa_A Peptide methionine sulfoxide reductase MSRA; oxidoreductase, product complex, structural genomics, PSI, protein structure initiative; 1.50A {Mycobacterium tuberculosis} SCOP: d.58.28.1 | Back alignment and structure |
|---|
| >1fvg_A Peptide methionine sulfoxide reductase; oxidoreductase; 1.60A {Bos taurus} SCOP: d.58.28.1 PDB: 1fva_A 2l90_A* | Back alignment and structure |
|---|
| >3bqh_A PILB, peptide methionine sulfoxide reductase MSRA/MSRB; methionine sulfoxide reductase A, oxidized form, elect transport; 1.95A {Neisseria meningitidis} PDB: 3bqe_A 3bqf_A* 3bqg_A | Back alignment and structure |
|---|
| >1ff3_A Peptide methionine sulfoxide reductase; alpha beta roll, PMSR, MSRA, oxidoreductase; 1.90A {Escherichia coli} SCOP: d.58.28.1 PDB: 2gt3_A 2iem_A | Back alignment and structure |
|---|
| >2j89_A Methionine sulfoxide reductase A; MSRA, poplar, oxidoreductase; 1.7A {Populus trichocarpa} | Back alignment and structure |
|---|
| >3e0m_A Peptide methionine sulfoxide reductase MSRA/MSRB 1; fusion, msrab, linker, hinge, cell membrane, membrane, multifunctional enzyme, oxidoreductase; 2.40A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3pim_A Peptide methionine sulfoxide reductase; methionine-S-sulfoxide reductase, oxidoreductase; 1.90A {Saccharomyces cerevisiae} PDB: 3pil_A 3pin_B | Back alignment and structure |
|---|
| >1q3j_A ALO3; peptide, knottin, cystine-knot, antifungal protein; NMR {Synthetic} SCOP: g.3.4.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 200 | ||||
| d1qupa2 | 72 | d.58.17.1 (A:2-73) Copper chaperone for superoxide | 6e-12 | |
| d1fe0a_ | 66 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 7e-10 | |
| d1kvja_ | 79 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 7e-08 | |
| d1cc8a_ | 72 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 8e-08 | |
| d2ggpb1 | 72 | d.58.17.1 (B:1-72) Copper transporter domain ccc2a | 9e-08 | |
| d2aw0a_ | 72 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 2e-07 | |
| d1p6ta1 | 72 | d.58.17.1 (A:1-72) Potential copper-translocating | 3e-07 | |
| d1osda_ | 72 | d.58.17.1 (A:) Mercuric ion binding protein MerP { | 3e-07 | |
| d1mwza_ | 73 | d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, | 5e-07 | |
| d1sb6a_ | 64 | d.58.17.1 (A:) Copper chaperone {Synechocystis sp. | 2e-06 | |
| d1p6ta2 | 79 | d.58.17.1 (A:73-151) Potential copper-translocatin | 3e-06 | |
| d1cpza_ | 68 | d.58.17.1 (A:) Copper chaperone {Enterococcus hira | 1e-05 | |
| d2qifa1 | 69 | d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt | 2e-05 | |
| d1q8la_ | 84 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 0.001 |
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: HMA, heavy metal-associated domain family: HMA, heavy metal-associated domain domain: Copper chaperone for superoxide dismutase, N-terminal domain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 56.7 bits (137), Expect = 6e-12
Identities = 15/68 (22%), Positives = 29/68 (42%), Gaps = 2/68 (2%)
Query: 27 ETPEIVLKVDMHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQK 86
+T E + MHCE C + LK G++ + D + + V+ + P + L +
Sbjct: 4 DTYEATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVES-SVAPSTIINTL-R 61
Query: 87 KSGRKVEL 94
G+ +
Sbjct: 62 NCGKDAII 69
|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 200 | |||
| d2aw0a_ | 72 | Menkes copper-transporting ATPase {Human (Homo sap | 99.5 | |
| d1qupa2 | 72 | Copper chaperone for superoxide dismutase, N-termi | 99.5 | |
| d2qifa1 | 69 | Copper chaperone {Bacillus subtilis, CopZ [TaxId: | 99.5 | |
| d1osda_ | 72 | Mercuric ion binding protein MerP {Ralstonia metal | 99.49 | |
| d2ggpb1 | 72 | Copper transporter domain ccc2a {Baker's yeast (Sa | 99.49 | |
| d1cpza_ | 68 | Copper chaperone {Enterococcus hirae [TaxId: 1354] | 99.48 | |
| d1fe0a_ | 66 | ATX1 metallochaperone protein (ATOX1) {Human (Homo | 99.48 | |
| d1p6ta1 | 72 | Potential copper-translocating P-type ATPase CopA | 99.48 | |
| d1cc8a_ | 72 | ATX1 metallochaperone protein (ATOX1) {Baker's yea | 99.47 | |
| d1q8la_ | 84 | Menkes copper-transporting ATPase {Human (Homo sap | 99.45 | |
| d1p6ta2 | 79 | Potential copper-translocating P-type ATPase CopA | 99.43 | |
| d1kvja_ | 79 | Menkes copper-transporting ATPase {Human (Homo sap | 99.42 | |
| d1mwza_ | 73 | Metal ion-transporting ATPase ZntA, N-terminal dom | 99.4 | |
| d2aw0a_ | 72 | Menkes copper-transporting ATPase {Human (Homo sap | 99.39 | |
| d2ggpb1 | 72 | Copper transporter domain ccc2a {Baker's yeast (Sa | 99.38 | |
| d1cpza_ | 68 | Copper chaperone {Enterococcus hirae [TaxId: 1354] | 99.37 | |
| d1sb6a_ | 64 | Copper chaperone {Synechocystis sp. pcc 6803, Scat | 99.37 | |
| d1osda_ | 72 | Mercuric ion binding protein MerP {Ralstonia metal | 99.36 | |
| d2qifa1 | 69 | Copper chaperone {Bacillus subtilis, CopZ [TaxId: | 99.35 | |
| d1kvja_ | 79 | Menkes copper-transporting ATPase {Human (Homo sap | 99.34 | |
| d1q8la_ | 84 | Menkes copper-transporting ATPase {Human (Homo sap | 99.3 | |
| d1mwza_ | 73 | Metal ion-transporting ATPase ZntA, N-terminal dom | 99.29 | |
| d1p6ta1 | 72 | Potential copper-translocating P-type ATPase CopA | 99.29 | |
| d1cc8a_ | 72 | ATX1 metallochaperone protein (ATOX1) {Baker's yea | 99.28 | |
| d1fe0a_ | 66 | ATX1 metallochaperone protein (ATOX1) {Human (Homo | 99.27 | |
| d1qupa2 | 72 | Copper chaperone for superoxide dismutase, N-termi | 99.27 | |
| d1p6ta2 | 79 | Potential copper-translocating P-type ATPase CopA | 99.25 | |
| d1sb6a_ | 64 | Copper chaperone {Synechocystis sp. pcc 6803, Scat | 99.24 | |
| d1nwaa_ | 168 | Peptide methionine sulfoxide reductase {Mycobacter | 93.14 | |
| d1ff3a_ | 211 | Peptide methionine sulfoxide reductase {Escherichi | 91.72 | |
| d1fvga_ | 192 | Peptide methionine sulfoxide reductase {Cow (Bos t | 90.75 | |
| d1uwda_ | 102 | Hypothetical protein TM0487 {Thermotoga maritima [ | 82.03 |
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: HMA, heavy metal-associated domain family: HMA, heavy metal-associated domain domain: Menkes copper-transporting ATPase species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.50 E-value=1.6e-14 Score=96.54 Aligned_cols=49 Identities=24% Similarity=0.278 Sum_probs=46.1
Q ss_pred eEEEEEe-eccChhHHHHHHHHHhccCCeeEEEeecCCcEEEEEEcCCee
Q 029022 127 ITVVLNV-RMHCEACAQGLRKRIRKIQGIYFHWHSHFPLILQIYYSLNLM 175 (200)
Q Consensus 127 ~~~~l~I-gM~CasCa~~IE~aL~~~~GV~~a~Vnlat~~a~V~ydp~~~ 175 (200)
.+..|.| ||+|++|+++||++|.++|||.++.|||.+++++|.|||..+
T Consensus 3 ~~~~l~V~GM~C~~C~~~Ie~~l~~~~GV~~v~v~~~~~~v~v~~d~~~~ 52 (72)
T d2aw0a_ 3 QETVINIDGMTCNSCVQSIEGVISKKPGVKSIRVSLANSNGTVEYDPLLT 52 (72)
T ss_dssp EEEEEEEECCCSHHHHHHHHHHHHTSTTCCCEEEETTTTEEEEEECTTTC
T ss_pred EEEEEEECCcccHHHHHHHHHHHhcCCCcEEEEEECCCCEEEEEECCCCC
Confidence 3578999 999999999999999999999999999999999999999764
|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1nwaa_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ff3a_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fvga_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1uwda_ d.52.8.2 (A:) Hypothetical protein TM0487 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|