Citrus Sinensis ID: 029149

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MKVNGCDGEIRTVREKSPAPINGTGENGSRDGEELFVPPFNFAIVDNGIFRSGFPDSANFSFLKSLGLRSVIYLCPEPYPDSNLEFLKANGIQLFQFGIDGCKEPFVNIPEETIREALKVVLDERNHPLLIHCKRGKHRTGCLVGCLRKLQKWCLSSIFDEYQRFAAAKARLSDQRFIELFDISSFKRLPMSFSCSAR
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccEEEEccccccccHHHHHHHHccccEEEccccccccccccccHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHccccccccccccccccc
ccEEEccccccccccccccccccccccccccccccccccccccccccccEcccccccccHHHHHHccccEEEEEccccccHHHHHHHHHcccEEEEEEccccccccccccHHHHHHHHHHHHccccccEEEEEccccccccHHHHHHHHHccccHHHHHHHHHHHHcccHcHHHHHHHHHccHHHHHccccccccccc
mkvngcdgeirtvrekspapingtgengsrdgeelfvppfnfaivdngifrsgfpdsanfsflksLGLRSViylcpepypdsnleFLKANGIQLFqfgidgckepfvnipeETIREALKVVLdernhpllihckrgkhrtgclVGCLRKLQKWCLSSIFDEYQRFAAAKARLSDQRFIELfdissfkrlpmsfscsar
mkvngcdgeirtvrekspapingtgengsrdgEELFVPPFNFAIVDNGIFRSGFPDSANFSFLKSLGLRSVIYLCPEPYPDSNLEFLKANGIQLFQFGIDGCKEPFVNIPEETIREALKVVLDERNhpllihckrgkhrtGCLVGCLRKLQKWCLSSIFDEYQRFAAAKARLSDQRFIELfdissfkrlpmsfscsar
MKVNGCDGEIRTVREKSPAPINGTGENGSRDGEELFVPPFNFAIVDNGIFRSGFPDSANFSFLKSLGLRSVIYLCPEPYPDSNLEFLKANGIQLFQFGIDGCKEPFVNIPEETIREALKVVLDERNHPLLIHCKRGKHRTGCLVGCLRKLQKWCLSSIFDEYQRFAAAKARLSDQRFIELFDISSFKRLPMSFSCSAR
**********************************LFVPPFNFAIVDNGIFRSGFPDSANFSFLKSLGLRSVIYLCPEPYPDSNLEFLKANGIQLFQFGIDGCKEPFVNIPEETIREALKVVLDERNHPLLIHCKRGKHRTGCLVGCLRKLQKWCLSSIFDEYQRFAAAKARLSDQRFIELFDISSFKRL*********
**********************************LFVPPFNFAIVDNGIFRSGFPDSANFSFLKSLGLRSVIYLCPEPYPDSNLEFLKANGIQLFQFGIDGCKEPFVNIPEETIREALKVVLDERNHPLLIHCKRGKHRTGCLVGCLRKLQKWCLSSIFDEYQRFAAAKARLSDQRFIELFDISSFKRLPMSFS****
MKVNGCDGEIRTVREKSPAPINGTGENGSRDGEELFVPPFNFAIVDNGIFRSGFPDSANFSFLKSLGLRSVIYLCPEPYPDSNLEFLKANGIQLFQFGIDGCKEPFVNIPEETIREALKVVLDERNHPLLIHCKRGKHRTGCLVGCLRKLQKWCLSSIFDEYQRFAAAKARLSDQRFIELFDISSFKRLPMSFSCSAR
*********************************ELFVPPFNFAIVDNGIFRSGFPDSANFSFLKSLGLRSVIYLCPEPYPDSNLEFLKANGIQLFQFGIDGCKEPFVNIPEETIREALKVVLDERNHPLLIHCKRGKHRTGCLVGCLRKLQKWCLSSIFDEYQRFAAAKARLSDQRFIELFDISSFKRLPMS******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVNGCDGEIRTVREKSPAPINGTGENGSRDGEELFVPPFNFAIVDNGIFRSGFPDSANFSFLKSLGLRSVIYLCPEPYPDSNLEFLKANGIQLFQFGIDGCKEPFVNIPEETIREALKVVLDERNHPLLIHCKRGKHRTGCLVGCLRKLQKWCLSSIFDEYQRFAAAKARLSDQRFIELFDISSFKRLPMSFSCSAR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query198 2.2.26 [Sep-21-2011]
Q9ZVN4215 Probable tyrosine-protein yes no 0.843 0.776 0.815 3e-80
P53965281 Tyrosine-protein phosphat yes no 0.772 0.544 0.571 9e-48
Q1ZXG8166 Probable tyrosine-protein no no 0.737 0.879 0.458 2e-35
Q4P7L6158 Putative tyrosine-protein N/A no 0.747 0.936 0.429 1e-30
Q6CTE4210 Putative tyrosine-protein no no 0.772 0.728 0.406 3e-27
A5DE24185 Putative tyrosine-protein N/A no 0.767 0.821 0.371 4e-26
A3LW52212 Putative tyrosine-protein no no 0.782 0.731 0.364 6e-26
Q6BLZ8196 Putative tyrosine-protein no no 0.782 0.790 0.360 1e-25
Q75B37225 Putative tyrosine-protein no no 0.782 0.688 0.368 1e-24
P50946238 Putative tyrosine-protein no no 0.838 0.697 0.363 2e-24
>sp|Q9ZVN4|Y1500_ARATH Probable tyrosine-protein phosphatase At1g05000 OS=Arabidopsis thaliana GN=At1g05000 PE=1 SV=1 Back     alignment and function desciption
 Score =  297 bits (761), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 137/168 (81%), Positives = 158/168 (94%), Gaps = 1/168 (0%)

Query: 32  GEEL-FVPPFNFAIVDNGIFRSGFPDSANFSFLKSLGLRSVIYLCPEPYPDSNLEFLKAN 90
           GEEL  +PP NF++VDNGIFRSGFPDSANFSFL++LGLRS+IYLCPEPYP+SNL+FLK+N
Sbjct: 48  GEELHLIPPLNFSMVDNGIFRSGFPDSANFSFLQTLGLRSIIYLCPEPYPESNLQFLKSN 107

Query: 91  GIQLFQFGIDGCKEPFVNIPEETIREALKVVLDERNHPLLIHCKRGKHRTGCLVGCLRKL 150
           GI+LFQFGI+G KEPFVNIP+  IR ALKV+LDE+NHP+LIHCKRGKHRTGCLVGCLRKL
Sbjct: 108 GIRLFQFGIEGNKEPFVNIPDHKIRMALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKL 167

Query: 151 QKWCLSSIFDEYQRFAAAKARLSDQRFIELFDISSFKRLPMSFSCSAR 198
           QKWCL+SIFDEYQRFAAAKAR+SDQRF+E+FD+SSF  +PMSFSCS R
Sbjct: 168 QKWCLTSIFDEYQRFAAAKARVSDQRFMEIFDVSSFSHIPMSFSCSIR 215

Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|P53965|SIW14_YEAST Tyrosine-protein phosphatase SIW14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIW14 PE=1 SV=1 Back     alignment and function description
>sp|Q1ZXG8|D1060_DICDI Probable tyrosine-protein phosphatase DG1060 OS=Dictyostelium discoideum GN=DG1060 PE=3 SV=1 Back     alignment and function description
>sp|Q4P7L6|OCA1_USTMA Putative tyrosine-protein phosphatase OCA1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=OCA1 PE=3 SV=1 Back     alignment and function description
>sp|Q6CTE4|OCA1_KLULA Putative tyrosine-protein phosphatase OCA1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=OCA1 PE=3 SV=1 Back     alignment and function description
>sp|A5DE24|OCA1_PICGU Putative tyrosine-protein phosphatase OCA1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=OCA1 PE=3 SV=2 Back     alignment and function description
>sp|A3LW52|OCA1_PICST Putative tyrosine-protein phosphatase OCA1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=OCA1 PE=3 SV=1 Back     alignment and function description
>sp|Q6BLZ8|OCA1_DEBHA Putative tyrosine-protein phosphatase OCA1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=OCA1 PE=3 SV=1 Back     alignment and function description
>sp|Q75B37|OCA1_ASHGO Putative tyrosine-protein phosphatase OCA1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=OCA1 PE=3 SV=1 Back     alignment and function description
>sp|P50946|OCA1_YEAST Putative tyrosine-protein phosphatase OCA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OCA1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
359483448210 PREDICTED: probable tyrosine-protein pho 1.0 0.942 0.734 5e-84
225447153210 PREDICTED: probable tyrosine-protein pho 0.964 0.909 0.765 3e-83
356553721216 PREDICTED: probable tyrosine-protein pho 0.883 0.810 0.788 3e-80
15220383215 putative tyrosine-protein phosphatase [A 0.843 0.776 0.815 1e-78
224116022211 predicted protein [Populus trichocarpa] 0.828 0.777 0.829 4e-78
449517415229 PREDICTED: probable tyrosine-protein pho 0.873 0.755 0.770 2e-77
60459387225 tyrosine specific protein phosphatase fa 0.904 0.795 0.759 2e-77
357493185220 Tyrosine specific protein phosphatase fa 0.848 0.763 0.791 3e-77
449450894229 PREDICTED: probable tyrosine-protein pho 0.843 0.729 0.791 3e-77
356522035191 PREDICTED: probable tyrosine-protein pho 0.964 1.0 0.722 4e-77
>gi|359483448|ref|XP_002273080.2| PREDICTED: probable tyrosine-protein phosphatase At1g05000 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  315 bits (808), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 174/207 (84%), Gaps = 9/207 (4%)

Query: 1   MKVNGCDGEIRTVREKSPAP---------INGTGENGSRDGEELFVPPFNFAIVDNGIFR 51
           MK+   + EI      +P+P         + G+G+   RDGEELFVPP NFA+VD G+FR
Sbjct: 1   MKLESSEVEICAAVVGAPSPTGQISLAAMVQGSGDEDDRDGEELFVPPLNFAMVDCGVFR 60

Query: 52  SGFPDSANFSFLKSLGLRSVIYLCPEPYPDSNLEFLKANGIQLFQFGIDGCKEPFVNIPE 111
           SGFPD ANF+FL++LGLRS+IYLCPEPYP+ N+EFLK NGI+LFQFGIDGCKEPFVNIPE
Sbjct: 61  SGFPDIANFTFLQTLGLRSIIYLCPEPYPEPNIEFLKCNGIRLFQFGIDGCKEPFVNIPE 120

Query: 112 ETIREALKVVLDERNHPLLIHCKRGKHRTGCLVGCLRKLQKWCLSSIFDEYQRFAAAKAR 171
           +TIREALKVVLD+RNHPLLIHCKRGKHRTGCLVGCLRKLQ+WCLSSIFDEYQRFAAAKAR
Sbjct: 121 DTIREALKVVLDKRNHPLLIHCKRGKHRTGCLVGCLRKLQRWCLSSIFDEYQRFAAAKAR 180

Query: 172 LSDQRFIELFDISSFKRLPMSFSCSAR 198
           +SDQRF+ELFDISSFK LPM+   S R
Sbjct: 181 ISDQRFMELFDISSFKHLPMTSPPSRR 207

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225447153|ref|XP_002275443.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356553721|ref|XP_003545201.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like [Glycine max] Back     alignment and taxonomy information
>gi|15220383|ref|NP_171993.1| putative tyrosine-protein phosphatase [Arabidopsis thaliana] gi|73921030|sp|Q9ZVN4.1|Y1500_ARATH RecName: Full=Probable tyrosine-protein phosphatase At1g05000 gi|4056425|gb|AAC97999.1| ESTs gb|H36249, gb|AA59732 and gb|AA651219 come from this gene [Arabidopsis thaliana] gi|28950701|gb|AAO63274.1| At1g05000 [Arabidopsis thaliana] gi|110736114|dbj|BAF00029.1| hypothetical protein [Arabidopsis thaliana] gi|255957210|gb|ACU43461.1| PTP135 [Arabidopsis thaliana] gi|332189656|gb|AEE27777.1| putative tyrosine-protein phosphatase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224116022|ref|XP_002317187.1| predicted protein [Populus trichocarpa] gi|222860252|gb|EEE97799.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449517415|ref|XP_004165741.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|60459387|gb|AAX20039.1| tyrosine specific protein phosphatase family protein [Capsicum annuum] Back     alignment and taxonomy information
>gi|357493185|ref|XP_003616881.1| Tyrosine specific protein phosphatase family protein [Medicago truncatula] gi|355518216|gb|AES99839.1| Tyrosine specific protein phosphatase family protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449450894|ref|XP_004143197.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356522035|ref|XP_003529655.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
TAIR|locus:2136718198 PFA-DSP4 "AT4G03960" [Arabidop 0.964 0.964 0.686 1.8e-71
TAIR|locus:2059349257 PFA-DSP2 "AT2G32960" [Arabidop 0.479 0.369 0.778 5.3e-69
TAIR|locus:2075527203 PFA-DSP3 "AT3G02800" [Arabidop 0.838 0.817 0.598 2.4e-53
TAIR|locus:2171317204 PFA-DSP5 "AT5G16480" [Arabidop 0.792 0.769 0.601 1.3e-50
DICTYBASE|DDB_G0285909181 DDB_G0285909 "putative protein 0.762 0.834 0.602 2.2e-50
SGD|S000004977281 SIW14 "Tyrosine phosphatase in 0.772 0.544 0.571 3.4e-45
TAIR|locus:2205513247 PFA-DSP1 "AT1G05000" [Arabidop 0.722 0.578 0.610 1.5e-42
CGD|CAL0001689281 SIW14 [Candida albicans (taxid 0.767 0.540 0.565 1.5e-42
UNIPROTKB|Q59MU0281 SIW14 "Putative uncharacterize 0.767 0.540 0.565 1.5e-42
DICTYBASE|DDB_G0281953166 DDB_G0281953 "putative tyrosin 0.737 0.879 0.458 3.2e-33
TAIR|locus:2136718 PFA-DSP4 "AT4G03960" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 723 (259.6 bits), Expect = 1.8e-71, P = 1.8e-71
 Identities = 136/198 (68%), Positives = 160/198 (80%)

Query:     1 MKVNGCDGEIRTVREKSPAPINGTGENGSRDGEELFVPPFNFAIVDNGIFRSGFPDSANF 60
             M +    G++ TV    P   N   E G   G ELFVPP NFA+VDNGIFRSGFP+  +F
Sbjct:     1 MTLESYAGDVHTV----PQSENSMEERG---GGELFVPPLNFAMVDNGIFRSGFPEPVSF 53

Query:    61 SFLKSLGLRSVIYLCPEPYPDSNLEFLKANGIQLFQFGIDGCKEPFVNIPEETIREALKV 120
             SFL+SL L+S+IYLCPE YP+ N EF K+NGIQ+FQFGI+ CKEPFVNIP+E IREAL+V
Sbjct:    54 SFLQSLRLKSIIYLCPEAYPEVNREFAKSNGIQVFQFGIERCKEPFVNIPDEVIREALQV 113

Query:   121 VLDERNHPLLIHCKRGKHRTGCLVGCLRKLQKWCLSSIFDEYQRFAAAKARLSDQRFIEL 180
             +LD  NHP+LIHCK GKHRTGCLVGC+RK+Q+WCLSSIFDEYQRFAAAKAR+SDQRF+EL
Sbjct:   114 LLDTENHPVLIHCKSGKHRTGCLVGCVRKIQRWCLSSIFDEYQRFAAAKARISDQRFMEL 173

Query:   181 FDISSFKRLPMSFSCSAR 198
             FDIS+ K  P+SFSCS R
Sbjct:   174 FDISNLKHTPLSFSCSKR 191
GO:0004721 "phosphoprotein phosphatase activity" evidence=ISS
GO:0004725 "protein tyrosine phosphatase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0016791 "phosphatase activity" evidence=IEA
GO:1900424 "regulation of defense response to bacterium" evidence=IMP
GO:0007243 "intracellular protein kinase cascade" evidence=RCA
GO:0043407 "negative regulation of MAP kinase activity" evidence=RCA
TAIR|locus:2059349 PFA-DSP2 "AT2G32960" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075527 PFA-DSP3 "AT3G02800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171317 PFA-DSP5 "AT5G16480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0285909 DDB_G0285909 "putative protein tyrosine phosphatase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
SGD|S000004977 SIW14 "Tyrosine phosphatase involved in actin organization and endocytosis" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
TAIR|locus:2205513 PFA-DSP1 "AT1G05000" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
CGD|CAL0001689 SIW14 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59MU0 SIW14 "Putative uncharacterized protein SIW14" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0281953 DDB_G0281953 "putative tyrosine phosphatase family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ZVN4Y1500_ARATH3, ., 1, ., 3, ., 4, 80.81540.84340.7767yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.30.766
3rd Layer3.1.3.480.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
pfam03162150 pfam03162, Y_phosphatase2, Tyrosine phosphatase fa 1e-75
COG2365249 COG2365, COG2365, Protein tyrosine/serine phosphat 6e-16
COG2453180 COG2453, CDC14, Predicted protein-tyrosine phospha 5e-04
smart00195138 smart00195, DSPc, Dual specificity phosphatase, ca 0.004
>gnl|CDD|111998 pfam03162, Y_phosphatase2, Tyrosine phosphatase family Back     alignment and domain information 
 Score =  223 bits (570), Expect = 1e-75
 Identities = 82/149 (55%), Positives = 118/149 (79%)

Query: 37  VPPFNFAIVDNGIFRSGFPDSANFSFLKSLGLRSVIYLCPEPYPDSNLEFLKANGIQLFQ 96
           VPP NF+ V++G++RS +P + NFSFL+SL L+++I L PEPYP  NL+FL++  I+L+ 
Sbjct: 2   VPPLNFSPVESGLYRSSYPRANNFSFLRSLRLKTIISLSPEPYPQDNLQFLESEHIKLYH 61

Query: 97  FGIDGCKEPFVNIPEETIREALKVVLDERNHPLLIHCKRGKHRTGCLVGCLRKLQKWCLS 156
             ++G K+PFVNIP   +R ALK++L++ N+P+LIHC RGKHRTG ++GCLRKLQKW L+
Sbjct: 62  IHMEGNKDPFVNIPSHLLRRALKLLLNKDNYPVLIHCNRGKHRTGLVIGCLRKLQKWSLA 121

Query: 157 SIFDEYQRFAAAKARLSDQRFIELFDISS 185
           SI +EY+RF+ +KAR+ D+ FIE+FD   
Sbjct: 122 SILNEYRRFSGSKARIVDEEFIEIFDSEL 150

This family is closely related to the pfam00102 and pfam00782 families. Length = 150
>gnl|CDD|225240 COG2365, COG2365, Protein tyrosine/serine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 198
PF03162164 Y_phosphatase2: Tyrosine phosphatase family; Inter 100.0
KOG1572249 consensus Predicted protein tyrosine phosphatase [ 100.0
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 99.9
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 99.89
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 99.89
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 99.88
PTZ00242166 protein tyrosine phosphatase; Provisional 99.84
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 99.84
PTZ00393241 protein tyrosine phosphatase; Provisional 99.83
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 99.81
PRK12361 547 hypothetical protein; Provisional 99.78
PLN02727 986 NAD kinase 99.77
COG3453130 Uncharacterized protein conserved in bacteria [Fun 99.75
KOG1720225 consensus Protein tyrosine phosphatase CDC14 [Defe 99.68
COG2365249 Protein tyrosine/serine phosphatase [Signal transd 99.67
PF05706168 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) 99.65
KOG1719183 consensus Dual specificity phosphatase [Defense me 99.63
KOG1718198 consensus Dual specificity phosphatase [Defense me 99.62
KOG1716285 consensus Dual specificity phosphatase [Defense me 99.59
KOG1717343 consensus Dual specificity phosphatase [Defense me 99.44
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 99.37
KOG2836173 consensus Protein tyrosine phosphatase IVA1 [Signa 99.34
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 98.96
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 98.96
PF14566149 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 98.85
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 98.58
KOG2386 393 consensus mRNA capping enzyme, guanylyltransferase 98.58
KOG2283 434 consensus Clathrin coat dissociation kinase GAK/PT 98.51
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 98.48
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 98.44
PHA02740298 protein tyrosine phosphatase; Provisional 98.23
PHA02742303 protein tyrosine phosphatase; Provisional 98.22
PHA02747312 protein tyrosine phosphatase; Provisional 98.08
PHA02746323 protein tyrosine phosphatase; Provisional 98.03
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 97.99
PHA02738320 hypothetical protein; Provisional 97.97
KOG07921144 consensus Protein tyrosine phosphatase PTPMEG, con 97.94
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 97.88
COG5350172 Predicted protein tyrosine phosphatase [General fu 97.71
KOG0791374 consensus Protein tyrosine phosphatase, contains f 97.57
KOG0790600 consensus Protein tyrosine phosphatase Corkscrew a 97.4
KOG0789415 consensus Protein tyrosine phosphatase [Signal tra 97.21
KOG4228 1087 consensus Protein tyrosine phosphatase [Signal tra 96.99
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 95.91
KOG07931004 consensus Protein tyrosine phosphatase [Signal tra 95.8
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 95.73
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 95.49
PLN02160136 thiosulfate sulfurtransferase 95.03
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 94.35
PRK01415247 hypothetical protein; Validated 94.24
KOG4471 717 consensus Phosphatidylinositol 3-phosphate 3-phosp 94.06
PF04343122 DUF488: Protein of unknown function, DUF488; Inter 94.02
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 93.61
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 93.19
PF06602353 Myotub-related: Myotubularin-like phosphatase doma 93.03
PF04179451 Init_tRNA_PT: Initiator tRNA phosphoribosyl transf 92.63
PF00581113 Rhodanese: Rhodanese-like domain This Prosite entr 92.53
PRK00142314 putative rhodanese-related sulfurtransferase; Prov 91.84
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 91.5
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 91.35
KOG1530136 consensus Rhodanese-related sulfurtransferase [Ino 90.94
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 90.8
KOG1089 573 consensus Myotubularin-related phosphatidylinosito 90.54
KOG42281087 consensus Protein tyrosine phosphatase [Signal tra 90.38
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain 89.99
TIGR02990239 ectoine_eutA ectoine utilization protein EutA. Mem 89.39
PRK05600370 thiamine biosynthesis protein ThiF; Validated 88.59
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 87.88
PRK00162108 glpE thiosulfate sulfurtransferase; Validated 87.69
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 87.58
PF02126308 PTE: Phosphotriesterase family; InterPro: IPR00155 87.2
PRK09875 292 putative hydrolase; Provisional 87.13
TIGR02981101 phageshock_pspE phage shock operon rhodanese PspE. 86.93
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 86.8
COG1735316 Php Predicted metal-dependent hydrolase with the T 85.07
PF14671141 DSPn: Dual specificity protein phosphatase, N-term 84.64
cd01443113 Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda 83.94
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 83.38
COG3473238 Maleate cis-trans isomerase [Secondary metabolites 82.92
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 81.9
PRK10287104 thiosulfate:cyanide sulfurtransferase; Provisional 81.3
PRK05320257 rhodanese superfamily protein; Provisional 81.05
PRK11784 345 tRNA 2-selenouridine synthase; Provisional 80.83
>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information 
Probab=100.00  E-value=2.5e-40  Score=264.34  Aligned_cols=153  Identities=54%  Similarity=0.976  Sum_probs=110.0

Q ss_pred             eecCCCccccccceEecCCCCcccHHHHHhcCCcEEEEcCCCCCCCchHHHhHhCCceEEEeecCCCCCCCCCCCHHHHH
Q 029149           36 FVPPFNFAIVDNGIFRSGFPDSANFSFLKSLGLRSVIYLCPEPYPDSNLEFLKANGIQLFQFGIDGCKEPFVNIPEETIR  115 (198)
Q Consensus        36 ~~p~~nf~~V~~~Lyrs~~p~~~~~~~L~~~GIktVInLr~e~~~~~~~~~~~~~gI~~~~lpi~~~~~p~~~~~~~~v~  115 (198)
                      ++||.||+.|+++||||++|++.++++|+++|+||||+|++++.+....++++++||+++|+++.....+.+.+.++.+.
T Consensus         1 lvpP~nF~~V~~~vYRS~~P~~~n~~fL~~L~LKTII~L~~e~~~~~~~~f~~~~~I~l~~~~~~~~~~~~~~~~~~~v~   80 (164)
T PF03162_consen    1 LVPPLNFGMVEPGVYRSAQPTPANFPFLERLGLKTIINLRPEPPSQDFLEFAEENGIKLIHIPMSSSKDPWVPISEEQVA   80 (164)
T ss_dssp             B---TT-EEEETTEEEESS--HHHHHHHHHHT-SEEEE--SS---HHHHHHHHHTT-EEEE-------GGG----HHHHH
T ss_pred             CcCCccccCCCCCccCCCCCChhhHHHHHHCCCceEEEecCCCCCHHHHHHHhhcCceEEEeccccccCccccCCHHHHH
Confidence            47999999999999999999999999999999999999999987777788999999999999999877655667789999


Q ss_pred             HHHHHHHhcCCCcEEEEcCCCCChHHHHHHHHHHHCCCCHHHHHHHHHHhhccccCccHHHHHHHcCcccccc
Q 029149          116 EALKVVLDERNHPLLIHCKRGKHRTGCLVGCLRKLQKWCLSSIFDEYQRFAAAKARLSDQRFIELFDISSFKR  188 (198)
Q Consensus       116 ~~l~~i~~~~~~pVLVHC~aG~~RTG~v~a~yL~~~g~~~~~a~~e~~~~~~~~~~~~~~~fIe~~~~~~~~~  188 (198)
                      ++++.+++..++||||||..|++|||+|+|||+++|||+.++|++||++++.++.+..+++|||.|+.+++.-
T Consensus        81 ~aL~~ild~~n~PvLiHC~~G~~rTG~vvg~lRk~Q~W~~~~i~~Ey~~f~~~~~~~~~~~fIe~f~~~~~~~  153 (164)
T PF03162_consen   81 EALEIILDPRNYPVLIHCNHGKDRTGLVVGCLRKLQGWSLSSIFDEYRRFAGPKIRYLDEQFIELFDVELVVP  153 (164)
T ss_dssp             HHHHHHH-GGG-SEEEE-SSSSSHHHHHHHHHHHHTTB-HHHHHHHHHHHHGGG--HHHHHHHHT--------
T ss_pred             HHHHHHhCCCCCCEEEEeCCCCcchhhHHHHHHHHcCCCHHHHHHHHHHhcCCCCcHHHHHHHHhcCcceecc
Confidence            9999999988999999999999999999999999999999999999999999988889999999999997643

Consequently, maintaining an appropriate level of protein tyrosine phosphorylation is essential for many cellular functions. Tyrosine-specific protein phosphatases (PTPase; 3.1.3.48 from EC) catalyse the removal of a phosphate group attached to a tyrosine residue, using a cysteinyl-phosphate enzyme intermediate. These enzymes are key regulatory components in signal transduction pathways (such as the MAP kinase pathway) and cell cycle control, and are important in the control of cell growth, proliferation, differentiation and transformation [, ]. The PTP superfamily can be divided into four subfamilies []: (1) pTyr-specific phosphatases (2) dual specificity phosphatases (dTyr and dSer/dThr) (3) Cdc25 phosphatases (dTyr and/or dThr) (4) LMW (low molecular weight) phosphatases Based on their cellular localisation, PTPases are also classified as: Receptor-like, which are transmembrane receptors that contain PTPase domains [] Non-receptor (intracellular) PTPases [] All PTPases carry the highly conserved active site motif C(X)5R (PTP signature motif), employ a common catalytic mechanism, and share a similar core structure made of a central parallel beta-sheet with flanking alpha-helices containing a beta-loop-alpha-loop that encompasses the PTP signature motif []. Functional diversity between PTPases is endowed by regulatory domains and subunits. This entry represents protein-tyrosine phosphatases predominantly from fungi, plants and bacteria, several of which are putative enzymes. These proteins are closely related to the Y-phosphatase and DSPc families. This entry includes the PTPase SIW14 from Saccharomyces cerevisiae (Baker's yeast), which plays a role in actin filament organisation and endocytosis.; PDB: 2Q47_A 1XRI_A.
>KOG1572 consensus Predicted protein tyrosine phosphatase [Defense mechanisms] Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>COG3453 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1720 consensus Protein tyrosine phosphatase CDC14 [Defense mechanisms] Back     alignment and domain information
>COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species Back     alignment and domain information
>KOG1719 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>KOG1718 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>KOG1716 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2836 consensus Protein tyrosine phosphatase IVA1 [Signal transduction mechanisms] Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>KOG2386 consensus mRNA capping enzyme, guanylyltransferase (alpha) subunit [RNA processing and modification] Back     alignment and domain information
>KOG2283 consensus Clathrin coat dissociation kinase GAK/PTEN/Auxilin and related tyrosine phosphatases [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>KOG0792 consensus Protein tyrosine phosphatase PTPMEG, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>COG5350 Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>KOG0791 consensus Protein tyrosine phosphatase, contains fn3 domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0790 consensus Protein tyrosine phosphatase Corkscrew and related SH2 domain enzymes [Signal transduction mechanisms] Back     alignment and domain information
>KOG0789 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>KOG0793 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>KOG4471 consensus Phosphatidylinositol 3-phosphate 3-phosphatase myotubularin MTM1 [Lipid transport and metabolism; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04343 DUF488: Protein of unknown function, DUF488; InterPro: IPR007438 This family includes several proteins of uncharacterised function Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO Back     alignment and domain information
>PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 Back     alignment and domain information
>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>KOG1089 consensus Myotubularin-related phosphatidylinositol 3-phosphate 3-phosphatase MTM6 [General function prediction only] Back     alignment and domain information
>KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>TIGR02990 ectoine_eutA ectoine utilization protein EutA Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK00162 glpE thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>PF02126 PTE: Phosphotriesterase family; InterPro: IPR001559 Synonym(s): Paraoxonase, A-esterase, Aryltriphosphatase, Phosphotriesterase, Paraoxon hydrolase Bacteria such as Brevundimonas diminuta (Pseudomonas diminuta) harbour a plasmid that carries the gene for Aryldialkylphosphatase (3 Back     alignment and domain information
>PRK09875 putative hydrolase; Provisional Back     alignment and domain information
>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>COG1735 Php Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A Back     alignment and domain information
>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>COG3473 Maleate cis-trans isomerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
1xri_A151 X-ray Structure Of A Putative Phosphoprotein Phosph 2e-73
>pdb|1XRI|A Chain A, X-ray Structure Of A Putative Phosphoprotein Phosphatase From Arabidopsis Thaliana Gene At1g05000 Length = 151 Back     alignment and structure 
Iteration: 1

 Score =  271 bits (692), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 124/150 (82%), Positives = 142/150 (94%)
Query: 36  FVPPFNFAIVDNGIFRSGFPDSANFSFLKSLGLRSVIYLCPEPYPDSNLEFLKANGIQLF 95
            +PP NF+ VDNGIFRSGFPDSANFSFL++LGLRS+IYLCPEPYP+SNL+FLK+NGI+LF
Sbjct: 2   LIPPLNFSXVDNGIFRSGFPDSANFSFLQTLGLRSIIYLCPEPYPESNLQFLKSNGIRLF 61
Query: 96  QFGIDGCKEPFVNIPEETIREALKVVLDERNHPLLIHCKRGKHRTGCLVGCLRKLQKWCL 155
           QFGI+G KEPFVNIP+  IR ALKV+LDE+NHP+LIHCKRGKHRTGCLVGCLRKLQKWCL
Sbjct: 62  QFGIEGNKEPFVNIPDHKIRXALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKLQKWCL 121
Query: 156 SSIFDEYQRFAAAKARLSDQRFIELFDISS 185
           +SIFDEYQRFAAAKAR+SDQRF E+FD+SS
Sbjct: 122 TSIFDEYQRFAAAKARVSDQRFXEIFDVSS 151

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
1xri_A151 AT1G05000; structural genomics, protein structure 1e-66
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 6e-21
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 2e-12
2f46_A156 Hypothetical protein; structural genomics, joint c 2e-11
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 2e-09
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 3e-09
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 7e-08
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 3e-07
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 1e-06
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 2e-06
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 8e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 6e-04
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Length = 151 Back     alignment and structure
 Score =  200 bits (510), Expect = 1e-66
 Identities = 124/150 (82%), Positives = 144/150 (96%)

Query: 36  FVPPFNFAIVDNGIFRSGFPDSANFSFLKSLGLRSVIYLCPEPYPDSNLEFLKANGIQLF 95
            +PP NF++VDNGIFRSGFPDSANFSFL++LGLRS+IYLCPEPYP+SNL+FLK+NGI+LF
Sbjct: 2   LIPPLNFSMVDNGIFRSGFPDSANFSFLQTLGLRSIIYLCPEPYPESNLQFLKSNGIRLF 61

Query: 96  QFGIDGCKEPFVNIPEETIREALKVVLDERNHPLLIHCKRGKHRTGCLVGCLRKLQKWCL 155
           QFGI+G KEPFVNIP+  IR ALKV+LDE+NHP+LIHCKRGKHRTGCLVGCLRKLQKWCL
Sbjct: 62  QFGIEGNKEPFVNIPDHKIRMALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKLQKWCL 121

Query: 156 SSIFDEYQRFAAAKARLSDQRFIELFDISS 185
           +SIFDEYQRFAAAKAR+SDQRF+E+FD+SS
Sbjct: 122 TSIFDEYQRFAAAKARVSDQRFMEIFDVSS 151
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Length = 157 Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Length = 156 Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
1xri_A151 AT1G05000; structural genomics, protein structure 100.0
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 99.94
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 99.94
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 99.93
2f46_A156 Hypothetical protein; structural genomics, joint c 99.93
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 99.92
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 99.92
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 99.91
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 99.91
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 99.91
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 99.9
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 99.9
2oud_A177 Dual specificity protein phosphatase 10; A central 99.9
2hcm_A164 Dual specificity protein phosphatase; structural g 99.9
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 99.89
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 99.89
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 99.89
3emu_A161 Leucine rich repeat and phosphatase domain contain 99.89
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 99.89
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 99.89
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 99.89
2hxp_A155 Dual specificity protein phosphatase 9; human phos 99.88
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 99.88
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 99.88
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 99.88
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.88
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four str 99.87
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 99.86
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 99.86
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 99.86
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 99.85
2q05_A195 Late protein H1, dual specificity protein phosphat 99.85
3cm3_A176 Late protein H1, dual specificity protein phosphat 99.85
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 99.81
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 99.81
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 99.76
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 99.75
1d5r_A 324 Phosphoinositide phosphotase PTEN; C2 domain, phos 99.66
3n0a_A 361 Tyrosine-protein phosphatase auxilin; phosphatase- 99.45
3v0d_A 339 Voltage-sensor containing phosphatase; PTP, hydrol 99.45
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 99.4
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 99.16
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 99.14
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 98.78
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 98.71
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 98.67
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 98.67
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 98.66
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 98.63
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 98.62
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 98.62
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 98.62
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 98.61
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 98.6
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 98.6
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 98.6
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 98.59
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 98.59
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 98.57
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 98.56
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 98.55
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 98.54
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 98.54
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 98.52
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 98.47
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 98.47
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 98.47
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 98.46
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 98.45
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 98.45
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 98.43
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 98.4
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 98.34
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 98.33
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 98.32
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 98.28
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 98.24
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 98.22
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 98.2
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 98.19
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 98.19
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 98.02
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 98.0
1vee_A134 Proline-rich protein family; hypothetical protein, 95.14
1ohe_A 348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 93.93
1tq1_A129 AT5G66040, senescence-associated family protein; C 93.15
2yf0_A 512 Myotubularin-related protein 6; hydrolase; 2.65A { 92.8
1zsq_A 528 Myotubularin-related protein 2; protein-phospholip 92.43
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 92.02
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 91.74
1lw3_A 657 Myotubularin-related protein 2; protein-phosphate 91.37
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 91.35
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 91.28
2jtq_A85 Phage shock protein E; solution structure rhodanes 89.42
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 87.85
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 85.36
3tn4_A 360 Phosphotriesterase; lactonase, hydrolase; HET: KCX 85.22
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 84.56
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 84.18
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 82.71
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 82.34
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 82.13
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 81.44
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 80.98
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
Probab=100.00  E-value=4.3e-36  Score=232.71  Aligned_cols=150  Identities=83%  Similarity=1.477  Sum_probs=133.6

Q ss_pred             eecCCCccccccceEecCCCCcccHHHHHhcCCcEEEEcCCCCCCCchHHHhHhCCceEEEeecCCCCCCCCCCCHHHHH
Q 029149           36 FVPPFNFAIVDNGIFRSGFPDSANFSFLKSLGLRSVIYLCPEPYPDSNLEFLKANGIQLFQFGIDGCKEPFVNIPEETIR  115 (198)
Q Consensus        36 ~~p~~nf~~V~~~Lyrs~~p~~~~~~~L~~~GIktVInLr~e~~~~~~~~~~~~~gI~~~~lpi~~~~~p~~~~~~~~v~  115 (198)
                      +.||.||.+|.++||||++|++.++++|+++||++||||+++.+.....++++..|++|+++|+.+...|...++.+.+.
T Consensus         2 ~~pp~n~~~v~~~l~~s~~~~~~d~~~L~~~gi~~Vi~l~~~~e~~~~~~~~~~~gi~~~~ipi~d~~~~~~~~~~~~~~   81 (151)
T 1xri_A            2 LIPPLNFSMVDNGIFRSGFPDSANFSFLQTLGLRSIIYLCPEPYPESNLQFLKSNGIRLFQFGIEGNKEPFVNIPDHKIR   81 (151)
T ss_dssp             BCCCTTCEEEETTEEEESCCCHHHHHHHHHHTCSEEEECCSSCCCHHHHHHHHHHTCEEEECCCCCCCGGGCCCCHHHHH
T ss_pred             ccCCcCcCeeCCCeEECCCcCccCHHHHHHCCCCEEEECCCCCcChhHHHHHHhcCCeEEecccccccCccccCCHHHHH
Confidence            67999999999999999999999999999999999999999875544556777889999999999876665556677898


Q ss_pred             HHHHHHHhcCCCcEEEEcCCCCChHHHHHHHHHHHCCCCHHHHHHHHHHhhccccCccHHHHHHHcCccc
Q 029149          116 EALKVVLDERNHPLLIHCKRGKHRTGCLVGCLRKLQKWCLSSIFDEYQRFAAAKARLSDQRFIELFDISS  185 (198)
Q Consensus       116 ~~l~~i~~~~~~pVLVHC~aG~~RTG~v~a~yL~~~g~~~~~a~~e~~~~~~~~~~~~~~~fIe~~~~~~  185 (198)
                      ++++++.+..++||||||++|+||||+++|+||+.+||+.++|+++|++++..+....+++||+.|+.+.
T Consensus        82 ~~~~~i~~~~~~~vlvHC~aG~~RTg~~~a~~l~~~g~~~~~a~~~~~~~~~~~~~~~~~qfi~~~~~~~  151 (151)
T 1xri_A           82 MALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLTSIFDEYQRFAAAKARVSDQRFMEIFDVSS  151 (151)
T ss_dssp             HHHHHHHCGGGCSEEEECSSSSSHHHHHHHHHHHHTTBCHHHHHHHHHHHHGGGCCHHHHHHHHTCCCCC
T ss_pred             HHHHHHHcCCCCCEEEECCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHhcCCCccchHHHHHHHhcCCC
Confidence            8999988766899999999999999999999999999999999999999988766678999999999863
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
>2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} Back     alignment and structure
>1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Back     alignment and structure
>1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>3tn4_A Phosphotriesterase; lactonase, hydrolase; HET: KCX; 1.50A {Geobacillus kaustophilus} PDB: 3tnb_A* 3tn3_A* 3tn5_A* 3tn6_A* 3ojg_A* 3orw_A* 3f4c_A* 3f4d_A* Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 198
d1xria_151 c.45.1.1 (A:) Putative phosphatase At1g05000 {Thal 2e-55
d1vhra_178 c.45.1.1 (A:) VH1-related dual-specificity phospha 3e-10
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 1e-07
d1fpza_176 c.45.1.1 (A:) Kinase associated phosphatase (kap) 4e-07
d1d5ra2174 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase 6e-05
d1i9sa_194 c.45.1.1 (A:) mRNA capping enzyme, triphosphatase 1e-04
d1ywfa1272 c.45.1.5 (A:4-275) Phosphotyrosine protein phospha 3e-04
d1m3ga_145 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 0.001
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 0.003
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 151 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Putative phosphatase At1g05000
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score =  170 bits (432), Expect = 2e-55
 Identities = 124/150 (82%), Positives = 144/150 (96%)

Query: 36  FVPPFNFAIVDNGIFRSGFPDSANFSFLKSLGLRSVIYLCPEPYPDSNLEFLKANGIQLF 95
            +PP NF++VDNGIFRSGFPDSANFSFL++LGLRS+IYLCPEPYP+SNL+FLK+NGI+LF
Sbjct: 2   LIPPLNFSMVDNGIFRSGFPDSANFSFLQTLGLRSIIYLCPEPYPESNLQFLKSNGIRLF 61

Query: 96  QFGIDGCKEPFVNIPEETIREALKVVLDERNHPLLIHCKRGKHRTGCLVGCLRKLQKWCL 155
           QFGI+G KEPFVNIP+  IR ALKV+LDE+NHP+LIHCKRGKHRTGCLVGCLRKLQKWCL
Sbjct: 62  QFGIEGNKEPFVNIPDHKIRMALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKLQKWCL 121

Query: 156 SSIFDEYQRFAAAKARLSDQRFIELFDISS 185
           +SIFDEYQRFAAAKAR+SDQRF+E+FD+SS
Sbjct: 122 TSIFDEYQRFAAAKARVSDQRFMEIFDVSS 151
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 272 Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 100.0
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 99.9
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 99.9
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 99.85
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 99.84
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 99.84
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 99.82
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 99.81
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 99.69
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 99.56
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 99.19
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 98.62
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 98.36
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 98.3
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 98.15
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 98.12
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 98.11
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 98.11
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 98.09
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 97.99
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 97.99
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 97.98
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 97.96
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 97.77
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 94.61
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 94.53
d1yt8a1136 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 94.17
d1zsqa2 387 Myotubularin-related protein 2, C-terminal domain 93.18
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 90.85
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 90.28
d1ohea1157 Proline directed phosphatase CDC14b2 {Human (Homo 89.0
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 87.48
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 86.69
d1uara2141 Sulfurtransferase {Thermus thermophilus [TaxId: 27 86.45
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Putative phosphatase At1g05000
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=100.00  E-value=8e-40  Score=253.67  Aligned_cols=150  Identities=82%  Similarity=1.467  Sum_probs=137.5

Q ss_pred             ceecCCCccccccceEecCCCCcccHHHHHhcCCcEEEEcCCCCCCCchHHHhHhCCceEEEeecCCCCCCCCCCCHHHH
Q 029149           35 LFVPPFNFAIVDNGIFRSGFPDSANFSFLKSLGLRSVIYLCPEPYPDSNLEFLKANGIQLFQFGIDGCKEPFVNIPEETI  114 (198)
Q Consensus        35 ~~~p~~nf~~V~~~Lyrs~~p~~~~~~~L~~~GIktVInLr~e~~~~~~~~~~~~~gI~~~~lpi~~~~~p~~~~~~~~v  114 (198)
                      ++.||.||++|+++||||++|+++++++|+++|||||||||++.+.....+++++.||+|+++|+.+...+......+.+
T Consensus         1 ~~~pp~nF~~V~~~lyRs~~~t~~~~~~L~~lgIktIidLr~~~e~~~~~~~~~~~gi~~~~ip~~~~~~~~~~~~~~~~   80 (151)
T d1xria_           1 HLIPPLNFSMVDNGIFRSGFPDSANFSFLQTLGLRSIIYLCPEPYPESNLQFLKSNGIRLFQFGIEGNKEPFVNIPDHKI   80 (151)
T ss_dssp             CBCCCTTCEEEETTEEEESCCCHHHHHHHHHHTCSEEEECCSSCCCHHHHHHHHHHTCEEEECCCCCCCGGGCCCCHHHH
T ss_pred             CCCCCcccceecCCceecCCCCHHHHHHHHHCCCCEEEECCCcchhhcccchhhhcCceEeecCccccccccccccHHHH
Confidence            46899999999999999999999999999999999999999987766778888999999999999987766555567889


Q ss_pred             HHHHHHHHhcCCCcEEEEcCCCCChHHHHHHHHHHHCCCCHHHHHHHHHHhhccccCccHHHHHHHcCcc
Q 029149          115 REALKVVLDERNHPLLIHCKRGKHRTGCLVGCLRKLQKWCLSSIFDEYQRFAAAKARLSDQRFIELFDIS  184 (198)
Q Consensus       115 ~~~l~~i~~~~~~pVLVHC~aG~~RTG~v~a~yL~~~g~~~~~a~~e~~~~~~~~~~~~~~~fIe~~~~~  184 (198)
                      ..+++.+.+..++||||||++|+||||+++|+||+++||+.++|++||++++.+..+..+++|||.|+.+
T Consensus        81 ~~~~~~~~~~~~~pvlvHC~~GkdRTG~v~a~~l~~~g~~~~~i~~dy~~~~~~~~~~~~~~fiE~f~~~  150 (151)
T d1xria_          81 RMALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLTSIFDEYQRFAAAKARVSDQRFMEIFDVS  150 (151)
T ss_dssp             HHHHHHHHCGGGCSEEEECSSSSSHHHHHHHHHHHHTTBCHHHHHHHHHHHHGGGCCHHHHHHHHTCCCC
T ss_pred             HHHHHHHhcCCCCCEEEEcCCCchHHHHHHHHHHHHcCCCHHHHHHHHHHhccCcccHHHHHHHHHhCCC
Confidence            8899998888899999999999999999999999999999999999999999887777889999999975
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure