Citrus Sinensis ID: 029159
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 198 | ||||||
| 224067160 | 230 | predicted protein [Populus trichocarpa] | 0.893 | 0.769 | 0.762 | 3e-72 | |
| 255537962 | 246 | heat shock protein binding protein, puta | 0.909 | 0.731 | 0.770 | 6e-69 | |
| 224081863 | 255 | predicted protein [Populus trichocarpa] | 0.883 | 0.686 | 0.721 | 1e-68 | |
| 297813203 | 234 | hypothetical protein ARALYDRAFT_351886 [ | 0.924 | 0.782 | 0.659 | 4e-65 | |
| 356510636 | 226 | PREDICTED: uncharacterized protein LOC10 | 0.924 | 0.809 | 0.718 | 2e-63 | |
| 225458924 | 249 | PREDICTED: uncharacterized protein LOC10 | 0.934 | 0.742 | 0.753 | 1e-62 | |
| 449450314 | 244 | PREDICTED: uncharacterized protein LOC10 | 0.914 | 0.741 | 0.719 | 5e-62 | |
| 19310566 | 277 | unknown protein [Arabidopsis thaliana] | 0.883 | 0.631 | 0.648 | 1e-59 | |
| 334186393 | 230 | chaperone DnaJ-domain containing protein | 0.904 | 0.778 | 0.632 | 4e-59 | |
| 334186395 | 216 | chaperone DnaJ-domain containing protein | 0.883 | 0.810 | 0.648 | 7e-59 |
| >gi|224067160|ref|XP_002302385.1| predicted protein [Populus trichocarpa] gi|222844111|gb|EEE81658.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 276 bits (706), Expect = 3e-72, Method: Compositional matrix adjust.
Identities = 138/181 (76%), Positives = 153/181 (84%), Gaps = 4/181 (2%)
Query: 17 SLARPQSSWKGASGS--SFRSSFQEEAWKRYNRRMREEYEEEMERVERIRRMQSVFNRER 74
+L R QS+WKGA+GS SFR+ FQEEA K YNRRM+E YEEEMERVERIRRMQSVFNRER
Sbjct: 49 ALTRSQSAWKGATGSARSFRTYFQEEACKNYNRRMQEAYEEEMERVERIRRMQSVFNRER 108
Query: 75 NKYKKSYESWRQNDYDNGTYHHHFQRDDWYWKADPSYRQQRTNFRQPPRESESYSLSHHY 134
NKY + +E WR+N G YH +FQRDDWYWK D S+R+QRTNFR+ R+S SYSLSHHY
Sbjct: 109 NKYTRDHEKWRENG--PGAYHQNFQRDDWYWKTDTSFREQRTNFRRTSRDSGSYSLSHHY 166
Query: 135 SVLGLDRLRKAPYTEAEIKTAFRAKAKEFHPDQNQGNKEAAEAKFKEVMVSYEAIKQERK 194
SVLGLDR R PYTEAEIKTAFR KAKEFHPDQNQ NKEAAEAKFKEVM+SYEAIK ERK
Sbjct: 167 SVLGLDRSRTIPYTEAEIKTAFRTKAKEFHPDQNQDNKEAAEAKFKEVMISYEAIKLERK 226
Query: 195 D 195
+
Sbjct: 227 N 227
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255537962|ref|XP_002510046.1| heat shock protein binding protein, putative [Ricinus communis] gi|223550747|gb|EEF52233.1| heat shock protein binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224081863|ref|XP_002306506.1| predicted protein [Populus trichocarpa] gi|222855955|gb|EEE93502.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297813203|ref|XP_002874485.1| hypothetical protein ARALYDRAFT_351886 [Arabidopsis lyrata subsp. lyrata] gi|297320322|gb|EFH50744.1| hypothetical protein ARALYDRAFT_351886 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356510636|ref|XP_003524043.1| PREDICTED: uncharacterized protein LOC100812371 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225458924|ref|XP_002285499.1| PREDICTED: uncharacterized protein LOC100248937 [Vitis vinifera] gi|302142151|emb|CBI19354.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449450314|ref|XP_004142908.1| PREDICTED: uncharacterized protein LOC101213280 [Cucumis sativus] gi|449494391|ref|XP_004159534.1| PREDICTED: uncharacterized LOC101213280 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|19310566|gb|AAL85016.1| unknown protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|334186393|ref|NP_567329.2| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] gi|332657188|gb|AEE82588.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|334186395|ref|NP_001190686.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] gi|21689789|gb|AAM67538.1| unknown protein [Arabidopsis thaliana] gi|332657189|gb|AEE82589.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 198 | ||||||
| UNIPROTKB|F1SR79 | 325 | DNAJB2 "Uncharacterized protei | 0.272 | 0.166 | 0.5 | 1.5e-07 | |
| DICTYBASE|DDB_G0291568 | 459 | dnaja1 "DnaJ homolog subfamily | 0.277 | 0.119 | 0.473 | 1.7e-07 | |
| TIGR_CMR|CBU_1289 | 374 | CBU_1289 "chaperone protein dn | 0.232 | 0.122 | 0.531 | 2e-07 | |
| UNIPROTKB|B0CM59 | 277 | DNAJB2 "DnaJ homolog, subfamil | 0.222 | 0.158 | 0.522 | 2.9e-07 | |
| MGI|MGI:1928739 | 277 | Dnajb2 "DnaJ (Hsp40) homolog, | 0.222 | 0.158 | 0.522 | 2.9e-07 | |
| UNIPROTKB|Q58DD3 | 278 | DNAJB2 "DnaJ (Hsp40) homolog, | 0.222 | 0.158 | 0.522 | 2.9e-07 | |
| UNIPROTKB|P25686 | 324 | DNAJB2 "DnaJ homolog subfamily | 0.222 | 0.135 | 0.522 | 4.1e-07 | |
| UNIPROTKB|B0KWI7 | 324 | DNAJB2 "DnaJ homolog, subfamil | 0.222 | 0.135 | 0.522 | 4.1e-07 | |
| UNIPROTKB|P08622 | 376 | dnaJ [Escherichia coli K-12 (t | 0.227 | 0.119 | 0.5 | 5.5e-07 | |
| TIGR_CMR|SPO_0044 | 381 | SPO_0044 "chaperone protein Dn | 0.217 | 0.112 | 0.545 | 6.1e-06 |
| UNIPROTKB|F1SR79 DNAJB2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Score = 126 (49.4 bits), Expect = 1.5e-07, P = 1.5e-07
Identities = 28/56 (50%), Positives = 36/56 (64%)
Query: 139 LDRLRKAPYTEAEIKTAFRAKAKEFHPDQNQGNKEAAEAKFKEVMVSYEAIKQERK 194
LD R A T +IK A+R KA ++HPD+N NKE AE KFKEV +YE + + K
Sbjct: 8 LDVPRSA--TADDIKKAYRKKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHK 61
|
|
| DICTYBASE|DDB_G0291568 dnaja1 "DnaJ homolog subfamily A member 1" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_1289 CBU_1289 "chaperone protein dnaJ" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B0CM59 DNAJB2 "DnaJ homolog, subfamily B, member 2, isoform 1 (Predicted)" [Papio anubis (taxid:9555)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1928739 Dnajb2 "DnaJ (Hsp40) homolog, subfamily B, member 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q58DD3 DNAJB2 "DnaJ (Hsp40) homolog, subfamily B, member 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P25686 DNAJB2 "DnaJ homolog subfamily B member 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B0KWI7 DNAJB2 "DnaJ homolog, subfamily B, member 2 isoform b (Predicted)" [Callithrix jacchus (taxid:9483)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P08622 dnaJ [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_0044 SPO_0044 "chaperone protein DnaJ" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 198 | |||
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 5e-14 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 7e-13 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 2e-12 | |
| PRK14277 | 386 | PRK14277, PRK14277, chaperone protein DnaJ; Provis | 5e-12 | |
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 6e-11 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 7e-11 | |
| PRK14290 | 365 | PRK14290, PRK14290, chaperone protein DnaJ; Provis | 1e-10 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 1e-10 | |
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 3e-10 | |
| PRK14295 | 389 | PRK14295, PRK14295, chaperone protein DnaJ; Provis | 6e-10 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 1e-09 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 3e-09 | |
| PRK14301 | 373 | PRK14301, PRK14301, chaperone protein DnaJ; Provis | 3e-09 | |
| cd06257 | 55 | cd06257, DnaJ, DnaJ domain or J-domain | 6e-09 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 2e-08 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 3e-08 | |
| PRK14286 | 372 | PRK14286, PRK14286, chaperone protein DnaJ; Provis | 4e-08 | |
| PRK14294 | 366 | PRK14294, PRK14294, chaperone protein DnaJ; Provis | 7e-08 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 7e-08 | |
| PRK14282 | 369 | PRK14282, PRK14282, chaperone protein DnaJ; Provis | 8e-08 | |
| PRK14285 | 365 | PRK14285, PRK14285, chaperone protein DnaJ; Provis | 5e-07 | |
| PRK14279 | 392 | PRK14279, PRK14279, chaperone protein DnaJ; Provis | 8e-07 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 2e-06 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 4e-06 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 6e-06 | |
| PRK14293 | 374 | PRK14293, PRK14293, chaperone protein DnaJ; Provis | 7e-06 | |
| PRK14300 | 372 | PRK14300, PRK14300, chaperone protein DnaJ; Provis | 3e-05 | |
| PRK14296 | 372 | PRK14296, PRK14296, chaperone protein DnaJ; Provis | 4e-05 | |
| PRK10266 | 306 | PRK10266, PRK10266, curved DNA-binding protein Cbp | 5e-05 | |
| PRK14292 | 371 | PRK14292, PRK14292, chaperone protein DnaJ; Provis | 5e-05 | |
| PRK14298 | 377 | PRK14298, PRK14298, chaperone protein DnaJ; Provis | 1e-04 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 2e-04 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 3e-04 | |
| COG2214 | 237 | COG2214, CbpA, DnaJ-class molecular chaperone [Pos | 3e-04 | |
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 0.001 |
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
Score = 69.0 bits (170), Expect = 5e-14
Identities = 29/61 (47%), Positives = 40/61 (65%), Gaps = 5/61 (8%)
Query: 134 YSVLGLDRLRKAPYTEAEIKTAFRAKAKEFHPDQNQGNKEAAEAKFKEVMVSYEAIKQER 193
Y VLG+ R A +E EIK A+R A ++HPD+N G+KE AE KFKE+ +YE + +
Sbjct: 7 YEVLGVSR--NA--SEDEIKKAYRKLAMKYHPDRNPGDKE-AEEKFKEIKEAYEVLSDPQ 61
Query: 194 K 194
K
Sbjct: 62 K 62
|
Length = 371 |
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
| >gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 198 | |||
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 99.82 | |
| KOG0713 | 336 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.79 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 99.71 | |
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 99.69 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 99.68 | |
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 99.68 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 99.67 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 99.66 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 99.65 | |
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 99.65 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.64 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.64 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 99.63 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 99.63 | |
| KOG0716 | 279 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.63 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 99.62 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 99.62 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 99.62 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 99.62 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 99.61 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 99.61 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 99.61 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 99.61 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 99.61 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 99.6 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 99.6 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 99.6 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 99.6 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 99.6 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 99.6 | |
| KOG0691 | 296 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.6 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 99.59 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 99.59 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 99.56 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 99.56 | |
| KOG0715 | 288 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.55 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 99.55 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 99.55 | |
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 99.54 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 99.53 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 99.51 | |
| KOG0721 | 230 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.49 | |
| KOG0718 | 546 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.49 | |
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 99.49 | |
| KOG0719 | 264 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.47 | |
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 99.46 | |
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 99.43 | |
| PHA03102 | 153 | Small T antigen; Reviewed | 99.41 | |
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 99.38 | |
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 99.38 | |
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 99.37 | |
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 99.35 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 99.33 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.28 | |
| KOG0714 | 306 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.19 | |
| KOG0720 | 490 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.18 | |
| KOG0722 | 329 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.16 | |
| KOG1150 | 250 | consensus Predicted molecular chaperone (DnaJ supe | 99.15 | |
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 99.14 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.14 | |
| PHA02624 | 647 | large T antigen; Provisional | 99.03 | |
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 98.96 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 98.88 | |
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 98.65 | |
| KOG1789 | 2235 | consensus Endocytosis protein RME-8, contains DnaJ | 98.56 | |
| KOG0568 | 342 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.23 | |
| KOG0723 | 112 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.18 | |
| KOG3192 | 168 | consensus Mitochondrial J-type chaperone [Posttran | 97.55 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 97.14 | |
| KOG0431 | 453 | consensus Auxilin-like protein and related protein | 96.57 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 96.01 | |
| PF03656 | 127 | Pam16: Pam16; InterPro: IPR005341 The Pam16 protei | 95.97 | |
| PF13446 | 62 | RPT: A repeated domain in UCH-protein | 94.83 | |
| PF14687 | 112 | DUF4460: Domain of unknown function (DUF4460) | 85.51 |
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.82 E-value=8.8e-21 Score=172.32 Aligned_cols=63 Identities=41% Similarity=0.694 Sum_probs=59.0
Q ss_pred hhhhhhhhCcCCCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChHHHHHHHHHHHHHHHHccCcccccC
Q 029159 130 LSHHYSVLGLDRLRKAPYTEAEIKTAFRAKAKEFHPDQNQGNKEAAEAKFKEVMVSYEAIKQERKDMN 197 (198)
Q Consensus 130 ~~d~Y~ILGL~~~a~~~~t~~eIKkAYRkLakk~HPDk~~~~~~~A~e~Fk~In~AYevL~dp~kR~~ 197 (198)
..|||+||||+++| |.+|||+|||+||++||||+|++++ +|+++|++|++||+||+||.+|..
T Consensus 3 ~~dyYeiLGV~k~A----s~~EIKkAYRkLA~kyHPD~n~g~~-~AeeKFKEI~eAYEVLsD~eKRa~ 65 (371)
T COG0484 3 KRDYYEILGVSKDA----SEEEIKKAYRKLAKKYHPDRNPGDK-EAEEKFKEINEAYEVLSDPEKRAA 65 (371)
T ss_pred ccchhhhcCCCCCC----CHHHHHHHHHHHHHHhCCCCCCCCH-HHHHHHHHHHHHHHHhCCHHHHHH
Confidence 36899999999999 9999999999999999999999754 799999999999999999999964
|
|
| >KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] | Back alignment and domain information |
|---|
| >PF13446 RPT: A repeated domain in UCH-protein | Back alignment and domain information |
|---|
| >PF14687 DUF4460: Domain of unknown function (DUF4460) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 198 | ||||
| 1xbl_A | 107 | Nmr Structure Of The J-Domain (Residues 2-76) In Th | 2e-05 | ||
| 2lgw_A | 99 | Solution Structure Of The J Domain Of Hsj1a Length | 2e-05 | ||
| 1bq0_A | 103 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 2e-05 | ||
| 1bqz_A | 77 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 3e-05 | ||
| 2dmx_A | 92 | Solution Structure Of The J Domain Of Dnaj Homolog | 3e-04 | ||
| 2ej7_A | 82 | Solution Structure Of The Dnaj Domain Of The Human | 4e-04 |
| >pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 | Back alignment and structure |
|
| >pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 | Back alignment and structure |
| >pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 | Back alignment and structure |
| >pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 | Back alignment and structure |
| >pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 | Back alignment and structure |
| >pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 198 | |||
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 1e-14 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 6e-14 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 2e-13 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 2e-13 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 2e-13 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 5e-12 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 1e-11 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 1e-11 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 2e-11 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 4e-11 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 1e-09 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 1e-09 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 1e-09 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 2e-09 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 2e-09 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 2e-09 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 2e-09 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 3e-09 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 4e-09 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 6e-09 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 1e-08 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 4e-08 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 9e-08 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 3e-07 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 9e-07 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 2e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-05 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 1e-04 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 2e-04 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 6e-04 |
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 | Back alignment and structure |
|---|
Score = 69.6 bits (171), Expect = 1e-14
Identities = 27/102 (26%), Positives = 46/102 (45%), Gaps = 19/102 (18%)
Query: 94 YHHHFQRDDWYWKADPSYRQQRT-NFRQPPRESESYSLSHHYSVLGLDRLRKAPYTEAEI 152
+HHH + Y Q + Y++LG+ I
Sbjct: 2 HHHHHHSSGVDLGTENLYFQSNAMELKDY------------YAILGVQP--TD--DLKTI 45
Query: 153 KTAFRAKAKEFHPDQNQGNKEAAEAKFKEVMVSYEAIKQERK 194
KTA+R A+++HPD ++ N AEAKFK++ ++E +K E++
Sbjct: 46 KTAYRRLARKYHPDVSKEND--AEAKFKDLAEAWEVLKDEQR 85
|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 198 | |||
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 99.78 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 99.76 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 99.76 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 99.74 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 99.74 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 99.74 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 99.74 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 99.73 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 99.73 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 99.73 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 99.72 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 99.72 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 99.71 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 99.7 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 99.7 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 99.67 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 99.67 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 99.66 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 99.66 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.66 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 99.64 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.64 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 99.62 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.61 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 99.59 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 99.59 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 99.57 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.56 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 99.56 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 99.55 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 99.5 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 99.46 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.37 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 99.06 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.87 |
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.78 E-value=3.3e-19 Score=128.10 Aligned_cols=64 Identities=38% Similarity=0.606 Sum_probs=59.6
Q ss_pred ChhhhhhhhCcCCCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChHHHHHHHHHHHHHHHHccCccccc
Q 029159 129 SLSHHYSVLGLDRLRKAPYTEAEIKTAFRAKAKEFHPDQNQGNKEAAEAKFKEVMVSYEAIKQERKDM 196 (198)
Q Consensus 129 ~~~d~Y~ILGL~~~a~~~~t~~eIKkAYRkLakk~HPDk~~~~~~~A~e~Fk~In~AYevL~dp~kR~ 196 (198)
.+.++|+||||++++ +.++||+||++|++++|||++++..+.+.+.|+.|++||++|+||.+|.
T Consensus 7 ~~~~~y~iLgv~~~a----s~~eIk~ayr~l~~~~HPDk~~~~~~~a~~~f~~i~~Ay~~L~d~~~R~ 70 (82)
T 2ej7_A 7 GMVDYYEVLDVPRQA----SSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRD 70 (82)
T ss_dssp SSCCHHHHTTCCTTC----CHHHHHHHHHHHHTTSCTTTCSTTHHHHHHHHHHHHHHHHHHSSTTHHH
T ss_pred CCcCHHHHcCCCCCC----CHHHHHHHHHHHHHHHCcCCCCCcHHHHHHHHHHHHHHHHHHCCHHHHH
Confidence 457899999999998 9999999999999999999998877789999999999999999999875
|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 198 | ||||
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 1e-05 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 2e-04 | |
| d1fafa_ | 79 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 7e-04 |
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: Auxilin J-domain species: Cow (Bos taurus) [TaxId: 9913]
Score = 40.3 bits (94), Expect = 1e-05
Identities = 12/65 (18%), Positives = 28/65 (43%), Gaps = 6/65 (9%)
Query: 132 HHYSVLGLDRLRKAPYTEAEIKTAFRAKAKEFHPDQNQGN--KEAAEAKFKEVMVSYEAI 189
+ +G+ L T ++K +R HPD+ G ++ A+ F E+ ++
Sbjct: 34 TKWKPVGMADLV----TPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEF 89
Query: 190 KQERK 194
+ + +
Sbjct: 90 ENQGQ 94
|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 198 | |||
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 99.78 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 99.73 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 99.7 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 99.7 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 99.69 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 99.67 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 99.67 | |
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.56 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Probab=99.78 E-value=8.8e-20 Score=128.73 Aligned_cols=61 Identities=41% Similarity=0.738 Sum_probs=56.6
Q ss_pred hhhhhhhCcCCCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChHHHHHHHHHHHHHHHHccCccccc
Q 029159 131 SHHYSVLGLDRLRKAPYTEAEIKTAFRAKAKEFHPDQNQGNKEAAEAKFKEVMVSYEAIKQERKDM 196 (198)
Q Consensus 131 ~d~Y~ILGL~~~a~~~~t~~eIKkAYRkLakk~HPDk~~~~~~~A~e~Fk~In~AYevL~dp~kR~ 196 (198)
.|||+||||++++ |.++||+||++|++++|||+++++. .+++.|..|++||+||+||.+|.
T Consensus 3 ~dyY~vLgv~~~A----s~~eIk~aYr~l~~~~HPDk~~~~~-~~~~~f~~i~~Ay~vL~d~~~R~ 63 (75)
T d1xbla_ 3 QDYYEILGVSKTA----EEREIRKAYKRLAMKYHPDRNQGDK-EAEAKFKEIKEAYEVLTDSQKRA 63 (75)
T ss_dssp CCTTTTTCCSSSC----CHHHHHHHHHHHHHHTCCTTCTTTC-HHHHHHHHHHHHHHHTTSSHHHH
T ss_pred CCHHHHcCCCCCc----CHHHHHHHHHHHHhhhhhhccCCCh-HHHHHHHHHHHHHHhcCCHHHHH
Confidence 5899999999999 9999999999999999999998654 57889999999999999999875
|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|