Citrus Sinensis ID: 029159


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MFEFDSYSNGWIEYFVSLARPQSSWKGASGSSFRSSFQEEAWKRYNRRMREEYEEEMERVERIRRMQSVFNRERNKYKKSYESWRQNDYDNGTYHHHFQRDDWYWKADPSYRQQRTNFRQPPRESESYSLSHHYSVLGLDRLRKAPYTEAEIKTAFRAKAKEFHPDQNQGNKEAAEAKFKEVMVSYEAIKQERKDMNS
cccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHcccccHHHHHHccccccccccccccccHHHccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccHHccc
ccEEccccccEEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHcccccccccccccccccccccccccHHHHcccccccccccccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccHHHcccc
mfefdsysngWIEYFVSLarpqsswkgasgssfrsSFQEEAWKRYNRRMREEYEEEMERVERIRRMQSVFNRERNKYKKSYESWrqndydngtyhhhfqrddwywkadpsyrqqrtnfrqppresesyslshhysvlgldrlrkapytEAEIKTAFRAKakefhpdqnqgnKEAAEAKFKEVMVSYEAIKQERKDMNS
MFEFDSYSNGWIEYFVSLARPQSswkgasgssfrssfqeeaWKRYNRRMREEYEEEMERVERIrrmqsvfnrernkykksyESWRQNDYDNGTYHHHFQRDDWYWKADPSYRQQRTNFrqppresesyslshHYSVLGLDRLRKAPYTEAEIKTAFRAKAkefhpdqnqgnkeaAEAKFKEVMVSYEAIKQERKDMNS
MFEFDSYSNGWIEYFVSLARPQSSWKGASGSSFRSSFQEEAWKRYNrrmreeyeeemerverirrmQSVFNRERNKYKKSYESWRQNDYDNGTYHHHFQRDDWYWKADPSYRQQRTNFRQPPResesyslshhysvlGLDRLRKAPYTEAEIKTAFRAKAKEFHPDQNQGNKEAAEAKFKEVMVSYEAIKQERKDMNS
*****SYSNGWIEYFVSLA*************************************************************YESWRQNDYDNGTYHHHFQRDDWYWKAD************************HYSVLGLDRLRKAPYTEA*I**********************************************
****DSYSNGWIEYFVSL*******************QEEAWKRYNRRMREE*****ERV**IRRMQSV**R********************TYHHHFQRDDWYWKADP***********************HYSVLGLDRLRKAPYTEAEIKTAFRAKAKEFHPDQNQGNKEAAEAKFKEVMVSYEAI*********
MFEFDSYSNGWIEYFVSLARP****************QEEAWKRYNRRMRE*********ERIRRMQSVFNRERNKYKKSYESWRQNDYDNGTYHHHFQRDDWYWKADPSY*******************SHHYSVLGLDRLRKAPYTEAEIKTAFRAKAKEFHPDQNQGNKEAAEAKFKEVMVSYEAIK********
MFEFDSYSNGWIEYFVSLARP*************SSFQEEAWKRYNRRMREEYEEEMERVERIRRMQSVFNRERNKYKKSYESWRQNDYDNGTYHHHFQRDDWYWKADPSY********QPPRESESYSLSHHYSVLGLDRLRKAPYTEAEIKTAFRAKAKEFHPDQNQGNKEAAEAKFKEVMVSYEAIKQE******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFEFDSYSNGWIEYFVSLARPQSSWKGASGSSFRSSFQEEAWKRYxxxxxxxxxxxxxxxxxxxxxQSVFNRERNKYKKSYESWRQNDYDNGTYHHHFQRDDWYWKADPSYRQQRTNFRQPPRESESYSLSHHYSVLGLDRLRKAPYTEAEIKTAFRAKAKEFHPDQNQGNxxxxxxxxxxxxxxxxxxxxxRKDMNS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query198 2.2.26 [Sep-21-2011]
A3DF24 386 Chaperone protein DnaJ OS yes no 0.287 0.147 0.483 1e-07
Q6L0S6 357 Chaperone protein DnaJ OS yes no 0.287 0.159 0.467 6e-07
Q52702 384 Chaperone protein DnaJ OS yes no 0.282 0.145 0.508 7e-07
A7HZ38 385 Chaperone protein DnaJ OS yes no 0.277 0.142 0.5 1e-06
B6IZJ1 374 Chaperone protein DnaJ OS yes no 0.287 0.152 0.483 2e-06
A9KG87 375 Chaperone protein DnaJ OS yes no 0.287 0.152 0.483 2e-06
B6J7U6 375 Chaperone protein DnaJ OS yes no 0.287 0.152 0.483 2e-06
Q73XZ6 381 Chaperone protein DnaJ 1 N/A no 0.277 0.144 0.459 3e-06
B9MJZ0 388 Chaperone protein DnaJ OS yes no 0.287 0.146 0.483 6e-06
Q5E3A8 379 Chaperone protein DnaJ OS yes no 0.282 0.147 0.475 6e-06
>sp|A3DF24|DNAJ_CLOTH Chaperone protein DnaJ OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237) GN=dnaJ PE=3 SV=1 Back     alignment and function desciption
 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 5/62 (8%)

Query: 133 HYSVLGLDRLRKAPYTEAEIKTAFRAKAKEFHPDQNQGNKEAAEAKFKEVMVSYEAIKQE 192
           +Y +LG+DR      ++AEIK A+R  AK++HPD N G+K AAEAKFKE+  +YE +   
Sbjct: 7   YYEILGVDR----GASDAEIKKAYRKLAKQYHPDMNPGDK-AAEAKFKEINEAYEVLSDP 61

Query: 193 RK 194
           +K
Sbjct: 62  QK 63




Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins.
Clostridium thermocellum (strain ATCC 27405 / DSM 1237) (taxid: 203119)
>sp|Q6L0S6|DNAJ_PICTO Chaperone protein DnaJ OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q52702|DNAJ_RHOCA Chaperone protein DnaJ OS=Rhodobacter capsulatus GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|A7HZ38|DNAJ_PARL1 Chaperone protein DnaJ OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|B6IZJ1|DNAJ_COXB2 Chaperone protein DnaJ OS=Coxiella burnetii (strain CbuG_Q212) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|A9KG87|DNAJ_COXBN Chaperone protein DnaJ OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|B6J7U6|DNAJ_COXB1 Chaperone protein DnaJ OS=Coxiella burnetii (strain CbuK_Q154) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q73XZ6|DNAJ1_MYCPA Chaperone protein DnaJ 1 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=dnaJ1 PE=3 SV=1 Back     alignment and function description
>sp|B9MJZ0|DNAJ_CALBD Chaperone protein DnaJ OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q5E3A8|DNAJ_VIBF1 Chaperone protein DnaJ OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dnaJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
224067160230 predicted protein [Populus trichocarpa] 0.893 0.769 0.762 3e-72
255537962246 heat shock protein binding protein, puta 0.909 0.731 0.770 6e-69
224081863255 predicted protein [Populus trichocarpa] 0.883 0.686 0.721 1e-68
297813203234 hypothetical protein ARALYDRAFT_351886 [ 0.924 0.782 0.659 4e-65
356510636226 PREDICTED: uncharacterized protein LOC10 0.924 0.809 0.718 2e-63
225458924249 PREDICTED: uncharacterized protein LOC10 0.934 0.742 0.753 1e-62
449450314244 PREDICTED: uncharacterized protein LOC10 0.914 0.741 0.719 5e-62
19310566277 unknown protein [Arabidopsis thaliana] 0.883 0.631 0.648 1e-59
334186393230 chaperone DnaJ-domain containing protein 0.904 0.778 0.632 4e-59
334186395216 chaperone DnaJ-domain containing protein 0.883 0.810 0.648 7e-59
>gi|224067160|ref|XP_002302385.1| predicted protein [Populus trichocarpa] gi|222844111|gb|EEE81658.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  276 bits (706), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 153/181 (84%), Gaps = 4/181 (2%)

Query: 17  SLARPQSSWKGASGS--SFRSSFQEEAWKRYNRRMREEYEEEMERVERIRRMQSVFNRER 74
           +L R QS+WKGA+GS  SFR+ FQEEA K YNRRM+E YEEEMERVERIRRMQSVFNRER
Sbjct: 49  ALTRSQSAWKGATGSARSFRTYFQEEACKNYNRRMQEAYEEEMERVERIRRMQSVFNRER 108

Query: 75  NKYKKSYESWRQNDYDNGTYHHHFQRDDWYWKADPSYRQQRTNFRQPPRESESYSLSHHY 134
           NKY + +E WR+N    G YH +FQRDDWYWK D S+R+QRTNFR+  R+S SYSLSHHY
Sbjct: 109 NKYTRDHEKWRENG--PGAYHQNFQRDDWYWKTDTSFREQRTNFRRTSRDSGSYSLSHHY 166

Query: 135 SVLGLDRLRKAPYTEAEIKTAFRAKAKEFHPDQNQGNKEAAEAKFKEVMVSYEAIKQERK 194
           SVLGLDR R  PYTEAEIKTAFR KAKEFHPDQNQ NKEAAEAKFKEVM+SYEAIK ERK
Sbjct: 167 SVLGLDRSRTIPYTEAEIKTAFRTKAKEFHPDQNQDNKEAAEAKFKEVMISYEAIKLERK 226

Query: 195 D 195
           +
Sbjct: 227 N 227




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255537962|ref|XP_002510046.1| heat shock protein binding protein, putative [Ricinus communis] gi|223550747|gb|EEF52233.1| heat shock protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224081863|ref|XP_002306506.1| predicted protein [Populus trichocarpa] gi|222855955|gb|EEE93502.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297813203|ref|XP_002874485.1| hypothetical protein ARALYDRAFT_351886 [Arabidopsis lyrata subsp. lyrata] gi|297320322|gb|EFH50744.1| hypothetical protein ARALYDRAFT_351886 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356510636|ref|XP_003524043.1| PREDICTED: uncharacterized protein LOC100812371 [Glycine max] Back     alignment and taxonomy information
>gi|225458924|ref|XP_002285499.1| PREDICTED: uncharacterized protein LOC100248937 [Vitis vinifera] gi|302142151|emb|CBI19354.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449450314|ref|XP_004142908.1| PREDICTED: uncharacterized protein LOC101213280 [Cucumis sativus] gi|449494391|ref|XP_004159534.1| PREDICTED: uncharacterized LOC101213280 [Cucumis sativus] Back     alignment and taxonomy information
>gi|19310566|gb|AAL85016.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334186393|ref|NP_567329.2| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] gi|332657188|gb|AEE82588.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334186395|ref|NP_001190686.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] gi|21689789|gb|AAM67538.1| unknown protein [Arabidopsis thaliana] gi|332657189|gb|AEE82589.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
UNIPROTKB|F1SR79 325 DNAJB2 "Uncharacterized protei 0.272 0.166 0.5 1.5e-07
DICTYBASE|DDB_G0291568 459 dnaja1 "DnaJ homolog subfamily 0.277 0.119 0.473 1.7e-07
TIGR_CMR|CBU_1289 374 CBU_1289 "chaperone protein dn 0.232 0.122 0.531 2e-07
UNIPROTKB|B0CM59 277 DNAJB2 "DnaJ homolog, subfamil 0.222 0.158 0.522 2.9e-07
MGI|MGI:1928739 277 Dnajb2 "DnaJ (Hsp40) homolog, 0.222 0.158 0.522 2.9e-07
UNIPROTKB|Q58DD3 278 DNAJB2 "DnaJ (Hsp40) homolog, 0.222 0.158 0.522 2.9e-07
UNIPROTKB|P25686 324 DNAJB2 "DnaJ homolog subfamily 0.222 0.135 0.522 4.1e-07
UNIPROTKB|B0KWI7 324 DNAJB2 "DnaJ homolog, subfamil 0.222 0.135 0.522 4.1e-07
UNIPROTKB|P08622 376 dnaJ [Escherichia coli K-12 (t 0.227 0.119 0.5 5.5e-07
TIGR_CMR|SPO_0044 381 SPO_0044 "chaperone protein Dn 0.217 0.112 0.545 6.1e-06
UNIPROTKB|F1SR79 DNAJB2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 126 (49.4 bits), Expect = 1.5e-07, P = 1.5e-07
 Identities = 28/56 (50%), Positives = 36/56 (64%)

Query:   139 LDRLRKAPYTEAEIKTAFRAKAKEFHPDQNQGNKEAAEAKFKEVMVSYEAIKQERK 194
             LD  R A  T  +IK A+R KA ++HPD+N  NKE AE KFKEV  +YE +  + K
Sbjct:     8 LDVPRSA--TADDIKKAYRKKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHK 61




GO:0090086 "negative regulation of protein deubiquitination" evidence=IEA
GO:0090084 "negative regulation of inclusion body assembly" evidence=IEA
GO:0070628 "proteasome binding" evidence=IEA
GO:0032436 "positive regulation of proteasomal ubiquitin-dependent protein catabolic process" evidence=IEA
GO:0031593 "polyubiquitin binding" evidence=IEA
GO:0031398 "positive regulation of protein ubiquitination" evidence=IEA
GO:0030544 "Hsp70 protein binding" evidence=IEA
GO:0030433 "ER-associated protein catabolic process" evidence=IEA
GO:0030308 "negative regulation of cell growth" evidence=IEA
GO:0016234 "inclusion body" evidence=IEA
GO:0008285 "negative regulation of cell proliferation" evidence=IEA
GO:0000502 "proteasome complex" evidence=IEA
DICTYBASE|DDB_G0291568 dnaja1 "DnaJ homolog subfamily A member 1" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1289 CBU_1289 "chaperone protein dnaJ" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|B0CM59 DNAJB2 "DnaJ homolog, subfamily B, member 2, isoform 1 (Predicted)" [Papio anubis (taxid:9555)] Back     alignment and assigned GO terms
MGI|MGI:1928739 Dnajb2 "DnaJ (Hsp40) homolog, subfamily B, member 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q58DD3 DNAJB2 "DnaJ (Hsp40) homolog, subfamily B, member 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P25686 DNAJB2 "DnaJ homolog subfamily B member 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B0KWI7 DNAJB2 "DnaJ homolog, subfamily B, member 2 isoform b (Predicted)" [Callithrix jacchus (taxid:9483)] Back     alignment and assigned GO terms
UNIPROTKB|P08622 dnaJ [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0044 SPO_0044 "chaperone protein DnaJ" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 5e-14
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 7e-13
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 2e-12
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 5e-12
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 6e-11
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 7e-11
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 1e-10
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 1e-10
pfam0022663 pfam00226, DnaJ, DnaJ domain 3e-10
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 6e-10
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 1e-09
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 3e-09
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 3e-09
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 6e-09
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 2e-08
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 3e-08
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 4e-08
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 7e-08
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 7e-08
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 8e-08
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 5e-07
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 8e-07
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 2e-06
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 4e-06
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 6e-06
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 7e-06
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 3e-05
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 4e-05
PRK10266 306 PRK10266, PRK10266, curved DNA-binding protein Cbp 5e-05
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 5e-05
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 1e-04
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 2e-04
PRK14299 291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 3e-04
COG2214 237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 3e-04
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 0.001
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
 Score = 69.0 bits (170), Expect = 5e-14
 Identities = 29/61 (47%), Positives = 40/61 (65%), Gaps = 5/61 (8%)

Query: 134 YSVLGLDRLRKAPYTEAEIKTAFRAKAKEFHPDQNQGNKEAAEAKFKEVMVSYEAIKQER 193
           Y VLG+ R   A  +E EIK A+R  A ++HPD+N G+KE AE KFKE+  +YE +   +
Sbjct: 7   YEVLGVSR--NA--SEDEIKKAYRKLAMKYHPDRNPGDKE-AEEKFKEIKEAYEVLSDPQ 61

Query: 194 K 194
           K
Sbjct: 62  K 62


Length = 371

>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 198
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.82
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 99.79
PRK14288 369 chaperone protein DnaJ; Provisional 99.71
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.69
PRK14296 372 chaperone protein DnaJ; Provisional 99.68
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.68
PRK14279 392 chaperone protein DnaJ; Provisional 99.67
PRK14282 369 chaperone protein DnaJ; Provisional 99.66
PRK14286 372 chaperone protein DnaJ; Provisional 99.65
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.65
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 99.64
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.64
PRK14285 365 chaperone protein DnaJ; Provisional 99.63
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.63
KOG0716 279 consensus Molecular chaperone (DnaJ superfamily) [ 99.63
PRK14295 389 chaperone protein DnaJ; Provisional 99.62
PRK14277 386 chaperone protein DnaJ; Provisional 99.62
PRK14287 371 chaperone protein DnaJ; Provisional 99.62
PRK14299 291 chaperone protein DnaJ; Provisional 99.62
PRK14294 366 chaperone protein DnaJ; Provisional 99.61
PRK14283 378 chaperone protein DnaJ; Provisional 99.61
PRK14297 380 chaperone protein DnaJ; Provisional 99.61
PRK14301 373 chaperone protein DnaJ; Provisional 99.61
PRK14284 391 chaperone protein DnaJ; Provisional 99.61
PRK14290 365 chaperone protein DnaJ; Provisional 99.6
PRK14298 377 chaperone protein DnaJ; Provisional 99.6
PRK14276 380 chaperone protein DnaJ; Provisional 99.6
PRK10767 371 chaperone protein DnaJ; Provisional 99.6
PRK14291 382 chaperone protein DnaJ; Provisional 99.6
PRK14278 378 chaperone protein DnaJ; Provisional 99.6
KOG0691 296 consensus Molecular chaperone (DnaJ superfamily) [ 99.6
PRK14281 397 chaperone protein DnaJ; Provisional 99.59
PRK14280 376 chaperone protein DnaJ; Provisional 99.59
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.56
PRK14292 371 chaperone protein DnaJ; Provisional 99.56
KOG0715 288 consensus Molecular chaperone (DnaJ superfamily) [ 99.55
PRK14289 386 chaperone protein DnaJ; Provisional 99.55
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.55
COG2214 237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.54
PRK14300 372 chaperone protein DnaJ; Provisional 99.53
PRK14293 374 chaperone protein DnaJ; Provisional 99.51
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.49
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.49
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.49
KOG0719 264 consensus Molecular chaperone (DnaJ superfamily) [ 99.47
PRK05014 171 hscB co-chaperone HscB; Provisional 99.46
PRK01356166 hscB co-chaperone HscB; Provisional 99.43
PHA03102153 Small T antigen; Reviewed 99.41
PRK00294173 hscB co-chaperone HscB; Provisional 99.38
PRK03578 176 hscB co-chaperone HscB; Provisional 99.38
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.37
PTZ00100116 DnaJ chaperone protein; Provisional 99.35
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.33
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.28
KOG0714 306 consensus Molecular chaperone (DnaJ superfamily) [ 99.19
KOG0720 490 consensus Molecular chaperone (DnaJ superfamily) [ 99.18
KOG0722 329 consensus Molecular chaperone (DnaJ superfamily) [ 99.16
KOG1150 250 consensus Predicted molecular chaperone (DnaJ supe 99.15
PRK01773 173 hscB co-chaperone HscB; Provisional 99.14
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.14
PHA02624 647 large T antigen; Provisional 99.03
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 98.96
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.88
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.65
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.56
KOG0568 342 consensus Molecular chaperone (DnaJ superfamily) [ 98.23
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 98.18
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 97.55
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 97.14
KOG0431453 consensus Auxilin-like protein and related protein 96.57
COG1076 174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.01
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 95.97
PF1344662 RPT: A repeated domain in UCH-protein 94.83
PF14687112 DUF4460: Domain of unknown function (DUF4460) 85.51
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.82  E-value=8.8e-21  Score=172.32  Aligned_cols=63  Identities=41%  Similarity=0.694  Sum_probs=59.0

Q ss_pred             hhhhhhhhCcCCCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChHHHHHHHHHHHHHHHHccCcccccC
Q 029159          130 LSHHYSVLGLDRLRKAPYTEAEIKTAFRAKAKEFHPDQNQGNKEAAEAKFKEVMVSYEAIKQERKDMN  197 (198)
Q Consensus       130 ~~d~Y~ILGL~~~a~~~~t~~eIKkAYRkLakk~HPDk~~~~~~~A~e~Fk~In~AYevL~dp~kR~~  197 (198)
                      ..|||+||||+++|    |.+|||+|||+||++||||+|++++ +|+++|++|++||+||+||.+|..
T Consensus         3 ~~dyYeiLGV~k~A----s~~EIKkAYRkLA~kyHPD~n~g~~-~AeeKFKEI~eAYEVLsD~eKRa~   65 (371)
T COG0484           3 KRDYYEILGVSKDA----SEEEIKKAYRKLAKKYHPDRNPGDK-EAEEKFKEINEAYEVLSDPEKRAA   65 (371)
T ss_pred             ccchhhhcCCCCCC----CHHHHHHHHHHHHHHhCCCCCCCCH-HHHHHHHHHHHHHHHhCCHHHHHH
Confidence            36899999999999    9999999999999999999999754 799999999999999999999964



>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>PF14687 DUF4460: Domain of unknown function (DUF4460) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 2e-05
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 2e-05
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-05
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 3e-05
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 3e-04
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 4e-04
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure

Iteration: 1

Score = 45.4 bits (106), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 23/46 (50%), Positives = 34/46 (73%), Gaps = 1/46 (2%) Query: 149 EAEIKTAFRAKAKEFHPDQNQGNKEAAEAKFKEVMVSYEAIKQERK 194 E EI+ A++ A ++HPD+NQG+KE AEAKFKE+ +YE + +K Sbjct: 17 EREIRKAYKRLAMKYHPDRNQGDKE-AEAKFKEIKEAYEVLTDSQK 61
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 1e-14
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 6e-14
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 2e-13
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 2e-13
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 2e-13
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 5e-12
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 1e-11
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 1e-11
3apq_A 210 DNAJ homolog subfamily C member 10; thioredoxin fo 2e-11
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 4e-11
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 1e-09
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 1e-09
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 1e-09
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 2e-09
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 2e-09
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 2e-09
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 2e-09
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 3e-09
2pf4_E 174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 4e-09
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 6e-09
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 1e-08
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 4e-08
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 9e-08
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 3e-07
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-07
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 1e-04
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 2e-04
3hho_A 174 CO-chaperone protein HSCB homolog; structural geno 6e-04
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
 Score = 69.6 bits (171), Expect = 1e-14
 Identities = 27/102 (26%), Positives = 46/102 (45%), Gaps = 19/102 (18%)

Query: 94  YHHHFQRDDWYWKADPSYRQQRT-NFRQPPRESESYSLSHHYSVLGLDRLRKAPYTEAEI 152
           +HHH          +  Y Q      +              Y++LG+            I
Sbjct: 2   HHHHHHSSGVDLGTENLYFQSNAMELKDY------------YAILGVQP--TD--DLKTI 45

Query: 153 KTAFRAKAKEFHPDQNQGNKEAAEAKFKEVMVSYEAIKQERK 194
           KTA+R  A+++HPD ++ N   AEAKFK++  ++E +K E++
Sbjct: 46  KTAYRRLARKYHPDVSKEND--AEAKFKDLAEAWEVLKDEQR 85


>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.78
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.76
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.76
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.74
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.74
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.74
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.74
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.73
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.73
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.73
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.72
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.72
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.71
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.7
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.7
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.67
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.67
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.66
2guz_A71 Mitochondrial import inner membrane translocase su 99.66
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.66
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.64
3apq_A 210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.64
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.62
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.61
3hho_A 174 CO-chaperone protein HSCB homolog; structural geno 99.59
1fpo_A 171 HSC20, chaperone protein HSCB; molecular chaperone 99.59
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.57
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.56
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.56
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.55
2pf4_E 174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.5
3uo3_A 181 J-type CO-chaperone JAC1, mitochondrial; structura 99.46
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.37
2guz_B65 Mitochondrial import inner membrane translocase su 99.06
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.87
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
Probab=99.78  E-value=3.3e-19  Score=128.10  Aligned_cols=64  Identities=38%  Similarity=0.606  Sum_probs=59.6

Q ss_pred             ChhhhhhhhCcCCCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChHHHHHHHHHHHHHHHHccCccccc
Q 029159          129 SLSHHYSVLGLDRLRKAPYTEAEIKTAFRAKAKEFHPDQNQGNKEAAEAKFKEVMVSYEAIKQERKDM  196 (198)
Q Consensus       129 ~~~d~Y~ILGL~~~a~~~~t~~eIKkAYRkLakk~HPDk~~~~~~~A~e~Fk~In~AYevL~dp~kR~  196 (198)
                      .+.++|+||||++++    +.++||+||++|++++|||++++..+.+.+.|+.|++||++|+||.+|.
T Consensus         7 ~~~~~y~iLgv~~~a----s~~eIk~ayr~l~~~~HPDk~~~~~~~a~~~f~~i~~Ay~~L~d~~~R~   70 (82)
T 2ej7_A            7 GMVDYYEVLDVPRQA----SSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRD   70 (82)
T ss_dssp             SSCCHHHHTTCCTTC----CHHHHHHHHHHHHTTSCTTTCSTTHHHHHHHHHHHHHHHHHHSSTTHHH
T ss_pred             CCcCHHHHcCCCCCC----CHHHHHHHHHHHHHHHCcCCCCCcHHHHHHHHHHHHHHHHHHCCHHHHH
Confidence            457899999999998    9999999999999999999998877789999999999999999999875



>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 198
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 1e-05
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 2e-04
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 7e-04
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Auxilin J-domain
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 40.3 bits (94), Expect = 1e-05
 Identities = 12/65 (18%), Positives = 28/65 (43%), Gaps = 6/65 (9%)

Query: 132 HHYSVLGLDRLRKAPYTEAEIKTAFRAKAKEFHPDQNQGN--KEAAEAKFKEVMVSYEAI 189
             +  +G+  L     T  ++K  +R      HPD+  G   ++ A+  F E+  ++   
Sbjct: 34  TKWKPVGMADLV----TPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEF 89

Query: 190 KQERK 194
           + + +
Sbjct: 90  ENQGQ 94


>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.78
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.73
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.7
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.69
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.67
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.67
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.56
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]
Probab=99.78  E-value=8.8e-20  Score=128.73  Aligned_cols=61  Identities=41%  Similarity=0.738  Sum_probs=56.6

Q ss_pred             hhhhhhhCcCCCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChHHHHHHHHHHHHHHHHccCccccc
Q 029159          131 SHHYSVLGLDRLRKAPYTEAEIKTAFRAKAKEFHPDQNQGNKEAAEAKFKEVMVSYEAIKQERKDM  196 (198)
Q Consensus       131 ~d~Y~ILGL~~~a~~~~t~~eIKkAYRkLakk~HPDk~~~~~~~A~e~Fk~In~AYevL~dp~kR~  196 (198)
                      .|||+||||++++    |.++||+||++|++++|||+++++. .+++.|..|++||+||+||.+|.
T Consensus         3 ~dyY~vLgv~~~A----s~~eIk~aYr~l~~~~HPDk~~~~~-~~~~~f~~i~~Ay~vL~d~~~R~   63 (75)
T d1xbla_           3 QDYYEILGVSKTA----EEREIRKAYKRLAMKYHPDRNQGDK-EAEAKFKEIKEAYEVLTDSQKRA   63 (75)
T ss_dssp             CCTTTTTCCSSSC----CHHHHHHHHHHHHHHTCCTTCTTTC-HHHHHHHHHHHHHHHTTSSHHHH
T ss_pred             CCHHHHcCCCCCc----CHHHHHHHHHHHHhhhhhhccCCCh-HHHHHHHHHHHHHHhcCCHHHHH
Confidence            5899999999999    9999999999999999999998654 57889999999999999999875



>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure